A0A5K4FEB9_SCHMA Loading...

Lipoprotein

AlphaFold DB , UniProt , Accession A0A5K4FEB9, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 76 aa.

						>A0A5K4FEB9_SCHMA|A0A5K4FEB9
MKDQPDEAFYDRCYRLRCNKNQLRVDRFSYIGLGCGGIAGFANAFGPMQTAVIGMMIGTVAAVCCNQIKSSTSTQK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.2	Low	70.7	Confident	214 Å²	214	129.2 Å²	129.2	100%	1.054	64%	0.638	S	S	*	*				0	43.8	0	-58.4	-177.2	-178.9	0	0	110.7
2	K	61.9	Low	71.2	Confident	200 Å²	200	133 Å²	133	87%	0.87	64%	0.64	S	S	*	*			trans	-114.2	-3.2	-175.1	-88.2	-177.1	170.7	178.5	0	114.3
3	D	66.1	Low	71.7	Confident	159 Å²	159	128.8 Å²	128.8	85%	0.85	63%	0.631	S	S	*	*	S	Bend	trans	-121	23.8	-169.9	-54.7	-72	0	0	0	113.6
4	Q	64.6	Low	72.1	Confident	116 Å²	116	130.7 Å²	130.7	54%	0.542	63%	0.63	S	S	.	*	S	Bend	trans	-105.6	132.4	170.4	-65.9	-161.6	-15.8	0	0	109	D6 A8 F9	Q4-D6 PolarHBondContact O-N 2.81Å; Q4-A8 HydrophobicContact CB-CB 4.37Å; Q4-F9 HydrophobicContact CB-CD2 4.38Å; Q4-F9 HydrophobicContact CB-CE2 3.82Å; Q4-F9 HydrophobicContact CB-CZ 4.42Å
5	P	72.1	Confident	72.4	Confident	89 Å²	89	133.1 Å²	133.1	58%	0.578	63%	0.629	S	S	*	*			trans	-57.1	139.4	176.8	25.4	-33.2	0	0	0	108.5	E7 A8	P5-E7 PolarHBondContact O-N 3.45Å; P5-A8 HydrophobicContact CG-CB 4.37Å; P5-A8 WeakPolarHBondContact O-CB 3.07Å; P5-A8 PolarHBondContact O-N 2.94Å
6	D	71.7	Confident	72.4	Confident	120 Å²	120	129 Å²	129	64%	0.642	61%	0.612	S	S	*	*	H	α-helix	trans	-50.3	-31.3	-176.1	-65	-48.7	0	0	0	112.2	Q4 A8 F9 Y10	Q4-D6 PolarHBondContact O-N 2.81Å; D6-A8 VanDerWaalsContact C-N 3.3Å; D6-A8 PolarHBondContact O-N 3.02Å; D6-F9 WeakPolarHBondContact O-CB 3.39Å; D6-F9 PolarHBondContact O-N 3.48Å; D6-Y10 HydrophobicContact CB-CD2 4.38Å; D6-Y10 HydrophobicContact CB-CE2 4.1Å; D6-Y10 WeakPolarHBondContact O-CD2 3.39Å; D6-Y10 PolarHBondContact O-N 2.88Å
7	E	75	Confident	72.2	Confident	159 Å²	159	132.8 Å²	132.8	74%	0.743	62%	0.619	S	S	*	*	H	α-helix	trans	-52.1	-40.8	172.6	-61.5	-176.7	179	0	0	113.9	P5 F9 Y10 D11	P5-E7 PolarHBondContact O-N 3.45Å; E7-F9 VanDerWaalsContact C-N 3.33Å; E7-F9 PolarHBondContact O-N 3.29Å; E7-Y10 PolarHBondContact O-N 2.77Å; E7-D11 PolarHBondContact O-N 3.27Å
8	A	76.1	Confident	72.4	Confident	39 Å²	39	129.4 Å²	129.4	32%	0.322	61%	0.612	S	S	.	*	H	α-helix	trans	-68.1	-34.4	178.5	0	0	0	0	0	111.8	Q4 P5 D6 R12	Q4-A8 HydrophobicContact CB-CB 4.37Å; P5-A8 HydrophobicContact CG-CB 4.37Å; P5-A8 WeakPolarHBondContact O-CB 3.07Å; P5-A8 PolarHBondContact O-N 2.94Å; D6-A8 VanDerWaalsContact C-N 3.3Å; D6-A8 PolarHBondContact O-N 3.02Å; A8-R12 WeakPolarHBondContact O-CB 3.41Å; A8-R12 PolarHBondContact O-N 3.05Å; A8-R12 VanDerWaalsContact O-N 3.11Å
9	F	75.5	Confident	72.7	Confident	81 Å²	81	126.2 Å²	126.2	36%	0.355	60%	0.599	S	S	.	*	H	α-helix	trans	-67.1	-43.4	172.6	-72.6	-83.2	0	0	0	111	Q4 D6 E7 R12 C13	Q4-F9 HydrophobicContact CB-CD2 4.38Å; Q4-F9 HydrophobicContact CB-CE2 3.82Å; Q4-F9 HydrophobicContact CB-CZ 4.42Å; D6-F9 WeakPolarHBondContact O-CB 3.39Å; D6-F9 PolarHBondContact O-N 3.48Å; E7-F9 VanDerWaalsContact C-N 3.33Å; E7-F9 PolarHBondContact O-N 3.29Å; F9-R12 PolarHBondContact O-N 3.11Å; F9-C13 WeakPolarHBondContact O-CB 3.34Å; F9-C13 PolarHBondContact O-N 3.4Å; F9-C13 PolarHBondContact O-SG 2.85Å
