A0A5K4FD14_SCHMA Loading...

Fibrinogen and fibronectin

AlphaFold DB , UniProt , Accession A0A5K4FD14, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 127 aa.

						>A0A5K4FD14_SCHMA|A0A5K4FD14
MIIQNAPNDLLSYTSNDIFKMIELVKEALTKLTTSSLSQLMMIRTRIGYLDRLTDRLLDYRRQAELARTRVSQTQKLIDKALLEQQEKTTQLAQLKNSCKKLVSFLEDELSRICNRQVQITGQFCDL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.5	Very low	62	Low	213 Å²	213	117.1 Å²	117.1	100%	1.049	62%	0.617	S	S	*	*				0	70.6	0	-169.7	176.3	56.6	0	0	109.3
2	I	52.9	Low	63.4	Low	169 Å²	169	115.1 Å²	115.1	87%	0.867	62%	0.62	S	S	*	*			trans	-134.1	66.1	-179.2	-53.2	172.7	0	0	0	108.3
3	I	54.1	Low	64.6	Low	42 Å²	42	113.8 Å²	113.8	22%	0.215	60%	0.602	C	S	.	*			trans	-135.8	-1.7	170.1	-45.6	169.4	0	0	0	111.2	N5 A6 I18	I3-N5 PolarHBondContact O-N 3.14Å; I3-N5 VanDerWaalsContact O-N 3.07Å; I3-A6 HydrophobicContact CG2-CB 3.62Å; I3-A6 WeakPolarHBondContact O-CB 3.31Å; I3-A6 PolarHBondContact O-N 3.5Å; I3-I18 HydrophobicContact CD1-CD1 3.34Å; I3-I18 HydrophobicContact CD1-CG1 4.41Å; I3-I18 HydrophobicContact CG1-CD1 3.66Å; I3-I18 HydrophobicContact CG2-CD1 4.42Å
4	Q	57.8	Low	65.9	Low	161 Å²	161	110.9 Å²	110.9	75%	0.752	59%	0.591	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63	-22.1	-176.1	-72	-176.2	-13.1	0	0	114.4
5	N	64.4	Low	67.1	Low	166 Å²	166	107.8 Å²	107.8	89%	0.888	58%	0.582	S	S	*	*	T	Hydrogen-bonded Turn	trans	-111.1	17.3	178.6	-63.7	-18.1	0	0	0	112.8	I3	I3-N5 PolarHBondContact O-N 3.14Å; I3-N5 VanDerWaalsContact O-N 3.07Å
6	A	60.1	Low	68.3	Low	24 Å²	24	107.9 Å²	107.9	20%	0.198	58%	0.582	C	S	.	*	S	Bend	trans	-77.9	142.2	176.7	0	0	0	0	0	109.7	I3 L10	I3-A6 HydrophobicContact CG2-CB 3.62Å; I3-A6 WeakPolarHBondContact O-CB 3.31Å; I3-A6 PolarHBondContact O-N 3.5Å; A6-L10 HydrophobicContact CB-CB 3.62Å; A6-L10 HydrophobicContact CB-CD1 3.95Å; A6-L10 HydrophobicContact CB-CG 4.44Å
7	P	69	Low	69.5	Low	83 Å²	83	104.5 Å²	104.5	54%	0.539	56%	0.563	S	S	.	*			trans	-48.5	148.3	173.4	14.7	-29.3	0	0	0	111.6	D9 L10	P7-D9 PolarHBondContact O-N 3.04Å; P7-L10 HydrophobicContact CG-CD1 3.83Å; P7-L10 HydrophobicContact CG-CG 4.25Å; P7-L10 WeakPolarHBondContact O-CA 3.26Å; P7-L10 WeakPolarHBondContact O-CB 3.31Å; P7-L10 PolarHBondContact O-N 2.87Å
8	N	70.3	Confident	70.4	Confident	136 Å²	136	101.3 Å²	101.3	73%	0.727	55%	0.546	S	S	*	.	H	α-helix	trans	-49	-33.2	-171.5	-77.5	-14.7	0	0	0	114.1	L10 L11	N8-L10 PolarHBondContact O-N 3.45Å; N8-L11 WeakPolarHBondContact O-CB 3.13Å; N8-L11 PolarHBondContact O-N 3.04Å; N8-L11 WeakPolarHBondContact OD1-CD1 3.33Å
9	D	71.5	Confident	71.4	Confident	134 Å²	134	102.4 Å²	102.4	72%	0.717	55%	0.545	S	S	*	.	H	α-helix	trans	-59.7	-33.2	176.9	-56	-29	0	0	0	112.6	P7 S12 Y13	P7-D9 PolarHBondContact O-N 3.04Å; D9-S12 PolarHBondContact O-OG 3.36Å; D9-Y13 WeakPolarHBondContact O-CD2 3.21Å; D9-Y13 VanDerWaalsContact O-CE2 3.24Å; D9-Y13 WeakPolarHBondContact O-CE2 3.32Å
10	L	66.6	Low	72.5	Confident	64 Å²	64	104 Å²	104	34%	0.335	55%	0.547	S	S	.	.	H	α-helix	trans	-84.3	-17.4	179.9	-67.8	177.4	0	0	0	113.8	A6 P7 N8 S12 Y13	A6-L10 HydrophobicContact CB-CB 3.62Å; A6-L10 HydrophobicContact CB-CD1 3.95Å; A6-L10 HydrophobicContact CB-CG 4.44Å; P7-L10 HydrophobicContact CG-CD1 3.83Å; P7-L10 HydrophobicContact CG-CG 4.25Å; P7-L10 WeakPolarHBondContact O-CA 3.26Å; P7-L10 WeakPolarHBondContact O-CB 3.31Å; P7-L10 PolarHBondContact O-N 2.87Å; N8-L10 PolarHBondContact O-N 3.45Å; L10-S12 PolarHBondContact O-N 3.29Å; L10-Y13 HydrophobicContact CD2-CD2 4.17Å; L10-Y13 HydrophobicContact CD2-CE2 4.36Å; L10-Y13 WeakPolarHBondContact O-CB 3.15Å; L10-Y13 PolarHBondContact O-N 3.44Å
11	L	69.7	Low	73.4	Confident	96 Å²	96	103.2 Å²	103.2	50%	0.503	54%	0.542	S	S	.	.	H	α-helix	trans	-64.1	-24.1	179.2	-67.4	174.5	0	0	0	112.5	N8 Y13	N8-L11 WeakPolarHBondContact O-CB 3.13Å; N8-L11 PolarHBondContact O-N 3.04Å; N8-L11 WeakPolarHBondContact OD1-CD1 3.33Å; L11-Y13 VanDerWaalsContact C-N 3.29Å
12	S	78.4	Confident	75.6	Confident	93 Å²	93	96.7 Å²	96.7	65%	0.65	51%	0.51	S	S	*	.	T	Hydrogen-bonded Turn	trans	-75.3	-16.2	175.6	66.4	0	0	0	0	113.8	D9 L10	D9-S12 PolarHBondContact O-OG 3.36Å; L10-S12 PolarHBondContact O-N 3.29Å
13	Y	79.1	Confident	77.6	Confident	98 Å²	98	93.5 Å²	93.5	38%	0.384	49%	0.491	S	S	.	.	S	Bend	trans	-86.2	126.7	-176.9	-70.5	-100	0	0	0	110	D9 L10 L11 D17 M21	D9-Y13 WeakPolarHBondContact O-CD2 3.21Å; D9-Y13 VanDerWaalsContact O-CE2 3.24Å; D9-Y13 WeakPolarHBondContact O-CE2 3.32Å; L10-Y13 HydrophobicContact CD2-CD2 4.17Å; L10-Y13 HydrophobicContact CD2-CE2 4.36Å; L10-Y13 WeakPolarHBondContact O-CB 3.15Å; L10-Y13 PolarHBondContact O-N 3.44Å; L11-Y13 VanDerWaalsContact C-N 3.29Å; Y13-D17 HydrophobicContact CD1-CB 3.73Å; Y13-D17 HydrophobicContact CG-CB 4.42Å; Y13-M21 HydrophobicContact CD1-SD 4.08Å; Y13-M21 HydrophobicContact CE1-SD 4.03Å
14	T	82.7	Confident	79.5	Confident	73 Å²	73	96.8 Å²	96.8	45%	0.448	51%	0.509	S	S	.	.			trans	-71.1	160.9	172.2	68.3	0	0	0	0	110	N16 D17 I18	T14-N16 PolarHBondContact O-N 2.9Å; T14-N16 VanDerWaalsContact O-N 3.11Å; T14-N16 PolarHBondContact OG1-N 3.32Å; T14-D17 WeakPolarHBondContact CB-OD2 3.46Å; T14-D17 PolarHBondContact N-OD2 3.27Å; T14-D17 PolarHBondContact O-N 3.49Å; T14-D17 PolarHBondContact OG1-N 2.65Å; T14-D17 PolarHBondContact OG1-OD2 3.49Å; T14-I18 PolarHBondContact O-N 2.86Å; T14-I18 VanDerWaalsContact O-N 3.15Å
15	S	84	Confident	81.1	Confident	65 Å²	65	93.9 Å²	93.9	46%	0.455	50%	0.502	S	S	.	.	H	α-helix	trans	-53.7	-34.1	172.2	-167.9	0	0	0	0	111.6	I18 F19	S15-I18 PolarHBondContact O-N 2.86Å; S15-F19 WeakPolarHBondContact O-CD2 3.38Å; S15-F19 PolarHBondContact O-N 3.43Å; S15-F19 VanDerWaalsContact OG-CE2 3.24Å; S15-F19 WeakPolarHBondContact OG-CE2 3.36Å
16	N	87.5	Confident	82.6	Confident	110 Å²	110	91.2 Å²	91.2	59%	0.588	48%	0.483	S	S	*	.	H	α-helix	trans	-65.7	-37	176.5	-70.5	-18.3	0	0	0	112.2	T14 F19 K20	T14-N16 PolarHBondContact O-N 2.9Å; T14-N16 VanDerWaalsContact O-N 3.11Å; T14-N16 PolarHBondContact OG1-N 3.32Å; N16-F19 PolarHBondContact O-N 3.05Å; N16-K20 VanDerWaalsContact O-CG 3.27Å; N16-K20 WeakPolarHBondContact O-CG 3.48Å; N16-K20 PolarHBondContact O-N 2.84Å
17	D	87.8	Confident	84.2	Confident	49 Å²	49	94.4 Å²	94.4	26%	0.262	49%	0.493	S	S	.	.	H	α-helix	trans	-68.3	-40.7	177.3	-55.6	-46.1	0	0	0	111	Y13 T14 K20 M21	Y13-D17 HydrophobicContact CD1-CB 3.73Å; Y13-D17 HydrophobicContact CG-CB 4.42Å; T14-D17 WeakPolarHBondContact CB-OD2 3.46Å; T14-D17 PolarHBondContact N-OD2 3.27Å; T14-D17 PolarHBondContact O-N 3.49Å; T14-D17 PolarHBondContact OG1-N 2.65Å; T14-D17 PolarHBondContact OG1-OD2 3.49Å; D17-K20 WeakPolarHBondContact O-CB 3.32Å; D17-K20 PolarHBondContact O-N 3.37Å; D17-M21 VanDerWaalsContact O-CG 3.3Å; D17-M21 WeakPolarHBondContact O-CG 3.42Å; D17-M21 PolarHBondContact O-N 2.94Å
18	I	86.4	Confident	85.2	Confident	48 Å²	48	93 Å²	93	25%	0.246	49%	0.489	C	S	.	.	H	α-helix	trans	-62.8	-46	173.7	-61.5	-174.7	0	0	0	111	I3 T14 S15 K20 M21 I22	I3-I18 HydrophobicContact CD1-CD1 3.34Å; I3-I18 HydrophobicContact CD1-CG1 4.41Å; I3-I18 HydrophobicContact CG1-CD1 3.66Å; I3-I18 HydrophobicContact CG2-CD1 4.42Å; T14-I18 PolarHBondContact O-N 2.86Å; T14-I18 VanDerWaalsContact O-N 3.15Å; S15-I18 PolarHBondContact O-N 2.86Å; I18-K20 VanDerWaalsContact C-N 3.3Å; I18-K20 PolarHBondContact O-N 3.05Å; I18-M21 PolarHBondContact O-N 2.74Å; I18-M21 VanDerWaalsContact O-N 3.16Å; I18-I22 HydrophobicContact CG2-CD1 3.88Å; I18-I22 HydrophobicContact CG2-CG1 4.37Å; I18-I22 WeakPolarHBondContact O-CG1 3.38Å; I18-I22 PolarHBondContact O-N 3.29Å
19	F	89.3	Confident	86.1	Confident	122 Å²	122	92.3 Å²	92.3	54%	0.535	49%	0.485	S	S	.	.	H	α-helix	trans	-58.6	-43.6	176.2	-80.4	-61.6	0	0	0	111.3	S15 N16 M21 I22 E23	S15-F19 WeakPolarHBondContact O-CD2 3.38Å; S15-F19 PolarHBondContact O-N 3.43Å; S15-F19 VanDerWaalsContact OG-CE2 3.24Å; S15-F19 WeakPolarHBondContact OG-CE2 3.36Å; N16-F19 PolarHBondContact O-N 3.05Å; F19-M21 PolarHBondContact O-N 3.37Å; F19-I22 PolarHBondContact O-N 2.79Å; F19-E23 WeakPolarHBondContact O-CG 3.33Å; F19-E23 PolarHBondContact O-N 3.36Å