10	Y	78.7	Confident	72.9	Confident	173 Å²	173	128.1 Å²	128.1	68%	0.678	61%	0.605	S	S	*	*	H	α-helix	trans	-65	-43.4	177.5	-72.3	-69.3	0	0	0	112.7	D6 E7 R12 C13 Y14	D6-Y10 HydrophobicContact CB-CD2 4.38Å; D6-Y10 HydrophobicContact CB-CE2 4.1Å; D6-Y10 WeakPolarHBondContact O-CD2 3.39Å; D6-Y10 PolarHBondContact O-N 2.88Å; E7-Y10 PolarHBondContact O-N 2.77Å; Y10-R12 VanDerWaalsContact C-N 3.33Å; Y10-R12 PolarHBondContact O-N 2.94Å; Y10-C13 PolarHBondContact O-N 3.24Å; Y10-Y14 VanDerWaalsContact O-CB 3.29Å; Y10-Y14 WeakPolarHBondContact O-CB 3.32Å; Y10-Y14 PolarHBondContact O-N 3.43Å
11	D	82.6	Confident	73.1	Confident	71 Å²	71	125.4 Å²	125.4	38%	0.38	59%	0.594	S	S	.	*	H	α-helix	trans	-61.5	-42.7	175.8	-175.4	40.4	0	0	0	111.1	E7 C13 Y14 R15	E7-D11 PolarHBondContact O-N 3.27Å; D11-C13 PolarHBondContact O-N 2.8Å; D11-Y14 PolarHBondContact O-N 3.46Å; D11-R15 WeakPolarHBondContact O-CG 3.38Å; D11-R15 PolarHBondContact O-N 2.94Å; D11-R15 IonicContact OD1-NE 3.21Å; D11-R15 PolarHBondContact OD1-NE 3.49Å; D11-R15 IonicContact OD2-CZ 2.94Å; D11-R15 IonicContact OD2-NE 3.43Å; D11-R15 PolarHBondContact OD2-NE 3.29Å; D11-R15 IonicContact OD2-NH2 2.77Å; D11-R15 PolarHBondContact OD2-NH2 3.38Å
12	R	77.2	Confident	74.2	Confident	175 Å²	175	119.6 Å²	119.6	66%	0.66	56%	0.564	S	S	*	*	H	α-helix	trans	-62.5	-46.8	176.4	-170	176.1	-174.7	-177.6	1.1	111.9	A8 F9 Y10 Y14 R15 L16	A8-R12 WeakPolarHBondContact O-CB 3.41Å; A8-R12 PolarHBondContact O-N 3.05Å; A8-R12 VanDerWaalsContact O-N 3.11Å; F9-R12 PolarHBondContact O-N 3.11Å; Y10-R12 VanDerWaalsContact C-N 3.33Å; Y10-R12 PolarHBondContact O-N 2.94Å; R12-Y14 VanDerWaalsContact C-N 3.3Å; R12-Y14 PolarHBondContact O-N 2.9Å; R12-R15 PolarHBondContact O-N 3.5Å; R12-L16 HydrophobicContact CG-CD1 4.25Å; R12-L16 WeakPolarHBondContact O-CB 3.41Å; R12-L16 VanDerWaalsContact O-CG 3.24Å; R12-L16 WeakPolarHBondContact O-CG 3.29Å; R12-L16 PolarHBondContact O-N 3.32Å
13	C	77.7	Confident	75	Confident	78 Å²	78	113 Å²	113	53%	0.527	54%	0.538	S	S	.	.	H	α-helix	trans	-62.1	-37.9	175.7	-73.2	0	0	0	0	111.9	F9 Y10 D11 L16 R17	F9-C13 WeakPolarHBondContact O-CB 3.34Å; F9-C13 PolarHBondContact O-N 3.4Å; F9-C13 PolarHBondContact O-SG 2.85Å; Y10-C13 PolarHBondContact O-N 3.24Å; D11-C13 PolarHBondContact O-N 2.8Å; C13-L16 PolarHBondContact O-N 3.45Å; C13-R17 WeakPolarHBondContact O-CB 3.24Å; C13-R17 PolarHBondContact O-N 3.45Å
14	Y	77	Confident	75.7	Confident	156 Å²	156	108.9 Å²	108.9	61%	0.612	51%	0.511	S	S	*	.	H	α-helix	trans	-65.9	-47.9	176.8	-172.2	-99.7	0	0	0	111.4	Y10 D11 R12 L16 R17 C18	Y10-Y14 VanDerWaalsContact O-CB 3.29Å; Y10-Y14 WeakPolarHBondContact O-CB 3.32Å; Y10-Y14 PolarHBondContact O-N 3.43Å; D11-Y14 PolarHBondContact O-N 3.46Å; R12-Y14 VanDerWaalsContact C-N 3.3Å; R12-Y14 PolarHBondContact O-N 2.9Å; Y14-L16 VanDerWaalsContact C-N 3.32Å; Y14-L16 PolarHBondContact O-N 2.8Å; Y14-R17 CarbonylContact O-C 3.57Å; Y14-R17 PolarHBondContact O-N 2.87Å; Y14-R17 VanDerWaalsContact O-N 3.09Å; Y14-C18 WeakPolarHBondContact CE1-SG 3.11Å; Y14-C18 VanDerWaalsContact CZ-SG 3.58Å; Y14-C18 WeakPolarHBondContact O-CB 3.45Å; Y14-C18 PolarHBondContact O-N 3.41Å; Y14-C18 PolarHBondContact O-SG 3.35Å; Y14-C18 VanDerWaalsContact O-SG 3.37Å