20	K	92.4	Very high	87.1	Confident	133 Å²	133	91.3 Å²	91.3	58%	0.578	48%	0.484	S	S	*	.	H	α-helix	trans	-59.7	-44.9	173.8	-73	170.3	-175.7	172.9	0	112.2	N16 D17 I18 I22 E23 L24	N16-K20 VanDerWaalsContact O-CG 3.27Å; N16-K20 WeakPolarHBondContact O-CG 3.48Å; N16-K20 PolarHBondContact O-N 2.84Å; D17-K20 WeakPolarHBondContact O-CB 3.32Å; D17-K20 PolarHBondContact O-N 3.37Å; I18-K20 VanDerWaalsContact C-N 3.3Å; I18-K20 PolarHBondContact O-N 3.05Å; K20-I22 PolarHBondContact O-N 2.93Å; K20-E23 PolarHBondContact O-N 3.14Å; K20-L24 VanDerWaalsContact O-CG 3.3Å; K20-L24 WeakPolarHBondContact O-CG 3.5Å; K20-L24 PolarHBondContact O-N 3.45Å
21	M	91.4	Very high	88.2	Confident	89 Å²	89	94.8 Å²	94.8	44%	0.438	50%	0.496	S	S	.	.	H	α-helix	trans	-61.7	-43.5	177.7	-70.6	175	78.7	0	0	111.9	Y13 D17 I18 F19 E23 L24 V25	Y13-M21 HydrophobicContact CD1-SD 4.08Å; Y13-M21 HydrophobicContact CE1-SD 4.03Å; D17-M21 VanDerWaalsContact O-CG 3.3Å; D17-M21 WeakPolarHBondContact O-CG 3.42Å; D17-M21 PolarHBondContact O-N 2.94Å; I18-M21 PolarHBondContact O-N 2.74Å; I18-M21 VanDerWaalsContact O-N 3.16Å; F19-M21 PolarHBondContact O-N 3.37Å; M21-E23 VanDerWaalsContact C-N 3.34Å; M21-E23 PolarHBondContact O-N 2.95Å; M21-L24 PolarHBondContact O-N 3.48Å; M21-V25 WeakPolarHBondContact O-CG2 3.38Å; M21-V25 PolarHBondContact O-N 3.35Å
22	I	92.1	Very high	89.2	Confident	76 Å²	76	94 Å²	94	39%	0.39	49%	0.492	S	S	.	.	H	α-helix	trans	-60.7	-45.6	176.2	-69.9	169.8	0	0	0	110.4	I18 F19 K20 V25 K26	I18-I22 HydrophobicContact CG2-CD1 3.88Å; I18-I22 HydrophobicContact CG2-CG1 4.37Å; I18-I22 WeakPolarHBondContact O-CG1 3.38Å; I18-I22 PolarHBondContact O-N 3.29Å; F19-I22 PolarHBondContact O-N 2.79Å; K20-I22 PolarHBondContact O-N 2.93Å; I22-V25 PolarHBondContact O-N 2.87Å; I22-K26 HydrophobicContact CG2-CD 4.3Å; I22-K26 HydrophobicContact CG2-CG 4.48Å; I22-K26 WeakPolarHBondContact O-CG 3.36Å; I22-K26 PolarHBondContact O-N 3.12Å
23	E	94.8	Very high	89.9	Confident	101 Å²	101	93.4 Å²	93.4	47%	0.472	48%	0.484	S	S	.	.	H	α-helix	trans	-63.7	-40.3	177.8	-69.2	-55.1	120.3	0	0	111.8	F19 K20 M21 V25 K26 E27	F19-E23 WeakPolarHBondContact O-CG 3.33Å; F19-E23 PolarHBondContact O-N 3.36Å; K20-E23 PolarHBondContact O-N 3.14Å; M21-E23 VanDerWaalsContact C-N 3.34Å; M21-E23 PolarHBondContact O-N 2.95Å; E23-V25 PolarHBondContact O-N 3.37Å; E23-K26 PolarHBondContact O-N 3.03Å; E23-K26 IonicContact OE1-NZ 2.79Å; E23-K26 PolarHBondContact OE1-NZ 2.97Å; E23-E27 WeakPolarHBondContact O-CB 3.39Å; E23-E27 PolarHBondContact O-N 2.93Å
24	L	93.8	Very high	90.5	Very high	111 Å²	111	94.9 Å²	94.9	58%	0.581	50%	0.504	S	S	*	.	H	α-helix	trans	-61.4	-41	173.3	-72.1	171.9	0	0	0	112.5	K20 M21 E27 A28	K20-L24 VanDerWaalsContact O-CG 3.3Å; K20-L24 WeakPolarHBondContact O-CG 3.5Å; K20-L24 PolarHBondContact O-N 3.45Å; M21-L24 PolarHBondContact O-N 3.48Å; L24-E27 PolarHBondContact O-N 3.19Å; L24-A28 WeakPolarHBondContact O-CB 3.41Å; L24-A28 PolarHBondContact O-N 3.27Å
25	V	92.8	Very high	90.9	Very high	101 Å²	101	94.8 Å²	94.8	61%	0.612	51%	0.506	S	S	*	.	H	α-helix	trans	-67.3	-43.2	176.9	171.2	0	0	0	0	111	M21 I22 E23 E27 A28 L29	M21-V25 WeakPolarHBondContact O-CG2 3.38Å; M21-V25 PolarHBondContact O-N 3.35Å; I22-V25 PolarHBondContact O-N 2.87Å; E23-V25 PolarHBondContact O-N 3.37Å; V25-E27 VanDerWaalsContact C-N 3.32Å; V25-E27 PolarHBondContact O-N 3.48Å; V25-A28 PolarHBondContact O-N 3.18Å; V25-L29 WeakPolarHBondContact O-CB 2.76Å; V25-L29 PolarHBondContact O-N 3.04Å
26	K	94.2	Very high	91.2	Very high	110 Å²	110	93.1 Å²	93.1	48%	0.478	49%	0.494	S	S	.	.	H	α-helix	trans	-60.7	-43.6	174.4	-74.2	178	-173.4	165.6	0	111.1	I22 E23 L29 T30	I22-K26 HydrophobicContact CG2-CD 4.3Å; I22-K26 HydrophobicContact CG2-CG 4.48Å; I22-K26 WeakPolarHBondContact O-CG 3.36Å; I22-K26 PolarHBondContact O-N 3.12Å; E23-K26 PolarHBondContact O-N 3.03Å; E23-K26 IonicContact OE1-NZ 2.79Å; E23-K26 PolarHBondContact OE1-NZ 2.97Å; K26-L29 WeakPolarHBondContact O-CB 3.13Å; K26-L29 PolarHBondContact O-N 3.12Å; K26-T30 WeakPolarHBondContact O-CG2 3.43Å; K26-T30 PolarHBondContact O-N 2.85Å; K26-T30 PolarHBondContact O-OG1 3.42Å
27	E	94.3	Very high	91.4	Very high	90 Å²	90	92.3 Å²	92.3	42%	0.421	49%	0.49	S	S	.	.	H	α-helix	trans	-63.7	-40.8	176.8	-170.2	-172.5	167.9	0	0	112	E23 L24 V25 L29 T30 K31	E23-E27 WeakPolarHBondContact O-CB 3.39Å; E23-E27 PolarHBondContact O-N 2.93Å; L24-E27 PolarHBondContact O-N 3.19Å; V25-E27 VanDerWaalsContact C-N 3.32Å; V25-E27 PolarHBondContact O-N 3.48Å; E27-L29 VanDerWaalsContact C-N 3.31Å; E27-L29 PolarHBondContact O-N 3.34Å; E27-T30 PolarHBondContact O-N 2.91Å; E27-T30 PolarHBondContact O-OG1 3.25Å; E27-K31 WeakPolarHBondContact O-CG 3.4Å; E27-K31 PolarHBondContact O-N 3.34Å; E27-K31 WeakPolarHBondContact OE1-CE 3.3Å; E27-K31 IonicContact OE1-NZ 2.62Å; E27-K31 PolarHBondContact OE1-NZ 3.46Å
28	A	89.4	Confident	91.6	Very high	54 Å²	54	93 Å²	93	45%	0.446	50%	0.498	S	S	.	.	H	α-helix	trans	-62.9	-41.1	174	0	0	0	0	0	111.2	L24 V25 K31 L32	L24-A28 WeakPolarHBondContact O-CB 3.41Å; L24-A28 PolarHBondContact O-N 3.27Å; V25-A28 PolarHBondContact O-N 3.18Å; A28-K31 PolarHBondContact O-N 3.33Å; A28-L32 WeakPolarHBondContact O-CG 3.29Å; A28-L32 PolarHBondContact O-N 3.2Å; A28-L32 VanDerWaalsContact O-N 3.11Å
29	L	90.1	Very high	91.7	Very high	122 Å²	122	94.9 Å²	94.9	64%	0.639	51%	0.506	S	S	*	.	H	α-helix	trans	-65.2	-40	178.8	-170.4	68	0	0	0	112.2	V25 K26 E27 K31 L32	V25-L29 WeakPolarHBondContact O-CB 2.76Å; V25-L29 PolarHBondContact O-N 3.04Å; K26-L29 WeakPolarHBondContact O-CB 3.13Å; K26-L29 PolarHBondContact O-N 3.12Å; E27-L29 VanDerWaalsContact C-N 3.31Å; E27-L29 PolarHBondContact O-N 3.34Å; L29-K31 VanDerWaalsContact C-N 3.27Å; L29-K31 PolarHBondContact O-N 3.06Å; L29-L32 HydrophobicContact CD1-CD1 4.38Å; L29-L32 PolarHBondContact O-N 2.94Å
30	T	91.7	Very high	91.7	Very high	113 Å²	113	93.3 Å²	93.3	69%	0.693	50%	0.503	S	S	*	.	H	α-helix	trans	-69	-25.6	177.2	57	0	0	0	0	112.9	K26 E27	K26-T30 WeakPolarHBondContact O-CG2 3.43Å; K26-T30 PolarHBondContact O-N 2.85Å; K26-T30 PolarHBondContact O-OG1 3.42Å; E27-T30 PolarHBondContact O-N 2.91Å; E27-T30 PolarHBondContact O-OG1 3.25Å
31	K	90.7	Very high	91.7	Very high	137 Å²	137	90.9 Å²	90.9	60%	0.596	49%	0.494	S	S	*	.	H	α-helix	trans	-84.9	-13.9	174.6	-68	176.2	-173.6	172.6	0	113.5	E27 A28 L29 T33	E27-K31 WeakPolarHBondContact O-CG 3.4Å; E27-K31 PolarHBondContact O-N 3.34Å; E27-K31 WeakPolarHBondContact OE1-CE 3.3Å; E27-K31 IonicContact OE1-NZ 2.62Å; E27-K31 PolarHBondContact OE1-NZ 3.46Å; A28-K31 PolarHBondContact O-N 3.33Å; L29-K31 VanDerWaalsContact C-N 3.27Å; L29-K31 PolarHBondContact O-N 3.06Å; K31-T33 PolarHBondContact O-N 2.57Å
32	L	90.5	Very high	91.7	Very high	80 Å²	80	88.8 Å²	88.8	42%	0.419	48%	0.484	S	S	.	.			trans	-73.6	112.7	175.4	-81.2	169.1	0	0	0	110	A28 L29 L40	A28-L32 WeakPolarHBondContact O-CG 3.29Å; A28-L32 PolarHBondContact O-N 3.2Å; A28-L32 VanDerWaalsContact O-N 3.11Å; L29-L32 HydrophobicContact CD1-CD1 4.38Å; L29-L32 PolarHBondContact O-N 2.94Å; L32-L40 HydrophobicContact CD2-CD1 4.04Å
33	T	92.1	Very high	91.6	Very high	80 Å²	80	88.5 Å²	88.5	49%	0.491	48%	0.482	S	S	.	.			trans	-105.7	162.6	171.2	62.4	0	0	0	0	108.9	K31 S35 S36 L37	K31-T33 PolarHBondContact O-N 2.57Å; T33-S35 PolarHBondContact O-N 3.38Å; T33-S35 VanDerWaalsContact O-N 3.13Å; T33-S36 PolarHBondContact N-OG 2.97Å; T33-S36 PolarHBondContact O-N 3.06Å; T33-S36 VanDerWaalsContact O-N 3.12Å; T33-S36 PolarHBondContact O-OG 3.45Å; T33-S36 PolarHBondContact OG1-N 3.26Å; T33-S36 VanDerWaalsContact OG1-N 3.15Å; T33-S36 PolarHBondContact OG1-OG 3.22Å; T33-L37 PolarHBondContact O-N 3.47Å