15	R	77.2	Confident	76.5	Confident	166 Å²	166	104.8 Å²	104.8	63%	0.626	49%	0.494	S	S	*	.	H	α-helix	trans	-58.2	-43.4	174.6	-70.7	-179.9	-165.5	-155.1	7	112	D11 R12 R17 C18 N19	D11-R15 WeakPolarHBondContact O-CG 3.38Å; D11-R15 PolarHBondContact O-N 2.94Å; D11-R15 IonicContact OD1-NE 3.21Å; D11-R15 PolarHBondContact OD1-NE 3.49Å; D11-R15 IonicContact OD2-CZ 2.94Å; D11-R15 IonicContact OD2-NE 3.43Å; D11-R15 PolarHBondContact OD2-NE 3.29Å; D11-R15 IonicContact OD2-NH2 2.77Å; D11-R15 PolarHBondContact OD2-NH2 3.38Å; R12-R15 PolarHBondContact O-N 3.5Å; R15-R17 VanDerWaalsContact C-N 3.33Å; R15-R17 PolarHBondContact O-N 2.97Å; R15-C18 PolarHBondContact O-N 3.38Å; R15-N19 PolarHBondContact O-N 3.09Å
16	L	71.4	Confident	77	Confident	68 Å²	68	104.3 Å²	104.3	36%	0.356	49%	0.486	S	S	.	.	H	α-helix	trans	-61.9	-40.8	175.3	-72.4	169.2	0	0	0	111.7	R12 C13 Y14 N19 Q22	R12-L16 HydrophobicContact CG-CD1 4.25Å; R12-L16 WeakPolarHBondContact O-CB 3.41Å; R12-L16 VanDerWaalsContact O-CG 3.24Å; R12-L16 WeakPolarHBondContact O-CG 3.29Å; R12-L16 PolarHBondContact O-N 3.32Å; C13-L16 PolarHBondContact O-N 3.45Å; Y14-L16 VanDerWaalsContact C-N 3.32Å; Y14-L16 PolarHBondContact O-N 2.8Å; L16-N19 PolarHBondContact O-N 3.37Å; L16-Q22 VanDerWaalsContact CD2-CD 3.49Å; L16-Q22 VanDerWaalsContact CD2-OE1 3.23Å
17	R	70.1	Confident	77.6	Confident	193 Å²	193	107 Å²	107	73%	0.728	49%	0.487	S	S	*	.	H	α-helix	trans	-71.3	-33.2	177.5	-166.7	173.7	-172.5	167.4	2	112.9	C13 Y14 R15 N19 L23	C13-R17 WeakPolarHBondContact O-CB 3.24Å; C13-R17 PolarHBondContact O-N 3.45Å; Y14-R17 CarbonylContact O-C 3.57Å; Y14-R17 PolarHBondContact O-N 2.87Å; Y14-R17 VanDerWaalsContact O-N 3.09Å; R15-R17 VanDerWaalsContact C-N 3.33Å; R15-R17 PolarHBondContact O-N 2.97Å; R17-N19 VanDerWaalsContact C-N 3.32Å; R17-L23 HydrophobicContact CG-CD1 4.36Å; R17-L23 WeakPolarHBondContact O-CD1 3.45Å
18	C	75.7	Confident	77.9	Confident	72 Å²	72	103.2 Å²	103.2	49%	0.486	47%	0.468	S	S	.	.	H	α-helix	trans	-72.2	-27.8	174.5	-72.8	0	0	0	0	112.2	Y14 R15 K20	Y14-C18 WeakPolarHBondContact CE1-SG 3.11Å; Y14-C18 VanDerWaalsContact CZ-SG 3.58Å; Y14-C18 WeakPolarHBondContact O-CB 3.45Å; Y14-C18 PolarHBondContact O-N 3.41Å; Y14-C18 PolarHBondContact O-SG 3.35Å; Y14-C18 VanDerWaalsContact O-SG 3.37Å; R15-C18 PolarHBondContact O-N 3.38Å; C18-K20 VanDerWaalsContact C-N 3.28Å; C18-K20 PolarHBondContact O-N 3.01Å
19	N	77.7	Confident	78.2	Confident	68 Å²	68	101.9 Å²	101.9	36%	0.364	46%	0.457	S	S	.	.			trans	-74.6	79.7	174.7	-167.3	-5.2	0	0	0	111.3	R15 L16 R17 N21 Q22 L23	R15-N19 PolarHBondContact O-N 3.09Å; L16-N19 PolarHBondContact O-N 3.37Å; R17-N19 VanDerWaalsContact C-N 3.32Å; N19-N21 PolarHBondContact O-N 3.41Å; N19-N21 WeakPolarHBondContact OD1-CB 3.5Å; N19-N21 PolarHBondContact OD1-N 2.97Å; N19-Q22 HydrophobicContact CB-CB 4.05Å; N19-Q22 PolarHBondContact ND2-OE1 3.16Å; N19-Q22 PolarHBondContact O-N 3.03Å; N19-Q22 PolarHBondContact OD1-N 3.06Å; N19-L23 PolarHBondContact O-N 2.93Å