34	T	91.6	Very high	91.4	Very high	129 Å²	129	93.4 Å²	93.4	79%	0.791	50%	0.497	S	S	*	.	H	α-helix	trans	-54.1	-34.1	172.4	-47.5	0	0	0	0	111.8	S38	T34-S38 WeakPolarHBondContact O-CB 3.33Å; T34-S38 PolarHBondContact O-N 3.3Å
35	S	92.5	Very high	91.3	Very high	71 Å²	71	92.8 Å²	92.8	50%	0.497	50%	0.497	S	S	.	.	H	α-helix	trans	-67.1	-50.2	175.8	-179	0	0	0	0	112.3	T33 L37 S38 Q39	T33-S35 PolarHBondContact O-N 3.38Å; T33-S35 VanDerWaalsContact O-N 3.13Å; S35-L37 VanDerWaalsContact C-N 3.32Å; S35-L37 PolarHBondContact O-N 2.88Å; S35-S38 PolarHBondContact O-N 3.26Å; S35-Q39 WeakPolarHBondContact O-CG 3.45Å; S35-Q39 PolarHBondContact O-N 2.99Å
36	S	90.7	Very high	91.1	Very high	30 Å²	30	94.8 Å²	94.8	21%	0.21	49%	0.494	C	S	.	.	H	α-helix	trans	-66	-36.3	179.9	59.9	0	0	0	0	111.8	T33 Q39 L40	T33-S36 PolarHBondContact N-OG 2.97Å; T33-S36 PolarHBondContact O-N 3.06Å; T33-S36 VanDerWaalsContact O-N 3.12Å; T33-S36 PolarHBondContact O-OG 3.45Å; T33-S36 PolarHBondContact OG1-N 3.26Å; T33-S36 VanDerWaalsContact OG1-N 3.15Å; T33-S36 PolarHBondContact OG1-OG 3.22Å; S36-Q39 PolarHBondContact O-N 3.33Å; S36-L40 VanDerWaalsContact O-CG 3.3Å; S36-L40 WeakPolarHBondContact O-CG 3.4Å; S36-L40 PolarHBondContact O-N 2.9Å
37	L	90.6	Very high	90.7	Very high	93 Å²	93	97.3 Å²	97.3	49%	0.487	51%	0.511	S	S	.	.	H	α-helix	trans	-62.5	-45.4	173.2	-172.9	65.9	0	0	0	111.9	T33 S35 Q39 L40 M41	T33-L37 PolarHBondContact O-N 3.47Å; S35-L37 VanDerWaalsContact C-N 3.32Å; S35-L37 PolarHBondContact O-N 2.88Å; L37-Q39 VanDerWaalsContact C-N 3.32Å; L37-Q39 PolarHBondContact O-N 2.82Å; L37-L40 PolarHBondContact O-N 2.87Å; L37-M41 WeakPolarHBondContact O-CG 3.38Å; L37-M41 PolarHBondContact O-N 2.95Å
38	S	92	Very high	90.5	Very high	64 Å²	64	94.4 Å²	94.4	45%	0.448	51%	0.505	S	S	.	.	H	α-helix	trans	-59.5	-42.2	175.7	179.9	0	0	0	0	111.9	T34 S35 M41 M42	T34-S38 WeakPolarHBondContact O-CB 3.33Å; T34-S38 PolarHBondContact O-N 3.3Å; S35-S38 PolarHBondContact O-N 3.26Å; S38-M41 PolarHBondContact O-N 3.4Å; S38-M42 WeakPolarHBondContact O-CG 3.45Å; S38-M42 PolarHBondContact O-N 2.92Å
39	Q	89.3	Confident	90.7	Very high	87 Å²	87	93.5 Å²	93.5	41%	0.407	49%	0.49	S	S	.	.	H	α-helix	trans	-64.2	-44.7	175.7	-69.9	174.8	2.6	0	0	112.3	S35 S36 L37 M41 M42 I43	S35-Q39 WeakPolarHBondContact O-CG 3.45Å; S35-Q39 PolarHBondContact O-N 2.99Å; S36-Q39 PolarHBondContact O-N 3.33Å; L37-Q39 VanDerWaalsContact C-N 3.32Å; L37-Q39 PolarHBondContact O-N 2.82Å; Q39-M41 VanDerWaalsContact C-N 3.3Å; Q39-M41 PolarHBondContact O-N 2.68Å; Q39-M42 HydrophobicContact CG-CE 4.22Å; Q39-M42 PolarHBondContact O-N 3.5Å; Q39-M42 VanDerWaalsContact O-N 3.14Å; Q39-I43 VanDerWaalsContact O-CG1 3.32Å; Q39-I43 WeakPolarHBondContact O-CG1 3.3Å; Q39-I43 PolarHBondContact O-N 3.43Å
40	L	88.8	Confident	90.7	Very high	88 Å²	88	92 Å²	92	46%	0.461	48%	0.483	S	S	.	.	H	α-helix	trans	-60.6	-40.5	175.2	-71.7	172.1	0	0	0	111.5	L32 S36 L37 I43 R44	L32-L40 HydrophobicContact CD2-CD1 4.04Å; S36-L40 VanDerWaalsContact O-CG 3.3Å; S36-L40 WeakPolarHBondContact O-CG 3.4Å; S36-L40 PolarHBondContact O-N 2.9Å; L37-L40 PolarHBondContact O-N 2.87Å; L40-I43 PolarHBondContact O-N 2.95Å; L40-R44 WeakPolarHBondContact O-CB 3.43Å; L40-R44 PolarHBondContact O-N 3.47Å
41	M	92	Very high	90.7	Very high	82 Å²	82	91.1 Å²	91.1	40%	0.404	47%	0.474	S	S	.	.	H	α-helix	trans	-64.2	-40.7	173.8	-70.2	-57.1	100	0	0	111.8	L37 S38 Q39 R44 T45	L37-M41 WeakPolarHBondContact O-CG 3.38Å; L37-M41 PolarHBondContact O-N 2.95Å; S38-M41 PolarHBondContact O-N 3.4Å; Q39-M41 VanDerWaalsContact C-N 3.3Å; Q39-M41 PolarHBondContact O-N 2.68Å; M41-R44 PolarHBondContact O-N 3.22Å; M41-T45 WeakPolarHBondContact O-CB 3.5Å; M41-T45 WeakPolarHBondContact O-CG2 3.3Å; M41-T45 PolarHBondContact O-N 3.29Å; M41-T45 PolarHBondContact O-OG1 3.3Å
42	M	92.5	Very high	90.8	Very high	46 Å²	46	91.7 Å²	91.7	23%	0.227	47%	0.472	C	S	.	.	H	α-helix	trans	-63.8	-41.7	174.4	-74.5	-166.8	-73.9	0	0	112.3	S38 Q39 R44 T45 R46 Y49	S38-M42 WeakPolarHBondContact O-CG 3.45Å; S38-M42 PolarHBondContact O-N 2.92Å; Q39-M42 HydrophobicContact CG-CE 4.22Å; Q39-M42 PolarHBondContact O-N 3.5Å; Q39-M42 VanDerWaalsContact O-N 3.14Å; M42-R44 VanDerWaalsContact C-N 3.33Å; M42-R44 PolarHBondContact O-N 2.93Å; M42-T45 PolarHBondContact O-N 3.11Å; M42-R46 WeakPolarHBondContact O-CB 3.33Å; M42-R46 PolarHBondContact O-N 2.98Å; M42-Y49 HydrophobicContact CB-CD1 3.54Å; M42-Y49 HydrophobicContact CB-CD2 4.15Å; M42-Y49 HydrophobicContact CB-CE1 3.58Å; M42-Y49 HydrophobicContact CB-CE2 4.2Å; M42-Y49 HydrophobicContact CB-CG 3.84Å; M42-Y49 HydrophobicContact CE-CE1 4.16Å; M42-Y49 HydrophobicContact CE-CE2 3.75Å; M42-Y49 VanDerWaalsContact CE-CZ 3.46Å; M42-Y49 VanDerWaalsContact CE-OH 3.24Å; M42-Y49 WeakPolarHBondContact CE-OH 3.3Å; M42-Y49 HydrophobicContact SD-CD2 4.11Å; M42-Y49 HydrophobicContact SD-CE2 3.68Å
43	I	90.2	Very high	90.9	Very high	69 Å²	69	90.1 Å²	90.1	35%	0.354	46%	0.464	S	S	.	.	H	α-helix	trans	-60.3	-44.7	175.1	-67.1	166.6	0	0	0	110.2	Q39 L40 Y49 L53	Q39-I43 VanDerWaalsContact O-CG1 3.32Å; Q39-I43 WeakPolarHBondContact O-CG1 3.3Å; Q39-I43 PolarHBondContact O-N 3.43Å; L40-I43 PolarHBondContact O-N 2.95Å; I43-Y49 HydrophobicContact CB-CD1 4.46Å; I43-Y49 HydrophobicContact CG1-CD1 3.69Å; I43-Y49 HydrophobicContact CG1-CE1 3.79Å; I43-L53 HydrophobicContact CG1-CD1 4.42Å
44	R	88.8	Confident	91	Very high	205 Å²	205	89.3 Å²	89.3	77%	0.774	46%	0.459	S	S	*	.	H	α-helix	trans	-67.6	-40.3	-179.8	-176.9	-180	179.6	-175.2	1.4	113.3	L40 M41 M42	L40-R44 WeakPolarHBondContact O-CB 3.43Å; L40-R44 PolarHBondContact O-N 3.47Å; M41-R44 PolarHBondContact O-N 3.22Å; M42-R44 VanDerWaalsContact C-N 3.33Å; M42-R44 PolarHBondContact O-N 2.93Å
45	T	92.1	Very high	91.2	Very high	97 Å²	97	88.1 Å²	88.1	60%	0.595	45%	0.448	S	S	*	.	H	α-helix	trans	-97.2	-24.2	-167.6	57	0	0	0	0	114.1	M41 M42	M41-T45 WeakPolarHBondContact O-CB 3.5Å; M41-T45 WeakPolarHBondContact O-CG2 3.3Å; M41-T45 PolarHBondContact O-N 3.29Å; M41-T45 PolarHBondContact O-OG1 3.3Å; M42-T45 PolarHBondContact O-N 3.11Å
46	R	90.1	Very high	91.4	Very high	144 Å²	144	91.7 Å²	91.7	54%	0.543	45%	0.451	S	S	.	.			trans	-118.4	102.3	-174.9	-61.6	-178.1	178	-167.7	-2.1	110.1	M42 G48 Y49	M42-R46 WeakPolarHBondContact O-CB 3.33Å; M42-R46 PolarHBondContact O-N 2.98Å; R46-G48 VanDerWaalsContact C-N 3.3Å; R46-G48 PolarHBondContact O-N 2.88Å; R46-Y49 VanDerWaalsContact O-CB 3.31Å; R46-Y49 WeakPolarHBondContact O-CB 3.36Å; R46-Y49 PolarHBondContact O-N 3.39Å
47	I	84.7	Confident	91.7	Very high	162 Å²	162	95.9 Å²	95.9	83%	0.831	47%	0.47	S	S	*	.	H	α-helix	trans	-48.6	-48.7	-176.6	-60.7	170.7	0	0	0	111.8	Y49	I47-Y49 VanDerWaalsContact C-N 3.35Å; I47-Y49 PolarHBondContact O-N 3.47Å
48	G	91.1	Very high	92	Very high	29 Å²	29	95.1 Å²	95.1	30%	0.299	47%	0.466	S	S	.	.	H	α-helix	trans	-84.5	8.1	179.9	0	0	0	0	0	116.1	R46 R52	R46-G48 VanDerWaalsContact C-N 3.3Å; R46-G48 PolarHBondContact O-N 2.88Å; G48-R52 WeakPolarHBondContact O-CG 3.4Å; G48-R52 PolarHBondContact O-N 3.42Å; G48-R52 PolarHBondContact O-NE 3.36Å
49	Y	92.5	Very high	92.3	Very high	35 Å²	35	95.6 Å²	95.6	14%	0.137	46%	0.463	C	S	.	.	H	α-helix	trans	-74.1	-41.9	175.1	179.5	-105.6	0	0	0	111.7	M42 I43 R46 I47 D51 R52 L53	M42-Y49 HydrophobicContact CB-CD1 3.54Å; M42-Y49 HydrophobicContact CB-CD2 4.15Å; M42-Y49 HydrophobicContact CB-CE1 3.58Å; M42-Y49 HydrophobicContact CB-CE2 4.2Å; M42-Y49 HydrophobicContact CB-CG 3.84Å; M42-Y49 HydrophobicContact CE-CE1 4.16Å; M42-Y49 HydrophobicContact CE-CE2 3.75Å; M42-Y49 VanDerWaalsContact CE-CZ 3.46Å; M42-Y49 VanDerWaalsContact CE-OH 3.24Å; M42-Y49 WeakPolarHBondContact CE-OH 3.3Å; M42-Y49 HydrophobicContact SD-CD2 4.11Å; M42-Y49 HydrophobicContact SD-CE2 3.68Å; I43-Y49 HydrophobicContact CB-CD1 4.46Å; I43-Y49 HydrophobicContact CG1-CD1 3.69Å; I43-Y49 HydrophobicContact CG1-CE1 3.79Å; R46-Y49 VanDerWaalsContact O-CB 3.31Å; R46-Y49 WeakPolarHBondContact O-CB 3.36Å; R46-Y49 PolarHBondContact O-N 3.39Å; I47-Y49 VanDerWaalsContact C-N 3.35Å; I47-Y49 PolarHBondContact O-N 3.47Å; Y49-D51 VanDerWaalsContact C-N 3.34Å; Y49-D51 PolarHBondContact O-N 3.31Å; Y49-R52 PolarHBondContact O-N 2.94Å; Y49-L53 HydrophobicContact CD1-CD1 3.81Å; Y49-L53 HydrophobicContact CD1-CG 4.27Å; Y49-L53 HydrophobicContact CE1-CD1 3.2Å; Y49-L53 HydrophobicContact CE1-CD2 4.49Å; Y49-L53 HydrophobicContact CE1-CG 3.83Å; Y49-L53 HydrophobicContact CE2-CD1 4.47Å; Y49-L53 HydrophobicContact CE2-CD2 4.46Å; Y49-L53 HydrophobicContact CE2-CG 4.25Å; Y49-L53 WeakPolarHBondContact O-CG 3.46Å; Y49-L53 PolarHBondContact O-N 3.43Å
50	L	89.8	Confident	92.7	Very high	90 Å²	90	97.6 Å²	97.6	47%	0.471	47%	0.468	S	S	.	.	H	α-helix	trans	-63.3	-41.4	177.6	-176.6	62.1	0	0	0	111.6	L53 T54	L50-L53 PolarHBondContact O-N 3.04Å; L50-T54 WeakPolarHBondContact O-CB 3.35Å; L50-T54 PolarHBondContact O-N 3.48Å; L50-T54 PolarHBondContact O-OG1 3.46Å
51	D	92	Very high	93.1	Very high	95 Å²	95	100.5 Å²	100.5	51%	0.508	47%	0.473	S	S	.	.	H	α-helix	trans	-60	-50.2	176.9	-60	-31.2	0	0	0	111	Y49 L53 T54 D55	Y49-D51 VanDerWaalsContact C-N 3.34Å; Y49-D51 PolarHBondContact O-N 3.31Å; D51-L53 VanDerWaalsContact C-N 3.31Å; D51-L53 PolarHBondContact O-N 2.95Å; D51-T54 WeakPolarHBondContact O-CA 3.39Å; D51-T54 WeakPolarHBondContact O-CB 3.33Å; D51-T54 PolarHBondContact O-N 3.16Å; D51-D55 PolarHBondContact O-N 2.94Å
52	R	93.9	Very high	93.4	Very high	149 Å²	149	104.5 Å²	104.5	56%	0.562	48%	0.484	S	S	*	.	H	α-helix	trans	-61.9	-35.9	177	-73.9	-179.5	-67.9	-146.2	-2.2	113.5	G48 Y49 R56	G48-R52 WeakPolarHBondContact O-CG 3.4Å; G48-R52 PolarHBondContact O-N 3.42Å; G48-R52 PolarHBondContact O-NE 3.36Å; Y49-R52 PolarHBondContact O-N 2.94Å; R52-R56 WeakPolarHBondContact O-CB 3.36Å; R52-R56 PolarHBondContact O-N 3.02Å
53	L	92	Very high	93.6	Very high	47 Å²	47	107.1 Å²	107.1	25%	0.246	50%	0.495	C	S	.	.	H	α-helix	trans	-65.3	-43.1	173.5	-80.6	-177.3	0	0	0	110.9	I43 Y49 L50 D51 R56 L57	I43-L53 HydrophobicContact CG1-CD1 4.42Å; Y49-L53 HydrophobicContact CD1-CD1 3.81Å; Y49-L53 HydrophobicContact CD1-CG 4.27Å; Y49-L53 HydrophobicContact CE1-CD1 3.2Å; Y49-L53 HydrophobicContact CE1-CD2 4.49Å; Y49-L53 HydrophobicContact CE1-CG 3.83Å; Y49-L53 HydrophobicContact CE2-CD1 4.47Å; Y49-L53 HydrophobicContact CE2-CD2 4.46Å; Y49-L53 HydrophobicContact CE2-CG 4.25Å; Y49-L53 WeakPolarHBondContact O-CG 3.46Å; Y49-L53 PolarHBondContact O-N 3.43Å; L50-L53 PolarHBondContact O-N 3.04Å; D51-L53 VanDerWaalsContact C-N 3.31Å; D51-L53 PolarHBondContact O-N 2.95Å; L53-R56 PolarHBondContact O-N 3.31Å; L53-L57 VanDerWaalsContact O-CG 3.3Å; L53-L57 WeakPolarHBondContact O-CG 3.36Å; L53-L57 PolarHBondContact O-N 3.36Å
54	T	93.5	Very high	94	Very high	64 Å²	64	106 Å²	106	39%	0.393	50%	0.497	S	S	.	.	H	α-helix	trans	-62.1	-48.6	177.9	-57.4	0	0	0	0	110.7	L50 D51 R56 L57 L58	L50-T54 WeakPolarHBondContact O-CB 3.35Å; L50-T54 PolarHBondContact O-N 3.48Å; L50-T54 PolarHBondContact O-OG1 3.46Å; D51-T54 WeakPolarHBondContact O-CA 3.39Å; D51-T54 WeakPolarHBondContact O-CB 3.33Å; D51-T54 PolarHBondContact O-N 3.16Å; T54-R56 VanDerWaalsContact C-N 3.31Å; T54-R56 PolarHBondContact O-N 3.17Å; T54-L57 PolarHBondContact O-N 3.4Å; T54-L57 VanDerWaalsContact O-N 3.16Å; T54-L58 HydrophobicContact CG2-CD1 4.16Å; T54-L58 HydrophobicContact CG2-CG 4.49Å; T54-L58 WeakPolarHBondContact O-CG 3.44Å; T54-L58 PolarHBondContact O-N 2.87Å
55	D	96.4	Very high	94.4	Very high	103 Å²	103	101.1 Å²	101.1	55%	0.551	48%	0.482	S	S	*	.	H	α-helix	trans	-57.5	-44	176.3	-69.7	-23.4	0	0	0	111.7	D51 L58 D59	D51-D55 PolarHBondContact O-N 2.94Å; D55-L58 PolarHBondContact O-N 3.17Å; D55-D59 WeakPolarHBondContact O-CB 3.36Å; D55-D59 PolarHBondContact O-N 3.48Å
56	R	96	Very high	94.7	Very high	147 Å²	147	100.5 Å²	100.5	56%	0.555	48%	0.475	S	S	*	.	H	α-helix	trans	-64.8	-40.8	177.6	-174.3	178.9	-68.3	177.2	-3.4	112.1	R52 L53 T54 L58 D59 Y60	R52-R56 WeakPolarHBondContact O-CB 3.36Å; R52-R56 PolarHBondContact O-N 3.02Å; L53-R56 PolarHBondContact O-N 3.31Å; T54-R56 VanDerWaalsContact C-N 3.31Å; T54-R56 PolarHBondContact O-N 3.17Å; R56-L58 VanDerWaalsContact C-N 3.35Å; R56-D59 PolarHBondContact O-N 3.06Å; R56-Y60 HydrophobicContact CG-CD2 3.99Å; R56-Y60 HydrophobicContact CG-CE2 3.53Å; R56-Y60 WeakPolarHBondContact O-CD2 3.33Å; R56-Y60 PolarHBondContact O-N 2.91Å
57	L	96.7	Very high	95.1	Very high	117 Å²	117	96 Å²	96	61%	0.613	47%	0.468	S	S	*	.	H	α-helix	trans	-66.5	-38	176.1	-72	173.4	0	0	0	111.7	L53 T54 R61	L53-L57 VanDerWaalsContact O-CG 3.3Å; L53-L57 WeakPolarHBondContact O-CG 3.36Å; L53-L57 PolarHBondContact O-N 3.36Å; T54-L57 PolarHBondContact O-N 3.4Å; T54-L57 VanDerWaalsContact O-N 3.16Å; L57-R61 WeakPolarHBondContact O-CB 3.48Å; L57-R61 PolarHBondContact O-N 2.84Å
58	L	97.7	Very high	95.7	Very high	77 Å²	77	97.3 Å²	97.3	40%	0.403	46%	0.463	S	S	.	.	H	α-helix	trans	-64.7	-42.6	174.1	-71.5	172.9	0	0	0	111.6	T54 D55 R56 R61 R62	T54-L58 HydrophobicContact CG2-CD1 4.16Å; T54-L58 HydrophobicContact CG2-CG 4.49Å; T54-L58 WeakPolarHBondContact O-CG 3.44Å; T54-L58 PolarHBondContact O-N 2.87Å; D55-L58 PolarHBondContact O-N 3.17Å; R56-L58 VanDerWaalsContact C-N 3.35Å; L58-R61 VanDerWaalsContact CD2-NH2 3.31Å; L58-R61 PolarHBondContact O-N 3.13Å; L58-R62 PolarHBondContact O-N 2.9Å
59	D	97.8	Very high	96	Very high	74 Å²	74	99.4 Å²	99.4	40%	0.396	47%	0.47	S	S	.	.	H	α-helix	trans	-63.6	-47.4	175.5	-173.8	52	0	0	0	111.4	D55 R56 R61 R62 Q63	D55-D59 WeakPolarHBondContact O-CB 3.36Å; D55-D59 PolarHBondContact O-N 3.48Å; R56-D59 PolarHBondContact O-N 3.06Å; D59-R61 VanDerWaalsContact C-N 3.3Å; D59-R61 PolarHBondContact O-N 3.3Å; D59-R62 WeakPolarHBondContact O-CB 3.49Å; D59-R62 PolarHBondContact O-N 3.48Å; D59-R62 VanDerWaalsContact O-N 3.11Å; D59-Q63 WeakPolarHBondContact O-CG 3.35Å; D59-Q63 PolarHBondContact O-N 3.14Å; D59-Q63 PolarHBondContact OD2-NE2 3.43Å
60	Y	97.9	Very high	96.3	Very high	129 Å²	129	105.7 Å²	105.7	51%	0.506	49%	0.493	S	S	.	.	H	α-helix	trans	-59.7	-39.1	174.5	-71.3	-33.3	0	0	0	113	R56 Q63 A64	R56-Y60 HydrophobicContact CG-CD2 3.99Å; R56-Y60 HydrophobicContact CG-CE2 3.53Å; R56-Y60 WeakPolarHBondContact O-CD2 3.33Å; R56-Y60 PolarHBondContact O-N 2.91Å; Y60-Q63 PolarHBondContact O-N 3.42Å; Y60-A64 WeakPolarHBondContact O-CB 3.24Å; Y60-A64 PolarHBondContact O-N 2.84Å
61	R	97.7	Very high	96.7	Very high	150 Å²	150	106 Å²	106	57%	0.566	50%	0.499	S	S	*	.	H	α-helix	trans	-60.5	-46.8	174.1	-174.8	178	69	179.5	2.5	110.9	L57 L58 D59 A64 E65	L57-R61 WeakPolarHBondContact O-CB 3.48Å; L57-R61 PolarHBondContact O-N 2.84Å; L58-R61 VanDerWaalsContact CD2-NH2 3.31Å; L58-R61 PolarHBondContact O-N 3.13Å; D59-R61 VanDerWaalsContact C-N 3.3Å; D59-R61 PolarHBondContact O-N 3.3Å; R61-A64 PolarHBondContact O-N 3.5Å; R61-E65 WeakPolarHBondContact O-CG 3.35Å; R61-E65 PolarHBondContact O-N 3.4Å
62	R	97.7	Very high	97	Very high	166 Å²	166	104.4 Å²	104.4	63%	0.626	50%	0.495	S	S	*	.	H	α-helix	trans	-62.1	-43.6	177.1	-173.2	-177.6	-176.7	-176.9	1.8	111.9	L58 D59 A64 E65 L66	L58-R62 PolarHBondContact O-N 2.9Å; D59-R62 WeakPolarHBondContact O-CB 3.49Å; D59-R62 PolarHBondContact O-N 3.48Å; D59-R62 VanDerWaalsContact O-N 3.11Å; R62-A64 VanDerWaalsContact C-N 3.34Å; R62-A64 PolarHBondContact O-N 3.17Å; R62-E65 PolarHBondContact O-N 2.88Å; R62-L66 HydrophobicContact CG-CD1 4.38Å; R62-L66 WeakPolarHBondContact O-CG 3.44Å; R62-L66 PolarHBondContact O-N 2.83Å
63	Q	98	Very high	97.1	Very high	101 Å²	101	102.8 Å²	102.8	47%	0.472	49%	0.494	S	S	.	.	H	α-helix	trans	-62.2	-41.8	176.3	-70	-177.5	21.8	0	0	111.6	D59 Y60 L66 A67	D59-Q63 WeakPolarHBondContact O-CG 3.35Å; D59-Q63 PolarHBondContact O-N 3.14Å; D59-Q63 PolarHBondContact OD2-NE2 3.43Å; Y60-Q63 PolarHBondContact O-N 3.42Å; Q63-L66 PolarHBondContact O-N 3.06Å; Q63-A67 WeakPolarHBondContact O-CB 3.48Å; Q63-A67 PolarHBondContact O-N 2.94Å