20	K	77.4	Confident	78.5	Confident	165 Å²	165	105.2 Å²	105.2	72%	0.717	47%	0.468	S	S	*	.	H	α-helix	trans	-53.1	-29.9	178.9	-68.4	-178.5	-179.5	176.8	0	113	C18 R24	C18-K20 VanDerWaalsContact C-N 3.28Å; C18-K20 PolarHBondContact O-N 3.01Å; K20-R24 WeakPolarHBondContact O-CB 3.3Å; K20-R24 PolarHBondContact O-N 2.89Å; K20-R24 VanDerWaalsContact O-N 3.08Å
21	N	77.3	Confident	78.8	Confident	71 Å²	71	101.6 Å²	101.6	38%	0.38	46%	0.46	S	S	.	.	H	α-helix	trans	-68.6	-44.6	177.6	-70.4	-8.4	0	0	0	111	N19 R24 V25 N66	N19-N21 PolarHBondContact O-N 3.41Å; N19-N21 WeakPolarHBondContact OD1-CB 3.5Å; N19-N21 PolarHBondContact OD1-N 2.97Å; N21-R24 WeakPolarHBondContact O-CB 3.44Å; N21-R24 PolarHBondContact O-N 3.42Å; N21-V25 WeakPolarHBondContact O-CG2 3.41Å; N21-V25 PolarHBondContact O-N 3.08Å; N21-V25 VanDerWaalsContact O-N 3.07Å; N21-N66 WeakPolarHBondContact CA-ND2 3.33Å; N21-N66 HydrophobicContact CB-CB 4.42Å; N21-N66 WeakPolarHBondContact CB-ND2 3.49Å; N21-N66 PolarHBondContact O-ND2 3.03Å
22	Q	75.6	Confident	78.7	Confident	92 Å²	92	98.6 Å²	98.6	43%	0.43	45%	0.446	S	S	.	.	H	α-helix	trans	-69	-41.2	177.9	-172.2	167.7	7.7	0	0	112	L16 N19 R24 V25 D26	L16-Q22 VanDerWaalsContact CD2-CD 3.49Å; L16-Q22 VanDerWaalsContact CD2-OE1 3.23Å; N19-Q22 HydrophobicContact CB-CB 4.05Å; N19-Q22 PolarHBondContact ND2-OE1 3.16Å; N19-Q22 PolarHBondContact O-N 3.03Å; N19-Q22 PolarHBondContact OD1-N 3.06Å; Q22-R24 PolarHBondContact O-N 3.45Å; Q22-V25 PolarHBondContact O-N 3.37Å; Q22-V25 VanDerWaalsContact O-N 3.15Å; Q22-D26 WeakPolarHBondContact O-CB 3.14Å; Q22-D26 PolarHBondContact O-N 3.15Å
23	L	79.2	Confident	78.9	Confident	62 Å²	62	93.8 Å²	93.8	33%	0.325	43%	0.432	S	S	.	.	H	α-helix	trans	-58	-36	172	-77.1	179.1	0	0	0	112.5	R17 N19 R27	R17-L23 HydrophobicContact CG-CD1 4.36Å; R17-L23 WeakPolarHBondContact O-CD1 3.45Å; N19-L23 PolarHBondContact O-N 2.93Å; L23-R27 WeakPolarHBondContact O-CB 3.46Å; L23-R27 VanDerWaalsContact O-CG 3.3Å; L23-R27 WeakPolarHBondContact O-CG 3.42Å; L23-R27 PolarHBondContact O-N 3.44Å
24	R	80.3	Confident	79.1	Confident	73 Å²	73	91.6 Å²	91.6	28%	0.275	42%	0.423	S	S	.	.	H	α-helix	trans	-66.4	-48.2	175.7	-172.9	-176.3	-62.9	170.9	-18.8	110.7	K20 N21 Q22 D26 R27 F28 N66	K20-R24 WeakPolarHBondContact O-CB 3.3Å; K20-R24 PolarHBondContact O-N 2.89Å; K20-R24 VanDerWaalsContact O-N 3.08Å; N21-R24 WeakPolarHBondContact O-CB 3.44Å; N21-R24 PolarHBondContact O-N 3.42Å; Q22-R24 PolarHBondContact O-N 3.45Å; R24-D26 VanDerWaalsContact C-N 3.28Å; R24-D26 PolarHBondContact O-N 3.28Å; R24-R27 PolarHBondContact O-N 2.97Å; R24-F28 HydrophobicContact CG-CD2 3.65Å; R24-F28 HydrophobicContact CG-CE2 3.55Å; R24-F28 VanDerWaalsContact O-CD2 3.26Å; R24-F28 WeakPolarHBondContact O-CD2 3.45Å; R24-F28 PolarHBondContact O-N 2.95Å; R24-N66 VanDerWaalsContact CD-OD1 3.32Å; R24-N66 WeakPolarHBondContact CD-OD1 3.2Å; R24-N66 PolarHBondContact NH1-OD1 2.84Å
25	V	81.9	Confident	79.4	Confident	30 Å²	30	88 Å²	88	18%	0.182	42%	0.42	C	S	.	.	H	α-helix	trans	-57	-44.1	176.8	174.7	0	0	0	0	111.3	N21 Q22 F28 S29 T59 A62 V63	N21-V25 WeakPolarHBondContact O-CG2 3.41Å; N21-V25 PolarHBondContact O-N 3.08Å; N21-V25 VanDerWaalsContact O-N 3.07Å; Q22-V25 PolarHBondContact O-N 3.37Å; Q22-V25 VanDerWaalsContact O-N 3.15Å; V25-F28 PolarHBondContact O-N 3.47Å; V25-S29 WeakPolarHBondContact O-CB 3.26Å; V25-S29 PolarHBondContact O-N 3.39Å; V25-T59 HydrophobicContact CG1-CG2 3.92Å; V25-A62 HydrophobicContact CB-CB 4.13Å; V25-A62 HydrophobicContact CG2-CB 3.73Å; V25-V63 HydrophobicContact CG2-CG2 3.94Å