64	A	97.9	Very high	97.4	Very high	46 Å²	46	104 Å²	104	38%	0.38	50%	0.504	S	S	.	.	H	α-helix	trans	-64.4	-40.9	176.6	0	0	0	0	0	112.3	Y60 R61 R62 A67 R68	Y60-A64 WeakPolarHBondContact O-CB 3.24Å; Y60-A64 PolarHBondContact O-N 2.84Å; R61-A64 PolarHBondContact O-N 3.5Å; R62-A64 VanDerWaalsContact C-N 3.34Å; R62-A64 PolarHBondContact O-N 3.17Å; A64-A67 PolarHBondContact O-N 2.93Å; A64-R68 VanDerWaalsContact O-CG 3.32Å; A64-R68 WeakPolarHBondContact O-CG 3.32Å; A64-R68 PolarHBondContact O-N 3.41Å
65	E	97.9	Very high	97.6	Very high	102 Å²	102	105.2 Å²	105.2	48%	0.477	51%	0.505	S	S	.	.	H	α-helix	trans	-62.1	-48	174	-74.2	169.2	-175.7	0	0	111.5	R61 R62 A67 R68 T69	R61-E65 WeakPolarHBondContact O-CG 3.35Å; R61-E65 PolarHBondContact O-N 3.4Å; R62-E65 PolarHBondContact O-N 2.88Å; E65-A67 VanDerWaalsContact C-N 3.32Å; E65-A67 PolarHBondContact O-N 3.3Å; E65-R68 WeakPolarHBondContact O-CB 3.32Å; E65-R68 PolarHBondContact O-N 3.39Å; E65-T69 PolarHBondContact O-N 3.39Å; E65-T69 PolarHBondContact O-OG1 3.27Å
66	L	97.9	Very high	97.7	Very high	84 Å²	84	107.2 Å²	107.2	44%	0.44	51%	0.508	S	S	.	.	H	α-helix	trans	-59.8	-42	176.1	-71.5	172.9	0	0	0	112.1	R62 Q63 T69 R70	R62-L66 HydrophobicContact CG-CD1 4.38Å; R62-L66 WeakPolarHBondContact O-CG 3.44Å; R62-L66 PolarHBondContact O-N 2.83Å; Q63-L66 PolarHBondContact O-N 3.06Å; L66-T69 PolarHBondContact O-N 2.95Å; L66-R70 WeakPolarHBondContact O-CG 3.36Å; L66-R70 PolarHBondContact O-N 2.96Å
67	A	97.7	Very high	97.8	Very high	49 Å²	49	105.9 Å²	105.9	41%	0.405	51%	0.512	S	S	.	.	H	α-helix	trans	-62.3	-45	176.2	0	0	0	0	0	111.3	Q63 A64 E65 T69 R70 V71	Q63-A67 WeakPolarHBondContact O-CB 3.48Å; Q63-A67 PolarHBondContact O-N 2.94Å; A64-A67 PolarHBondContact O-N 2.93Å; E65-A67 VanDerWaalsContact C-N 3.32Å; E65-A67 PolarHBondContact O-N 3.3Å; A67-T69 VanDerWaalsContact C-N 3.34Å; A67-T69 PolarHBondContact O-N 2.96Å; A67-R70 PolarHBondContact O-N 2.88Å; A67-V71 VanDerWaalsContact O-CG2 3.24Å; A67-V71 WeakPolarHBondContact O-CG2 3.41Å; A67-V71 PolarHBondContact O-N 3.36Å
68	R	98	Very high	97.8	Very high	189 Å²	189	104.3 Å²	104.3	71%	0.713	50%	0.503	S	S	*	.	H	α-helix	trans	-59.7	-43.6	175.2	-74.1	173.4	-177.6	177.8	1.2	112	A64 E65 V71 S72	A64-R68 VanDerWaalsContact O-CG 3.32Å; A64-R68 WeakPolarHBondContact O-CG 3.32Å; A64-R68 PolarHBondContact O-N 3.41Å; E65-R68 WeakPolarHBondContact O-CB 3.32Å; E65-R68 PolarHBondContact O-N 3.39Å; R68-V71 PolarHBondContact O-N 2.93Å; R68-S72 WeakPolarHBondContact O-CB 3.4Å; R68-S72 PolarHBondContact O-N 2.89Å
69	T	97.5	Very high	97.9	Very high	74 Å²	74	104 Å²	104	45%	0.454	50%	0.502	S	S	.	.	H	α-helix	trans	-62.2	-45.4	176.5	-58.2	0	0	0	0	111.5	E65 L66 A67 S72 Q73	E65-T69 PolarHBondContact O-N 3.39Å; E65-T69 PolarHBondContact O-OG1 3.27Å; L66-T69 PolarHBondContact O-N 2.95Å; A67-T69 VanDerWaalsContact C-N 3.34Å; A67-T69 PolarHBondContact O-N 2.96Å; T69-S72 PolarHBondContact O-N 3.2Å; T69-Q73 WeakPolarHBondContact O-CG 3.39Å; T69-Q73 PolarHBondContact O-N 3.44Å
70	R	97.9	Very high	97.9	Very high	166 Å²	166	107.4 Å²	107.4	63%	0.626	51%	0.513	S	S	*	.	H	α-helix	trans	-60.6	-47	176.7	-73	177.8	-168.1	174.2	4.5	111.6	L66 A67 S72 Q73 T74	L66-R70 WeakPolarHBondContact O-CG 3.36Å; L66-R70 PolarHBondContact O-N 2.96Å; A67-R70 PolarHBondContact O-N 2.88Å; R70-S72 VanDerWaalsContact C-N 3.31Å; R70-S72 PolarHBondContact O-N 3.35Å; R70-Q73 PolarHBondContact O-N 3.15Å; R70-Q73 VanDerWaalsContact O-N 3.17Å; R70-T74 WeakPolarHBondContact O-CG2 3.36Å; R70-T74 PolarHBondContact O-N 3.11Å; R70-T74 PolarHBondContact O-OG1 2.97Å; R70-T74 VanDerWaalsContact O-OG1 3.06Å
71	V	98.2	Very high	97.9	Very high	96 Å²	96	103.9 Å²	103.9	58%	0.582	51%	0.511	S	S	*	.	H	α-helix	trans	-58	-44.7	177.2	170.7	0	0	0	0	110.9	A67 R68 Q73 T74 Q75	A67-V71 VanDerWaalsContact O-CG2 3.24Å; A67-V71 WeakPolarHBondContact O-CG2 3.41Å; A67-V71 PolarHBondContact O-N 3.36Å; R68-V71 PolarHBondContact O-N 2.93Å; V71-Q73 PolarHBondContact O-N 2.76Å; V71-T74 WeakPolarHBondContact CA-OG1 3.47Å; V71-T74 PolarHBondContact O-N 2.97Å; V71-T74 PolarHBondContact O-OG1 2.92Å; V71-Q75 WeakPolarHBondContact O-CB 3.32Å; V71-Q75 PolarHBondContact O-N 3.41Å
72	S	97.7	Very high	97.9	Very high	62 Å²	62	100.6 Å²	100.6	43%	0.434	50%	0.504	S	S	.	.	H	α-helix	trans	-63.3	-41.6	176.8	-178.1	0	0	0	0	112.4	R68 T69 R70 Q75 K76	R68-S72 WeakPolarHBondContact O-CB 3.4Å; R68-S72 PolarHBondContact O-N 2.89Å; T69-S72 PolarHBondContact O-N 3.2Å; R70-S72 VanDerWaalsContact C-N 3.31Å; R70-S72 PolarHBondContact O-N 3.35Å; S72-Q75 PolarHBondContact O-N 3.36Å; S72-K76 WeakPolarHBondContact O-CG 3.45Å; S72-K76 PolarHBondContact O-N 2.88Å; S72-K76 VanDerWaalsContact O-N 3.14Å
73	Q	97.7	Very high	97.9	Very high	116 Å²	116	98.2 Å²	98.2	54%	0.542	50%	0.503	S	S	.	.	H	α-helix	trans	-65.4	-45	176.6	-73.1	172.7	-13.8	0	0	111.9	T69 R70 V71 Q75 K76 L77	T69-Q73 WeakPolarHBondContact O-CG 3.39Å; T69-Q73 PolarHBondContact O-N 3.44Å; R70-Q73 PolarHBondContact O-N 3.15Å; R70-Q73 VanDerWaalsContact O-N 3.17Å; V71-Q73 PolarHBondContact O-N 2.76Å; Q73-Q75 VanDerWaalsContact C-N 3.33Å; Q73-Q75 PolarHBondContact O-N 3.29Å; Q73-K76 PolarHBondContact O-N 3.49Å; Q73-L77 PolarHBondContact O-N 3.38Å
74	T	97.5	Very high	97.9	Very high	72 Å²	72	98.5 Å²	98.5	44%	0.442	51%	0.505	S	S	.	.	H	α-helix	trans	-64.7	-38.4	177.4	51	0	0	0	0	111.6	R70 V71 K76 L77 I78	R70-T74 WeakPolarHBondContact O-CG2 3.36Å; R70-T74 PolarHBondContact O-N 3.11Å; R70-T74 PolarHBondContact O-OG1 2.97Å; R70-T74 VanDerWaalsContact O-OG1 3.06Å; V71-T74 WeakPolarHBondContact CA-OG1 3.47Å; V71-T74 PolarHBondContact O-N 2.97Å; V71-T74 PolarHBondContact O-OG1 2.92Å; T74-K76 VanDerWaalsContact C-N 3.35Å; T74-K76 PolarHBondContact O-N 3.34Å; T74-L77 PolarHBondContact O-N 2.82Å; T74-I78 WeakPolarHBondContact O-CG1 3.24Å; T74-I78 PolarHBondContact O-N 3.35Å
75	Q	97.7	Very high	97.9	Very high	90 Å²	90	102.1 Å²	102.1	42%	0.421	51%	0.513	S	S	.	.	H	α-helix	trans	-61.2	-44.1	176	-171.4	60.3	49.3	0	0	111.2	V71 S72 Q73 L77 I78 D79	V71-Q75 WeakPolarHBondContact O-CB 3.32Å; V71-Q75 PolarHBondContact O-N 3.41Å; S72-Q75 PolarHBondContact O-N 3.36Å; Q73-Q75 VanDerWaalsContact C-N 3.33Å; Q73-Q75 PolarHBondContact O-N 3.29Å; Q75-L77 VanDerWaalsContact C-N 3.27Å; Q75-L77 PolarHBondContact O-N 3.31Å; Q75-I78 WeakPolarHBondContact O-CB 3.3Å; Q75-I78 PolarHBondContact O-N 2.87Å; Q75-I78 VanDerWaalsContact O-N 3.13Å; Q75-D79 PolarHBondContact NE2-OD1 3.34Å; Q75-D79 PolarHBondContact O-N 3.16Å
76	K	97.9	Very high	97.9	Very high	144 Å²	144	103.1 Å²	103.1	63%	0.626	52%	0.518	S	S	*	.	H	α-helix	trans	-59.8	-36.6	175.4	-70.6	175.8	-177.6	-175.5	0	113	S72 Q73 T74 K80	S72-K76 WeakPolarHBondContact O-CG 3.45Å; S72-K76 PolarHBondContact O-N 2.88Å; S72-K76 VanDerWaalsContact O-N 3.14Å; Q73-K76 PolarHBondContact O-N 3.49Å; T74-K76 VanDerWaalsContact C-N 3.35Å; T74-K76 PolarHBondContact O-N 3.34Å; K76-K80 WeakPolarHBondContact O-CB 3.49Å; K76-K80 PolarHBondContact O-N 2.92Å
77	L	98.2	Very high	97.9	Very high	119 Å²	119	104.2 Å²	104.2	62%	0.623	52%	0.521	S	S	*	.	H	α-helix	trans	-69.5	-40.5	175.9	-67.9	174.4	0	0	0	111.6	Q73 T74 Q75 K80 A81	Q73-L77 PolarHBondContact O-N 3.38Å; T74-L77 PolarHBondContact O-N 2.82Å; Q75-L77 VanDerWaalsContact C-N 3.27Å; Q75-L77 PolarHBondContact O-N 3.31Å; L77-K80 PolarHBondContact O-N 2.84Å; L77-A81 WeakPolarHBondContact O-CB 3.31Å; L77-A81 PolarHBondContact O-N 2.98Å
78	I	98.1	Very high	97.9	Very high	84 Å²	84	107 Å²	107	43%	0.431	52%	0.524	S	S	.	.	H	α-helix	trans	-61.3	-48.4	174.3	-68.7	165.6	0	0	0	110	T74 Q75 K80 A81 L82	T74-I78 WeakPolarHBondContact O-CG1 3.24Å; T74-I78 PolarHBondContact O-N 3.35Å; Q75-I78 WeakPolarHBondContact O-CB 3.3Å; Q75-I78 PolarHBondContact O-N 2.87Å; Q75-I78 VanDerWaalsContact O-N 3.13Å; I78-K80 VanDerWaalsContact C-N 3.3Å; I78-K80 PolarHBondContact O-N 2.92Å; I78-A81 PolarHBondContact O-N 3.05Å; I78-A81 VanDerWaalsContact O-N 3.16Å; I78-L82 HydrophobicContact CG2-CD1 3.91Å; I78-L82 HydrophobicContact CG2-CG 4.33Å; I78-L82 WeakPolarHBondContact O-CG 3.44Å; I78-L82 PolarHBondContact O-N 3.05Å