26	D	82.5	Confident	79.3	Confident	78 Å²	78	80.5 Å²	80.5	42%	0.417	39%	0.394	S	S	.	.	H	α-helix	trans	-63.5	-46	179	-163.6	39.3	0	0	0	111.6	Q22 R24 F28 S29 Y30	Q22-D26 WeakPolarHBondContact O-CB 3.14Å; Q22-D26 PolarHBondContact O-N 3.15Å; R24-D26 VanDerWaalsContact C-N 3.28Å; R24-D26 PolarHBondContact O-N 3.28Å; D26-F28 PolarHBondContact O-N 2.94Å; D26-S29 VanDerWaalsContact O-CB 3.29Å; D26-S29 WeakPolarHBondContact O-CB 3.29Å; D26-S29 PolarHBondContact O-N 3.07Å; D26-S29 VanDerWaalsContact O-N 3.16Å; D26-Y30 WeakPolarHBondContact O-CD2 3.36Å; D26-Y30 PolarHBondContact O-N 3.27Å; D26-Y30 WeakPolarHBondContact OD1-CE2 3.26Å; D26-Y30 WeakPolarHBondContact OD2-CE2 3.32Å
27	R	82.9	Confident	79.6	Confident	177 Å²	177	77.8 Å²	77.8	67%	0.668	38%	0.383	S	S	*	.	H	α-helix	trans	-59.9	-45.7	175.1	-75.1	177.1	-179.7	-165.6	-0.7	113	L23 R24 S29 Y30 I31	L23-R27 WeakPolarHBondContact O-CB 3.46Å; L23-R27 VanDerWaalsContact O-CG 3.3Å; L23-R27 WeakPolarHBondContact O-CG 3.42Å; L23-R27 PolarHBondContact O-N 3.44Å; R24-R27 PolarHBondContact O-N 2.97Å; R27-S29 VanDerWaalsContact C-N 3.29Å; R27-S29 PolarHBondContact O-N 3.33Å; R27-Y30 PolarHBondContact O-N 3.46Å; R27-I31 VanDerWaalsContact O-CG1 3.26Å; R27-I31 WeakPolarHBondContact O-CG1 3.41Å; R27-I31 PolarHBondContact O-N 2.96Å
28	F	81.5	Confident	80.1	Confident	79 Å²	79	74.7 Å²	74.7	35%	0.346	38%	0.379	S	S	.	.	H	α-helix	trans	-67.1	-32.1	176.9	-84.1	-77.6	0	0	0	112.2	R24 V25 D26 I31 G32 G58 A62	R24-F28 HydrophobicContact CG-CD2 3.65Å; R24-F28 HydrophobicContact CG-CE2 3.55Å; R24-F28 VanDerWaalsContact O-CD2 3.26Å; R24-F28 WeakPolarHBondContact O-CD2 3.45Å; R24-F28 PolarHBondContact O-N 2.95Å; V25-F28 PolarHBondContact O-N 3.47Å; D26-F28 PolarHBondContact O-N 2.94Å; F28-I31 PolarHBondContact O-N 3.48Å; F28-G32 PolarHBondContact O-N 3.27Å; F28-G58 WeakPolarHBondContact CB-O 3.46Å; F28-A62 HydrophobicContact CB-CB 3.74Å; F28-A62 HydrophobicContact CD2-CB 3.58Å; F28-A62 HydrophobicContact CE2-CB 4.45Å; F28-A62 HydrophobicContact CG-CB 3.88Å
29	S	82.2	Confident	80.2	Confident	12 Å²	12	73.2 Å²	73.2	8%	0.084	37%	0.372	C	S	.	.	H	α-helix	trans	-62.4	-47.3	171.8	-169.7	0	0	0	0	111.2	V25 D26 R27 I31 G32 L33 M55	V25-S29 WeakPolarHBondContact O-CB 3.26Å; V25-S29 PolarHBondContact O-N 3.39Å; D26-S29 VanDerWaalsContact O-CB 3.29Å; D26-S29 WeakPolarHBondContact O-CB 3.29Å; D26-S29 PolarHBondContact O-N 3.07Å; D26-S29 VanDerWaalsContact O-N 3.16Å; R27-S29 VanDerWaalsContact C-N 3.29Å; R27-S29 PolarHBondContact O-N 3.33Å; S29-I31 PolarHBondContact O-N 3.27Å; S29-G32 CarbonylContact O-C 3.48Å; S29-G32 WeakPolarHBondContact O-CA 3.45Å; S29-G32 PolarHBondContact O-N 3.33Å; S29-G32 VanDerWaalsContact O-N 3.14Å; S29-L33 PolarHBondContact O-N 3.34Å; S29-M55 WeakPolarHBondContact OG-CE 3.28Å