79	D	98.1	Very high	97.8	Very high	72 Å²	72	102 Å²	102	39%	0.385	52%	0.515	S	S	.	.	H	α-helix	trans	-60.2	-42	179.8	-60.7	-22.1	0	0	0	111.1	Q75 L82 L83	Q75-D79 PolarHBondContact NE2-OD1 3.34Å; Q75-D79 PolarHBondContact O-N 3.16Å; D79-L82 PolarHBondContact O-N 3.32Å; D79-L83 WeakPolarHBondContact O-CG 3.37Å; D79-L83 PolarHBondContact O-N 2.88Å
80	K	98.1	Very high	97.7	Very high	145 Å²	145	102.3 Å²	102.3	63%	0.63	52%	0.516	S	S	*	.	H	α-helix	trans	-62.5	-45.7	174.9	-175	-179	176.4	-175	0	112.1	K76 L77 I78 L82 L83 E84	K76-K80 WeakPolarHBondContact O-CB 3.49Å; K76-K80 PolarHBondContact O-N 2.92Å; L77-K80 PolarHBondContact O-N 2.84Å; I78-K80 VanDerWaalsContact C-N 3.3Å; I78-K80 PolarHBondContact O-N 2.92Å; K80-L82 VanDerWaalsContact C-N 3.32Å; K80-L82 PolarHBondContact O-N 2.84Å; K80-L83 PolarHBondContact O-N 3.27Å; K80-E84 PolarHBondContact O-N 3.41Å
81	A	97.8	Very high	97.7	Very high	55 Å²	55	97.6 Å²	97.6	46%	0.455	50%	0.501	S	S	.	.	H	α-helix	trans	-64.6	-36.9	178.9	0	0	0	0	0	112	L77 I78 E84 Q85	L77-A81 WeakPolarHBondContact O-CB 3.31Å; L77-A81 PolarHBondContact O-N 2.98Å; I78-A81 PolarHBondContact O-N 3.05Å; I78-A81 VanDerWaalsContact O-N 3.16Å; A81-E84 PolarHBondContact O-N 3.39Å; A81-Q85 VanDerWaalsContact O-CB 3.3Å; A81-Q85 WeakPolarHBondContact O-CB 3.34Å; A81-Q85 PolarHBondContact O-N 3.5Å
82	L	98.4	Very high	97.5	Very high	80 Å²	80	97.5 Å²	97.5	42%	0.419	50%	0.497	S	S	.	.	H	α-helix	trans	-65.3	-43.6	175.4	-74.2	172.5	0	0	0	111.9	I78 D79 K80 Q85 Q86	I78-L82 HydrophobicContact CG2-CD1 3.91Å; I78-L82 HydrophobicContact CG2-CG 4.33Å; I78-L82 WeakPolarHBondContact O-CG 3.44Å; I78-L82 PolarHBondContact O-N 3.05Å; D79-L82 PolarHBondContact O-N 3.32Å; K80-L82 VanDerWaalsContact C-N 3.32Å; K80-L82 PolarHBondContact O-N 2.84Å; L82-Q85 PolarHBondContact O-N 2.97Å; L82-Q86 WeakPolarHBondContact O-CB 3.34Å; L82-Q86 VanDerWaalsContact O-CG 3.3Å; L82-Q86 WeakPolarHBondContact O-CG 3.32Å; L82-Q86 PolarHBondContact O-N 3.19Å
83	L	97.9	Very high	97.3	Very high	116 Å²	116	96.7 Å²	96.7	61%	0.607	50%	0.495	S	S	*	.	H	α-helix	trans	-62.2	-45	175.5	-72.2	173	0	0	0	111.7	D79 K80 Q86 E87	D79-L83 WeakPolarHBondContact O-CG 3.37Å; D79-L83 PolarHBondContact O-N 2.88Å; K80-L83 PolarHBondContact O-N 3.27Å; L83-Q86 PolarHBondContact O-N 3.37Å; L83-E87 PolarHBondContact O-N 3.32Å
84	E	97.8	Very high	97.2	Very high	108 Å²	108	96.9 Å²	96.9	51%	0.505	50%	0.495	S	S	.	.	H	α-helix	trans	-62.8	-43.6	176.8	-175.5	174.3	178.2	0	0	111.5	K80 A81 Q86 E87 K88	K80-E84 PolarHBondContact O-N 3.41Å; A81-E84 PolarHBondContact O-N 3.39Å; E84-Q86 VanDerWaalsContact C-N 3.33Å; E84-Q86 PolarHBondContact O-N 2.9Å; E84-E87 PolarHBondContact O-N 2.97Å; E84-K88 HydrophobicContact CG-CG 4.46Å; E84-K88 WeakPolarHBondContact O-CG 3.42Å; E84-K88 PolarHBondContact O-N 3.32Å
85	Q	97.9	Very high	97	Very high	121 Å²	121	99.1 Å²	99.1	57%	0.565	50%	0.504	S	S	*	.	H	α-helix	trans	-60.4	-42.7	176	-175.8	-179.6	19.5	0	0	111.8	A81 L82 K88 T89	A81-Q85 VanDerWaalsContact O-CB 3.3Å; A81-Q85 WeakPolarHBondContact O-CB 3.34Å; A81-Q85 PolarHBondContact O-N 3.5Å; L82-Q85 PolarHBondContact O-N 2.97Å; Q85-K88 PolarHBondContact O-N 2.88Å; Q85-T89 VanDerWaalsContact O-CB 3.3Å; Q85-T89 WeakPolarHBondContact O-CB 3.34Å; Q85-T89 PolarHBondContact O-N 3.12Å; Q85-T89 PolarHBondContact O-OG1 3.13Å
86	Q	97.8	Very high	96.7	Very high	123 Å²	123	98.6 Å²	98.6	58%	0.575	50%	0.5	S	S	*	.	H	α-helix	trans	-61.7	-48.5	176.4	-75.6	174.7	-4.2	0	0	111	L82 L83 E84 K88 T89 T90	L82-Q86 WeakPolarHBondContact O-CB 3.34Å; L82-Q86 VanDerWaalsContact O-CG 3.3Å; L82-Q86 WeakPolarHBondContact O-CG 3.32Å; L82-Q86 PolarHBondContact O-N 3.19Å; L83-Q86 PolarHBondContact O-N 3.37Å; E84-Q86 VanDerWaalsContact C-N 3.33Å; E84-Q86 PolarHBondContact O-N 2.9Å; Q86-K88 PolarHBondContact O-N 3.15Å; Q86-T89 PolarHBondContact O-N 3.45Å; Q86-T90 PolarHBondContact O-N 3.36Å; Q86-T90 PolarHBondContact O-OG1 3.43Å; Q86-T90 VanDerWaalsContact O-OG1 3.11Å
87	E	97.7	Very high	96.4	Very high	107 Å²	107	96.1 Å²	96.1	50%	0.5	49%	0.494	S	S	.	.	H	α-helix	trans	-58.2	-47.6	178.3	-167.7	-165.5	148.7	0	0	111.7	L83 E84 T89 T90 Q91	L83-E87 PolarHBondContact O-N 3.32Å; E84-E87 PolarHBondContact O-N 2.97Å; E87-T89 VanDerWaalsContact C-N 3.35Å; E87-T89 PolarHBondContact O-N 3.27Å; E87-T90 PolarHBondContact O-N 2.94Å; E87-Q91 WeakPolarHBondContact O-CG 3.36Å; E87-Q91 PolarHBondContact O-N 3.45Å; E87-Q91 PolarHBondContact OE1-NE2 3.48Å
88	K	97.4	Very high	96.1	Very high	108 Å²	108	93.6 Å²	93.6	47%	0.47	49%	0.486	S	S	.	.	H	α-helix	trans	-65.3	-37.4	178	-66	-52.1	178.9	-168.1	0	112.7	E84 Q85 Q86 T90 Q91 L92	E84-K88 HydrophobicContact CG-CG 4.46Å; E84-K88 WeakPolarHBondContact O-CG 3.42Å; E84-K88 PolarHBondContact O-N 3.32Å; Q85-K88 PolarHBondContact O-N 2.88Å; Q86-K88 PolarHBondContact O-N 3.15Å; K88-T90 VanDerWaalsContact C-N 3.34Å; K88-Q91 PolarHBondContact O-N 2.9Å; K88-L92 VanDerWaalsContact O-CB 3.29Å; K88-L92 WeakPolarHBondContact O-CB 3.47Å; K88-L92 PolarHBondContact O-N 3.14Å
89	T	96.6	Very high	95.8	Very high	84 Å²	84	91.7 Å²	91.7	52%	0.515	48%	0.48	S	S	.	.	H	α-helix	trans	-64.9	-41.1	176.1	-57.2	0	0	0	0	111	Q85 Q86 E87 L92 A93	Q85-T89 VanDerWaalsContact O-CB 3.3Å; Q85-T89 WeakPolarHBondContact O-CB 3.34Å; Q85-T89 PolarHBondContact O-N 3.12Å; Q85-T89 PolarHBondContact O-OG1 3.13Å; Q86-T89 PolarHBondContact O-N 3.45Å; E87-T89 VanDerWaalsContact C-N 3.35Å; E87-T89 PolarHBondContact O-N 3.27Å; T89-L92 PolarHBondContact O-N 3.33Å; T89-A93 WeakPolarHBondContact O-CB 3.32Å; T89-A93 PolarHBondContact O-N 2.9Å
90	T	96.2	Very high	95.4	Very high	80 Å²	80	93.8 Å²	93.8	49%	0.491	49%	0.486	S	S	.	.	H	α-helix	trans	-65.2	-45.6	174.8	-56.1	0	0	0	0	111.8	Q86 E87 K88 L92 A93 Q94	Q86-T90 PolarHBondContact O-N 3.36Å; Q86-T90 PolarHBondContact O-OG1 3.43Å; Q86-T90 VanDerWaalsContact O-OG1 3.11Å; E87-T90 PolarHBondContact O-N 2.94Å; K88-T90 VanDerWaalsContact C-N 3.34Å; T90-L92 VanDerWaalsContact C-N 3.33Å; T90-L92 PolarHBondContact O-N 2.94Å; T90-A93 PolarHBondContact O-N 3.28Å; T90-Q94 WeakPolarHBondContact O-CG 3.3Å; T90-Q94 PolarHBondContact O-N 2.66Å
91	Q	96.5	Very high	95.1	Very high	67 Å²	67	94.4 Å²	94.4	31%	0.313	49%	0.488	S	S	.	.	H	α-helix	trans	-59.1	-44.6	176.1	-74.8	170.7	7.7	0	0	111.4	E87 K88 Q94 L95	E87-Q91 WeakPolarHBondContact O-CG 3.36Å; E87-Q91 PolarHBondContact O-N 3.45Å; E87-Q91 PolarHBondContact OE1-NE2 3.48Å; K88-Q91 PolarHBondContact O-N 2.9Å; Q91-Q94 PolarHBondContact O-N 3.36Å; Q91-L95 WeakPolarHBondContact O-CG 3.4Å; Q91-L95 PolarHBondContact O-N 2.87Å
92	L	94.9	Very high	94.8	Very high	94 Å²	94	97.1 Å²	97.1	49%	0.492	49%	0.494	S	S	.	.	H	α-helix	trans	-61.9	-45.6	177.1	-174.2	67.5	0	0	0	111.1	K88 T89 T90 Q94 L95 K96	K88-L92 VanDerWaalsContact O-CB 3.29Å; K88-L92 WeakPolarHBondContact O-CB 3.47Å; K88-L92 PolarHBondContact O-N 3.14Å; T89-L92 PolarHBondContact O-N 3.33Å; T90-L92 VanDerWaalsContact C-N 3.33Å; T90-L92 PolarHBondContact O-N 2.94Å; L92-Q94 VanDerWaalsContact C-N 3.31Å; L92-Q94 PolarHBondContact O-N 2.91Å; L92-L95 PolarHBondContact O-N 3.43Å; L92-K96 VanDerWaalsContact O-CG 3.3Å; L92-K96 WeakPolarHBondContact O-CG 3.37Å; L92-K96 PolarHBondContact O-N 3.01Å
93	A	93.6	Very high	94.5	Very high	46 Å²	46	94.1 Å²	94.1	38%	0.38	48%	0.48	S	S	.	.	H	α-helix	trans	-60.4	-39.9	177.2	0	0	0	0	0	112.6	T89 T90 N97	T89-A93 WeakPolarHBondContact O-CB 3.32Å; T89-A93 PolarHBondContact O-N 2.9Å; T90-A93 PolarHBondContact O-N 3.28Å; A93-N97 VanDerWaalsContact O-CG 3.29Å; A93-N97 PolarHBondContact O-N 3.24Å; A93-N97 PolarHBondContact O-ND2 2.95Å
94	Q	95.2	Very high	94.1	Very high	119 Å²	119	91.4 Å²	91.4	56%	0.556	47%	0.47	S	S	*	.	H	α-helix	trans	-64.3	-45	174.8	-71.7	176	-6.3	0	0	111.9	T90 Q91 L92 N97 S98	T90-Q94 WeakPolarHBondContact O-CG 3.3Å; T90-Q94 PolarHBondContact O-N 2.66Å; Q91-Q94 PolarHBondContact O-N 3.36Å; L92-Q94 VanDerWaalsContact C-N 3.31Å; L92-Q94 PolarHBondContact O-N 2.91Å; Q94-N97 PolarHBondContact O-N 3.11Å; Q94-S98 PolarHBondContact O-N 3.4Å; Q94-S98 PolarHBondContact O-OG 3.28Å
95	L	93	Very high	93.9	Very high	120 Å²	120	92.1 Å²	92.1	63%	0.628	47%	0.472	S	S	*	.	H	α-helix	trans	-62.9	-43.4	177.4	-74.6	168.6	0	0	0	111.9	Q91 L92 N97 S98 C99	Q91-L95 WeakPolarHBondContact O-CG 3.4Å; Q91-L95 PolarHBondContact O-N 2.87Å; L92-L95 PolarHBondContact O-N 3.43Å; L95-N97 VanDerWaalsContact C-N 3.32Å; L95-N97 PolarHBondContact O-N 3.14Å; L95-S98 PolarHBondContact O-N 2.93Å; L95-C99 WeakPolarHBondContact O-CB 3.49Å; L95-C99 PolarHBondContact O-N 3.23Å
96	K	91.2	Very high	93.7	Very high	78 Å²	78	90.5 Å²	90.5	34%	0.339	47%	0.467	S	S	.	.	H	α-helix	trans	-57.6	-45.1	173.8	-69.6	-175.1	-163.9	-147.9	0	111.4	L92 C99 K100 L127	L92-K96 VanDerWaalsContact O-CG 3.3Å; L92-K96 WeakPolarHBondContact O-CG 3.37Å; L92-K96 PolarHBondContact O-N 3.01Å; K96-C99 PolarHBondContact O-N 2.62Å; K96-K100 WeakPolarHBondContact O-CG 3.42Å; K96-K100 PolarHBondContact O-N 3.26Å; K96-L127 WeakPolarHBondContact CD-O 3.4Å; K96-L127 WeakPolarHBondContact CD-OXT 3.49Å; K96-L127 WeakPolarHBondContact CE-O 3.39Å; K96-L127 WeakPolarHBondContact CG-OXT 3.44Å; K96-L127 PolarHBondContact NZ-O 3.07Å
97	N	92	Very high	93.4	Very high	93 Å²	93	86.7 Å²	86.7	50%	0.497	45%	0.449	S	S	.	.	H	α-helix	trans	-64.9	-41	178.3	-74.2	-22.3	0	0	0	112.4	A93 Q94 L95 K100 K101	A93-N97 VanDerWaalsContact O-CG 3.29Å; A93-N97 PolarHBondContact O-N 3.24Å; A93-N97 PolarHBondContact O-ND2 2.95Å; Q94-N97 PolarHBondContact O-N 3.11Å; L95-N97 VanDerWaalsContact C-N 3.32Å; L95-N97 PolarHBondContact O-N 3.14Å; N97-K100 PolarHBondContact O-N 3.45Å; N97-K101 WeakPolarHBondContact O-CG 3.42Å; N97-K101 PolarHBondContact O-N 2.95Å
98	S	93	Very high	93.3	Very high	65 Å²	65	86.1 Å²	86.1	46%	0.455	45%	0.449	S	S	.	.	H	α-helix	trans	-64.2	-42	174.8	-65.4	0	0	0	0	111.8	Q94 L95 K101 L102	Q94-S98 PolarHBondContact O-N 3.4Å; Q94-S98 PolarHBondContact O-OG 3.28Å; L95-S98 PolarHBondContact O-N 2.93Å; S98-K101 PolarHBondContact O-N 2.9Å; S98-L102 WeakPolarHBondContact O-CG 3.39Å; S98-L102 PolarHBondContact O-N 3.3Å
99	C	90.9	Very high	93.1	Very high	44 Å²	44	84.1 Å²	84.1	30%	0.297	44%	0.441	S	S	.	.	H	α-helix	trans	-61.4	-47.7	175.7	-171.4	0	0	0	0	111.2	L95 K96 K101 L102 V103	L95-C99 WeakPolarHBondContact O-CB 3.49Å; L95-C99 PolarHBondContact O-N 3.23Å; K96-C99 PolarHBondContact O-N 2.62Å; C99-K101 VanDerWaalsContact C-N 3.33Å; C99-K101 PolarHBondContact O-N 3.49Å; C99-L102 PolarHBondContact O-N 2.87Å; C99-L102 VanDerWaalsContact O-N 3.12Å; C99-V103 WeakPolarHBondContact O-CG2 3.41Å; C99-V103 PolarHBondContact O-N 3.45Å
100	K	89.5	Confident	93	Very high	117 Å²	117	83.4 Å²	83.4	51%	0.509	43%	0.434	S	S	.	.	H	α-helix	trans	-56.1	-44.5	175.1	-74.6	179.8	-179.9	-174.7	0	112.6	K96 N97 L102 V103 S104	K96-K100 WeakPolarHBondContact O-CG 3.42Å; K96-K100 PolarHBondContact O-N 3.26Å; N97-K100 PolarHBondContact O-N 3.45Å; K100-L102 PolarHBondContact O-N 3.49Å; K100-V103 PolarHBondContact O-N 2.85Å; K100-S104 PolarHBondContact O-N 2.89Å; K100-S104 PolarHBondContact O-OG 3.26Å; K100-S104 VanDerWaalsContact O-OG 3.12Å
101	K	91.7	Very high	92.9	Very high	157 Å²	157	80.9 Å²	80.9	68%	0.683	42%	0.42	S	S	*	.	H	α-helix	trans	-62	-41.7	176.7	-73.2	177.3	-179.6	-177.1	0	112.5	N97 S98 C99 F105	N97-K101 WeakPolarHBondContact O-CG 3.42Å; N97-K101 PolarHBondContact O-N 2.95Å; S98-K101 PolarHBondContact O-N 2.9Å; C99-K101 VanDerWaalsContact C-N 3.33Å; C99-K101 PolarHBondContact O-N 3.49Å; K101-F105 WeakPolarHBondContact O-CB 3.34Å; K101-F105 PolarHBondContact O-N 3.22Å
102	L	91.9	Very high	92.8	Very high	112 Å²	112	85.7 Å²	85.7	59%	0.586	44%	0.435	S	S	*	.	H	α-helix	trans	-66.8	-41.6	177	-72.5	169.9	0	0	0	111.8	S98 C99 K100 F105 L106	S98-L102 WeakPolarHBondContact O-CG 3.39Å; S98-L102 PolarHBondContact O-N 3.3Å; C99-L102 PolarHBondContact O-N 2.87Å; C99-L102 VanDerWaalsContact O-N 3.12Å; K100-L102 PolarHBondContact O-N 3.49Å; L102-F105 PolarHBondContact O-N 2.93Å; L102-L106 VanDerWaalsContact O-CG 3.32Å; L102-L106 WeakPolarHBondContact O-CG 3.37Å; L102-L106 PolarHBondContact O-N 2.93Å
103	V	91.4	Very high	92.8	Very high	18 Å²	18	87.4 Å²	87.4	11%	0.109	44%	0.443	C	S	.	.	H	α-helix	trans	-60.3	-50.7	175.1	171	0	0	0	0	110.2	C99 K100 F105 L106 E107 I120	C99-V103 WeakPolarHBondContact O-CG2 3.41Å; C99-V103 PolarHBondContact O-N 3.45Å; K100-V103 PolarHBondContact O-N 2.85Å; V103-F105 VanDerWaalsContact C-N 3.32Å; V103-F105 PolarHBondContact O-N 3.43Å; V103-L106 PolarHBondContact O-N 3.32Å; V103-L106 VanDerWaalsContact O-N 3.14Å; V103-E107 HydrophobicContact CG1-CG 4.27Å; V103-E107 WeakPolarHBondContact O-CG 3.3Å; V103-E107 PolarHBondContact O-N 3.3Å; V103-I120 HydrophobicContact CG1-CB 4.23Å; V103-I120 HydrophobicContact CG1-CD1 4.41Å
104	S	90.7	Very high	92.8	Very high	58 Å²	58	88.1 Å²	88.1	41%	0.406	45%	0.445	S	S	.	.	H	α-helix	trans	-59.7	-41.3	177.7	-59.7	0	0	0	0	112.4	K100 L106 E107 D108	K100-S104 PolarHBondContact O-N 2.89Å; K100-S104 PolarHBondContact O-OG 3.26Å; K100-S104 VanDerWaalsContact O-OG 3.12Å; S104-L106 PolarHBondContact O-N 3.45Å; S104-E107 PolarHBondContact O-N 2.89Å; S104-D108 WeakPolarHBondContact O-CB 3.34Å; S104-D108 PolarHBondContact O-N 3.49Å
105	F	93.4	Very high	92.6	Very high	124 Å²	124	89.8 Å²	89.8	54%	0.544	46%	0.458	S	S	.	.	H	α-helix	trans	-60.9	-44	175.2	176.1	-97.5	0	0	0	112.3	K101 L102 V103 D108 E109	K101-F105 WeakPolarHBondContact O-CB 3.34Å; K101-F105 PolarHBondContact O-N 3.22Å; L102-F105 PolarHBondContact O-N 2.93Å; V103-F105 VanDerWaalsContact C-N 3.32Å; V103-F105 PolarHBondContact O-N 3.43Å; F105-D108 PolarHBondContact O-N 2.96Å; F105-E109 HydrophobicContact CE1-CG 4.08Å; F105-E109 HydrophobicContact CE2-CG 4.17Å; F105-E109 HydrophobicContact CZ-CG 3.87Å; F105-E109 WeakPolarHBondContact O-CG 3.48Å; F105-E109 PolarHBondContact O-N 3.3Å
106	L	92.8	Very high	92.6	Very high	87 Å²	87	92.8 Å²	92.8	46%	0.455	46%	0.461	S	S	.	.	H	α-helix	trans	-67.6	-40	177.4	-71.4	171.9	0	0	0	112.2	L102 V103 S104 D108 E109 L110 I120	L102-L106 VanDerWaalsContact O-CG 3.32Å; L102-L106 WeakPolarHBondContact O-CG 3.37Å; L102-L106 PolarHBondContact O-N 2.93Å; V103-L106 PolarHBondContact O-N 3.32Å; V103-L106 VanDerWaalsContact O-N 3.14Å; S104-L106 PolarHBondContact O-N 3.45Å; L106-D108 VanDerWaalsContact C-N 3.34Å; L106-E109 PolarHBondContact O-N 3.33Å; L106-L110 VanDerWaalsContact O-CB 3.26Å; L106-L110 WeakPolarHBondContact O-CB 3.27Å; L106-L110 WeakPolarHBondContact O-CG 3.38Å; L106-L110 PolarHBondContact O-N 3.49Å; L106-I120 HydrophobicContact CB-CD1 3.7Å; L106-I120 HydrophobicContact CD1-CD1 4.3Å
107	E	92.8	Very high	92.5	Very high	42 Å²	42	96.5 Å²	96.5	20%	0.196	48%	0.479	C	S	.	.	H	α-helix	trans	-61	-42.8	175	-74.4	178.9	155.5	0	0	111.4	V103 S104 S111 Q119 I120	V103-E107 HydrophobicContact CG1-CG 4.27Å; V103-E107 WeakPolarHBondContact O-CG 3.3Å; V103-E107 PolarHBondContact O-N 3.3Å; S104-E107 PolarHBondContact O-N 2.89Å; E107-S111 WeakPolarHBondContact O-CB 3.01Å; E107-S111 PolarHBondContact O-N 3.16Å; E107-S111 PolarHBondContact O-OG 3.4Å; E107-Q119 WeakPolarHBondContact OE1-CA 3.3Å; E107-I120 HydrophobicContact CG-CB 4.29Å; E107-I120 HydrophobicContact CG-CD1 4.05Å; E107-I120 HydrophobicContact CG-CG1 3.83Å; E107-I120 PolarHBondContact OE1-N 3.03Å
108	D	93.7	Very high	92.5	Very high	95 Å²	95	93.6 Å²	93.6	51%	0.508	47%	0.465	S	S	.	.	H	α-helix	trans	-63.1	-48.2	176.3	-76.2	-20.4	0	0	0	111.6	S104 F105 L106 S111 R112	S104-D108 WeakPolarHBondContact O-CB 3.34Å; S104-D108 PolarHBondContact O-N 3.49Å; F105-D108 PolarHBondContact O-N 2.96Å; L106-D108 VanDerWaalsContact C-N 3.34Å; D108-S111 PolarHBondContact O-N 3.29Å; D108-R112 VanDerWaalsContact O-CG 3.32Å; D108-R112 WeakPolarHBondContact O-CG 3.33Å; D108-R112 PolarHBondContact O-N 2.79Å