30	Y	83.1	Confident	80	Confident	150 Å²	150	70 Å²	70	59%	0.588	36%	0.356	S	S	*	.	H	α-helix	trans	-62.9	-40.7	176	-78.4	-65.7	0	0	0	112.9	D26 R27 G32 L33 G34	D26-Y30 WeakPolarHBondContact O-CD2 3.36Å; D26-Y30 PolarHBondContact O-N 3.27Å; D26-Y30 WeakPolarHBondContact OD1-CE2 3.26Å; D26-Y30 WeakPolarHBondContact OD2-CE2 3.32Å; R27-Y30 PolarHBondContact O-N 3.46Å; Y30-G32 VanDerWaalsContact C-N 3.31Å; Y30-L33 PolarHBondContact O-N 3.31Å; Y30-G34 PolarHBondContact O-N 3.39Å
31	I	85.4	Confident	79.9	Confident	98 Å²	98	70.4 Å²	70.4	50%	0.503	36%	0.358	S	S	.	.	H	α-helix	trans	-62.2	-43.9	173.2	-66.9	164.8	0	0	0	109.7	R27 F28 S29 L33 G34 C35	R27-I31 VanDerWaalsContact O-CG1 3.26Å; R27-I31 WeakPolarHBondContact O-CG1 3.41Å; R27-I31 PolarHBondContact O-N 2.96Å; F28-I31 PolarHBondContact O-N 3.48Å; S29-I31 PolarHBondContact O-N 3.27Å; I31-L33 PolarHBondContact O-N 2.95Å; I31-G34 PolarHBondContact O-N 3.17Å; I31-C35 VanDerWaalsContact O-CB 3.32Å; I31-C35 WeakPolarHBondContact O-CB 3.49Å; I31-C35 PolarHBondContact O-N 2.87Å; I31-C35 PolarHBondContact O-SG 2.83Å; I31-C35 VanDerWaalsContact O-SG 3.42Å
32	G	79.7	Confident	79.8	Confident	8 Å²	8	71.3 Å²	71.3	8%	0.082	38%	0.375	C	S	.	.	H	α-helix	trans	-60.5	-40.7	175.5	0	0	0	0	0	113.2	F28 S29 Y30 G36 G54	F28-G32 PolarHBondContact O-N 3.27Å; S29-G32 CarbonylContact O-C 3.48Å; S29-G32 WeakPolarHBondContact O-CA 3.45Å; S29-G32 PolarHBondContact O-N 3.33Å; S29-G32 VanDerWaalsContact O-N 3.14Å; Y30-G32 VanDerWaalsContact C-N 3.31Å; G32-G36 VanDerWaalsContact O-CA 3.31Å; G32-G36 WeakPolarHBondContact O-CA 3.42Å; G32-G36 PolarHBondContact O-N 2.81Å; G32-G54 VanDerWaalsContact C-C 3.49Å; G32-G54 VanDerWaalsContact CA-O 3.28Å; G32-G54 WeakPolarHBondContact CA-O 3.43Å; G32-G54 CarbonylContact O-C 3.47Å; G32-G54 WeakPolarHBondContact O-CA 3.45Å
33	L	80.4	Confident	79.5	Confident	73 Å²	73	71.2 Å²	71.2	38%	0.382	38%	0.377	S	S	.	.	H	α-helix	trans	-61.6	-50.4	174	-170.1	161.3	0	0	0	110.4	S29 Y30 I31 G37 A51 M55	S29-L33 PolarHBondContact O-N 3.34Å; Y30-L33 PolarHBondContact O-N 3.31Å; I31-L33 PolarHBondContact O-N 2.95Å; L33-G37 WeakPolarHBondContact O-CA 3.33Å; L33-G37 PolarHBondContact O-N 3.08Å; L33-A51 HydrophobicContact CG-CB 4.5Å; L33-M55 HydrophobicContact CB-CG 3.54Å; L33-M55 HydrophobicContact CB-SD 3.99Å; L33-M55 HydrophobicContact CD1-CE 4Å; L33-M55 HydrophobicContact CD1-CG 4.34Å; L33-M55 HydrophobicContact CD1-SD 3.62Å; L33-M55 HydrophobicContact CG-CG 4.14Å; L33-M55 HydrophobicContact CG-SD 3.95Å
34	G	81.8	Confident	79.2	Confident	32 Å²	32	73.5 Å²	73.5	33%	0.33	41%	0.405	S	S	.	.	H	α-helix	trans	-63.2	-53.3	-179.5	0	0	0	0	0	112.2	Y30 I31 G37 I38	Y30-G34 PolarHBondContact O-N 3.39Å; I31-G34 PolarHBondContact O-N 3.17Å; G34-G37 PolarHBondContact O-N 3.39Å; G34-I38 VanDerWaalsContact O-CG1 3.24Å; G34-I38 WeakPolarHBondContact O-CG1 3.35Å; G34-I38 PolarHBondContact O-N 3.45Å
35	C	83.4	Confident	78.4	Confident	82 Å²	82	76.4 Å²	76.4	55%	0.554	42%	0.42	S	S	*	.	H	α-helix	trans	-64.1	-43.2	179.2	-69.8	0	0	0	0	111.9	I31 A39	I31-C35 VanDerWaalsContact O-CB 3.32Å; I31-C35 WeakPolarHBondContact O-CB 3.49Å; I31-C35 PolarHBondContact O-N 2.87Å; I31-C35 PolarHBondContact O-SG 2.83Å; I31-C35 VanDerWaalsContact O-SG 3.42Å; C35-A39 WeakPolarHBondContact O-CB 3.37Å; C35-A39 PolarHBondContact O-N 3.22Å