109	E	94.4	Very high	92.2	Very high	66 Å²	66	96.6 Å²	96.6	31%	0.308	47%	0.472	S	S	.	.	H	α-helix	trans	-66.3	-43.2	179.7	-73.5	-60.7	120.8	0	0	112.3	F105 L106 S111 R112 I113	F105-E109 HydrophobicContact CE1-CG 4.08Å; F105-E109 HydrophobicContact CE2-CG 4.17Å; F105-E109 HydrophobicContact CZ-CG 3.87Å; F105-E109 WeakPolarHBondContact O-CG 3.48Å; F105-E109 PolarHBondContact O-N 3.3Å; L106-E109 PolarHBondContact O-N 3.33Å; E109-S111 VanDerWaalsContact C-N 3.34Å; E109-S111 PolarHBondContact O-N 2.94Å; E109-R112 PolarHBondContact O-N 2.89Å; E109-R112 IonicContact OE1-CZ 3.64Å; E109-R112 IonicContact OE1-NH1 2.74Å; E109-R112 PolarHBondContact OE1-NH1 3.44Å; E109-I113 WeakPolarHBondContact O-CG1 3.47Å; E109-I113 PolarHBondContact O-N 2.95Å
110	L	93.9	Very high	91.9	Very high	69 Å²	69	96.9 Å²	96.9	36%	0.361	47%	0.469	S	S	.	.	H	α-helix	trans	-65.4	-38.3	175.2	-72	173	0	0	0	111.7	L106 R112 I113 C114 V118 I120	L106-L110 VanDerWaalsContact O-CB 3.26Å; L106-L110 WeakPolarHBondContact O-CB 3.27Å; L106-L110 WeakPolarHBondContact O-CG 3.38Å; L106-L110 PolarHBondContact O-N 3.49Å; L110-R112 VanDerWaalsContact C-N 3.3Å; L110-R112 PolarHBondContact O-N 3.48Å; L110-I113 PolarHBondContact O-N 2.89Å; L110-C114 VanDerWaalsContact O-CB 3.31Å; L110-C114 WeakPolarHBondContact O-CB 3.45Å; L110-C114 PolarHBondContact O-N 3.15Å; L110-C114 PolarHBondContact O-SG 2.92Å; L110-V118 HydrophobicContact CB-CB 4.09Å; L110-V118 HydrophobicContact CB-CG1 4.05Å; L110-V118 HydrophobicContact CB-CG2 4.26Å; L110-V118 HydrophobicContact CD1-CG1 4.18Å; L110-I120 HydrophobicContact CD1-CD1 4.48Å
111	S	94.9	Very high	91.5	Very high	27 Å²	27	97.3 Å²	97.3	19%	0.189	48%	0.482	C	S	.	.	H	α-helix	trans	-64.4	-38.1	178.3	-63.2	0	0	0	0	111.8	E107 D108 E109 N115 R116 V118	E107-S111 WeakPolarHBondContact O-CB 3.01Å; E107-S111 PolarHBondContact O-N 3.16Å; E107-S111 PolarHBondContact O-OG 3.4Å; D108-S111 PolarHBondContact O-N 3.29Å; E109-S111 VanDerWaalsContact C-N 3.34Å; E109-S111 PolarHBondContact O-N 2.94Å; S111-N115 PolarHBondContact O-N 3.11Å; S111-R116 WeakPolarHBondContact CA-O 3.38Å; S111-R116 VanDerWaalsContact CB-O 3.31Å; S111-R116 WeakPolarHBondContact CB-O 3.24Å; S111-R116 PolarHBondContact O-N 2.65Å; S111-R116 PolarHBondContact OG-O 3.26Å; S111-V118 PolarHBondContact OG-N 3.47Å
112	R	94.7	Very high	90.5	Very high	169 Å²	169	91.6 Å²	91.6	64%	0.638	47%	0.468	S	S	*	.	H	α-helix	trans	-63.6	-47.4	172.6	-71.9	170.4	-176	177.4	-0.8	111.9	D108 E109 L110 N115	D108-R112 VanDerWaalsContact O-CG 3.32Å; D108-R112 WeakPolarHBondContact O-CG 3.33Å; D108-R112 PolarHBondContact O-N 2.79Å; E109-R112 PolarHBondContact O-N 2.89Å; E109-R112 IonicContact OE1-CZ 3.64Å; E109-R112 IonicContact OE1-NH1 2.74Å; E109-R112 PolarHBondContact OE1-NH1 3.44Å; L110-R112 VanDerWaalsContact C-N 3.3Å; L110-R112 PolarHBondContact O-N 3.48Å; R112-N115 PolarHBondContact O-OD1 2.82Å
113	I	95.1	Very high	89.3	Confident	129 Å²	129	94 Å²	94	66%	0.662	48%	0.476	S	S	*	.	H	α-helix	trans	-65.4	-40.8	-179.4	-67.4	167.1	0	0	0	111.3	E109 L110	E109-I113 WeakPolarHBondContact O-CG1 3.47Å; E109-I113 PolarHBondContact O-N 2.95Å; L110-I113 PolarHBondContact O-N 2.89Å
114	C	92.3	Very high	87.7	Confident	62 Å²	62	99.9 Å²	99.9	42%	0.419	50%	0.5	S	S	.	.	H	α-helix	trans	-87.6	-3.6	-176.3	-67.3	0	0	0	0	114.5	L110 R116 V118	L110-C114 VanDerWaalsContact O-CB 3.31Å; L110-C114 WeakPolarHBondContact O-CB 3.45Å; L110-C114 PolarHBondContact O-N 3.15Å; L110-C114 PolarHBondContact O-SG 2.92Å; C114-R116 HydrophobicContact CB-CG 3.93Å; C114-R116 PolarHBondContact O-N 3.43Å; C114-R116 VanDerWaalsContact O-N 3.14Å; C114-V118 HydrophobicContact CB-CG2 4.12Å
115	N	92.6	Very high	85.9	Confident	154 Å²	154	99.7 Å²	99.7	82%	0.824	50%	0.499	S	S	*	.	T	Hydrogen-bonded Turn	trans	49.5	33.9	-173.5	-72.6	-35.4	0	0	0	114	S111 R112	S111-N115 PolarHBondContact O-N 3.11Å; R112-N115 PolarHBondContact O-OD1 2.82Å
116	R	91.7	Very high	84.2	Confident	182 Å²	182	100.6 Å²	100.6	69%	0.687	51%	0.509	S	S	*	.	S	Bend	trans	-155.4	157.1	176.4	65.9	178.3	179.9	168	-0.9	109.4	S111 C114 V118	S111-R116 WeakPolarHBondContact CA-O 3.38Å; S111-R116 VanDerWaalsContact CB-O 3.31Å; S111-R116 WeakPolarHBondContact CB-O 3.24Å; S111-R116 PolarHBondContact O-N 2.65Å; S111-R116 PolarHBondContact OG-O 3.26Å; C114-R116 HydrophobicContact CB-CG 3.93Å; C114-R116 PolarHBondContact O-N 3.43Å; C114-R116 VanDerWaalsContact O-N 3.14Å; R116-V118 HydrophobicContact CG-CG2 4.41Å; R116-V118 PolarHBondContact O-N 2.93Å
117	Q	90.4	Very high	82.2	Confident	157 Å²	157	102.4 Å²	102.4	73%	0.734	52%	0.519	S	S	*	.			trans	-63.4	124.5	173.3	-170.7	175	6.5	0	0	110.6
118	V	90.1	Very high	81.7	Confident	31 Å²	31	105.5 Å²	105.5	19%	0.188	54%	0.535	C	S	.	.			trans	-112.8	130	174.5	178.1	0	0	0	0	108.4	L110 S111 C114 R116	L110-V118 HydrophobicContact CB-CB 4.09Å; L110-V118 HydrophobicContact CB-CG1 4.05Å; L110-V118 HydrophobicContact CB-CG2 4.26Å; L110-V118 HydrophobicContact CD1-CG1 4.18Å; S111-V118 PolarHBondContact OG-N 3.47Å; C114-V118 HydrophobicContact CB-CG2 4.12Å; R116-V118 HydrophobicContact CG-CG2 4.41Å; R116-V118 PolarHBondContact O-N 2.93Å
119	Q	88.3	Confident	81	Confident	129 Å²	129	106 Å²	106	60%	0.603	54%	0.536	S	S	*	.			trans	-116.5	129.5	172.6	-70.3	179.8	-7.5	0	0	109.1	E107 T121	E107-Q119 WeakPolarHBondContact OE1-CA 3.3Å; Q119-T121 PolarHBondContact O-N 3.29Å
120	I	84.6	Confident	80.3	Confident	49 Å²	49	108.2 Å²	108.2	25%	0.251	55%	0.549	S	S	.	.			trans	-82.1	105.2	174.9	-62.9	173.4	0	0	0	107	V103 L106 E107 L110	V103-I120 HydrophobicContact CG1-CB 4.23Å; V103-I120 HydrophobicContact CG1-CD1 4.41Å; L106-I120 HydrophobicContact CB-CD1 3.7Å; L106-I120 HydrophobicContact CD1-CD1 4.3Å; E107-I120 HydrophobicContact CG-CB 4.29Å; E107-I120 HydrophobicContact CG-CD1 4.05Å; E107-I120 HydrophobicContact CG-CG1 3.83Å; E107-I120 PolarHBondContact OE1-N 3.03Å; L110-I120 HydrophobicContact CD1-CD1 4.48Å
121	T	81.1	Confident	79.5	Confident	126 Å²	126	110.5 Å²	110.5	77%	0.773	56%	0.56	S	S	*	*			trans	-90.6	137.6	175.5	52.6	0	0	0	0	110.1	Q119	Q119-T121 PolarHBondContact O-N 3.29Å
122	G	70.8	Confident	78.5	Confident	37 Å²	37	115.8 Å²	115.8	38%	0.381	58%	0.583	S	S	.	*	S	Bend	trans	151.3	166.1	176.8	0	0	0	0	0	113.3	F124 C125	G122-F124 PolarHBondContact O-N 3.06Å; G122-C125 PolarHBondContact O-N 2.77Å
123	Q	65.8	Low	77.4	Confident	162 Å²	162	112.2 Å²	112.2	76%	0.757	58%	0.579	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.1	-14.5	-178.9	-68.4	178.9	-11.1	0	0	114	C125 D126 L127	Q123-C125 PolarHBondContact O-N 3.22Å; Q123-D126 PolarHBondContact O-N 3.04Å; Q123-L127 WeakPolarHBondContact O-CG 3.24Å; Q123-L127 PolarHBondContact O-N 3.2Å
124	F	58.4	Low	76.2	Confident	142 Å²	142	111 Å²	111	62%	0.623	57%	0.574	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.9	-28.9	172.6	-58.1	-75	0	0	0	113	G122	G122-F124 PolarHBondContact O-N 3.06Å
125	C	53.1	Low	75	Confident	55 Å²	55	114.8 Å²	114.8	37%	0.372	59%	0.585	S	S	.	*	T	Hydrogen-bonded Turn	trans	-86.1	-22	178.1	-65.1	0	0	0	0	113.3	G122 Q123	G122-C125 PolarHBondContact O-N 2.77Å; Q123-C125 PolarHBondContact O-N 3.22Å
126	D	56.5	Low	73.5	Confident	143 Å²	143	111.5 Å²	111.5	77%	0.765	57%	0.566	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.1	-8.3	-179.6	-65.8	-32.2	0	0	0	113.2	Q123	Q123-D126 PolarHBondContact O-N 3.04Å
127	L	51.1	Low	71.8	Confident	125 Å²	125	105.1 Å²	105.1	65%	0.654	56%	0.555	S	S	*	*			trans	-69.2	0	171.8	-79.2	166.3	0	0	0	111.3	K96 Q123	K96-L127 WeakPolarHBondContact CD-O 3.4Å; K96-L127 WeakPolarHBondContact CD-OXT 3.49Å; K96-L127 WeakPolarHBondContact CE-O 3.39Å; K96-L127 WeakPolarHBondContact CG-OXT 3.44Å; K96-L127 PolarHBondContact NZ-O 3.07Å; Q123-L127 WeakPolarHBondContact O-CG 3.24Å; Q123-L127 PolarHBondContact O-N 3.2Å

Retrieved 127 of 127 residues in 51.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).