36	G	76.3	Confident	78.1	Confident	7 Å²	7	76.5 Å²	76.5	7%	0.072	43%	0.427	C	S	.	.	H	α-helix	trans	-65.4	-42.7	177.8	0	0	0	0	0	112	G32 A39 G40 T50	G32-G36 VanDerWaalsContact O-CA 3.31Å; G32-G36 WeakPolarHBondContact O-CA 3.42Å; G32-G36 PolarHBondContact O-N 2.81Å; G36-A39 PolarHBondContact O-N 3.31Å; G36-G40 PolarHBondContact O-N 3.25Å; G36-T50 VanDerWaalsContact CA-O 3.29Å; G36-T50 WeakPolarHBondContact CA-O 3.24Å; G36-T50 CarbonylContact O-C 3.51Å; G36-T50 WeakPolarHBondContact O-CB 3.47Å; G36-T50 PolarHBondContact O-OG1 3.14Å
37	G	77.1	Confident	77.8	Confident	12 Å²	12	75.1 Å²	75.1	12%	0.124	42%	0.422	C	S	.	.	H	α-helix	trans	-61.6	-47.6	176.4	0	0	0	0	0	112	L33 G34 G40 F41	L33-G37 WeakPolarHBondContact O-CA 3.33Å; L33-G37 PolarHBondContact O-N 3.08Å; G34-G37 PolarHBondContact O-N 3.39Å; G37-G40 PolarHBondContact O-N 3.08Å; G37-G40 VanDerWaalsContact O-N 3.16Å; G37-F41 VanDerWaalsContact O-CD2 3.24Å; G37-F41 WeakPolarHBondContact O-CD2 3.29Å; G37-F41 PolarHBondContact O-N 3.45Å
38	I	80.5	Confident	77.7	Confident	127 Å²	127	73.9 Å²	73.9	65%	0.651	43%	0.426	S	S	*	.	H	α-helix	trans	-61.9	-44.9	175.4	-65.3	166.7	0	0	0	110.6	G34 G40 F41	G34-I38 VanDerWaalsContact O-CG1 3.24Å; G34-I38 WeakPolarHBondContact O-CG1 3.35Å; G34-I38 PolarHBondContact O-N 3.45Å; I38-G40 PolarHBondContact O-N 2.97Å; I38-F41 PolarHBondContact O-N 3.01Å; I38-F41 VanDerWaalsContact O-N 3.1Å
39	A	77.3	Confident	77.8	Confident	41 Å²	41	75.3 Å²	75.3	34%	0.339	43%	0.434	S	S	.	.	H	α-helix	trans	-61.1	-28.6	177.4	0	0	0	0	0	112.6	C35 G36 F41 A42 N43	C35-A39 WeakPolarHBondContact O-CB 3.37Å; C35-A39 PolarHBondContact O-N 3.22Å; G36-A39 PolarHBondContact O-N 3.31Å; A39-F41 VanDerWaalsContact C-N 3.35Å; A39-A42 PolarHBondContact O-N 3.33Å; A39-N43 PolarHBondContact O-N 2.93Å; A39-N43 VanDerWaalsContact O-N 3.16Å; A39-N43 PolarHBondContact O-ND2 3.22Å
40	G	74	Confident	77.7	Confident	2 Å²	2	75.5 Å²	75.5	2%	0.021	43%	0.434	C	S	.	.	H	α-helix	trans	-75.5	-18.1	176.5	0	0	0	0	0	115.4	G36 G37 I38 A42 N43 T50	G36-G40 PolarHBondContact O-N 3.25Å; G37-G40 PolarHBondContact O-N 3.08Å; G37-G40 VanDerWaalsContact O-N 3.16Å; I38-G40 PolarHBondContact O-N 2.97Å; G40-A42 PolarHBondContact O-N 3.43Å; G40-N43 PolarHBondContact O-N 3.21Å; G40-N43 VanDerWaalsContact O-O 3.09Å; G40-T50 WeakPolarHBondContact CA-OG1 3.38Å; G40-T50 PolarHBondContact N-OG1 2.8Å
41	F	74.9	Confident	77.6	Confident	173 Å²	173	68.8 Å²	68.8	76%	0.759	41%	0.41	S	S	*	.	H	α-helix	trans	-69.5	-24.3	167	-74.9	-85.3	0	0	0	111.8	G37 I38 A39 P47	G37-F41 VanDerWaalsContact O-CD2 3.24Å; G37-F41 WeakPolarHBondContact O-CD2 3.29Å; G37-F41 PolarHBondContact O-N 3.45Å; I38-F41 PolarHBondContact O-N 3.01Å; I38-F41 VanDerWaalsContact O-N 3.1Å; A39-F41 VanDerWaalsContact C-N 3.35Å; F41-P47 HydrophobicContact CD2-CB 4.18Å; F41-P47 HydrophobicContact CE2-CB 3.92Å; F41-P47 HydrophobicContact CZ-CB 4.26Å; F41-P47 HydrophobicContact CZ-CG 4.37Å
42	A	76.6	Confident	77.6	Confident	90 Å²	90	67.6 Å²	67.6	74%	0.744	41%	0.407	S	S	*	.	S	Bend	trans	-95	-10.5	177.6	0	0	0	0	0	113.6	A39 G40	A39-A42 PolarHBondContact O-N 3.33Å; G40-A42 PolarHBondContact O-N 3.43Å
43	N	67.9	Low	77.9	Confident	90 Å²	90	71.5 Å²	71.5	48%	0.481	43%	0.425	S	S	.	.	S	Bend	trans	-109.5	151.5	-177.5	-80.4	-72.6	0	0	0	111.3	A39 G40 F45 T50	A39-N43 PolarHBondContact O-N 2.93Å; A39-N43 VanDerWaalsContact O-N 3.16Å; A39-N43 PolarHBondContact O-ND2 3.22Å; G40-N43 PolarHBondContact O-N 3.21Å; G40-N43 VanDerWaalsContact O-O 3.09Å; N43-F45 PolarHBondContact O-N 3.01Å; N43-T50 HydrophobicContact CB-CG2 4.35Å
44	A	72.7	Confident	78	Confident	109 Å²	109	68.6 Å²	68.6	90%	0.901	41%	0.413	S	S	*	.	S	Bend	trans	-64.3	-22.5	174.4	0	0	0	0	0	112.6	G46	A44-G46 PolarHBondContact O-N 3.43Å
45	F	65	Low	78.1	Confident	134 Å²	134	70 Å²	70	59%	0.588	41%	0.412	S	S	*	.	S	Bend	trans	-77.5	114.2	169.3	-62.2	-80.2	0	0	0	108.3	N43 T50	N43-F45 PolarHBondContact O-N 3.01Å; F45-T50 HydrophobicContact CB-CG2 3.97Å; F45-T50 WeakPolarHBondContact O-CG2 3.49Å
46	G	74.4	Confident	78.2	Confident	32 Å²	32	72 Å²	72	33%	0.33	41%	0.414	S	S	.	.			trans	-55.6	160.9	-172.8	0	0	0	0	0	114.1	A44 M48 Q49 T50	A44-G46 PolarHBondContact O-N 3.43Å; G46-M48 PolarHBondContact O-N 3.29Å; G46-Q49 PolarHBondContact O-N 3.47Å; G46-T50 PolarHBondContact O-N 2.83Å
47	P	77.6	Confident	78.7	Confident	50 Å²	50	77 Å²	77	33%	0.325	44%	0.438	S	S	.	.	H	α-helix	trans	-56.7	-31.6	-168.5	22.1	-34.3	0	0	0	114.2	F41 T50 A51	F41-P47 HydrophobicContact CD2-CB 4.18Å; F41-P47 HydrophobicContact CE2-CB 3.92Å; F41-P47 HydrophobicContact CZ-CB 4.26Å; F41-P47 HydrophobicContact CZ-CG 4.37Å; P47-T50 PolarHBondContact O-OG1 3.31Å; P47-T50 VanDerWaalsContact O-OG1 3.14Å; P47-A51 WeakPolarHBondContact O-CB 3.31Å; P47-A51 PolarHBondContact O-N 2.77Å
48	M	80.9	Confident	78.9	Confident	150 Å²	150	76.9 Å²	76.9	74%	0.739	44%	0.437	S	S	*	.	H	α-helix	trans	-68	-40	177.4	-71.6	-64.8	-74.8	0	0	112.6	G46 V52	G46-M48 PolarHBondContact O-N 3.29Å; M48-V52 VanDerWaalsContact O-CG2 3.28Å; M48-V52 WeakPolarHBondContact O-CG2 3.48Å; M48-V52 PolarHBondContact O-N 2.81Å; M48-V52 VanDerWaalsContact O-N 3.08Å
49	Q	82.6	Confident	79	Confident	109 Å²	109	72.8 Å²	72.8	51%	0.509	42%	0.418	S	S	.	.	H	α-helix	trans	-70.3	-46	-177.7	-68.9	179.5	-12.5	0	0	110.8	G46 A51 V52 I53	G46-Q49 PolarHBondContact O-N 3.47Å; Q49-A51 VanDerWaalsContact C-N 3.33Å; Q49-A51 PolarHBondContact O-N 2.77Å; Q49-V52 PolarHBondContact O-N 3.34Å; Q49-I53 VanDerWaalsContact O-CG1 3.29Å; Q49-I53 WeakPolarHBondContact O-CG1 3.32Å; Q49-I53 PolarHBondContact O-N 3.42Å
50	T	80.6	Confident	79.4	Confident	16 Å²	16	75.1 Å²	75.1	10%	0.098	43%	0.428	C	S	.	.	H	α-helix	trans	-68.6	-32.2	177.9	57.5	0	0	0	0	112.1	G36 G40 N43 F45 G46 P47 G54	G36-T50 VanDerWaalsContact CA-O 3.29Å; G36-T50 WeakPolarHBondContact CA-O 3.24Å; G36-T50 CarbonylContact O-C 3.51Å; G36-T50 WeakPolarHBondContact O-CB 3.47Å; G36-T50 PolarHBondContact O-OG1 3.14Å; G40-T50 WeakPolarHBondContact CA-OG1 3.38Å; G40-T50 PolarHBondContact N-OG1 2.8Å; N43-T50 HydrophobicContact CB-CG2 4.35Å; F45-T50 HydrophobicContact CB-CG2 3.97Å; F45-T50 WeakPolarHBondContact O-CG2 3.49Å; G46-T50 PolarHBondContact O-N 2.83Å; P47-T50 PolarHBondContact O-OG1 3.31Å; P47-T50 VanDerWaalsContact O-OG1 3.14Å; T50-G54 PolarHBondContact O-N 2.85Å
51	A	81.6	Confident	79.8	Confident	10 Å²	10	77 Å²	77	8%	0.083	44%	0.444	C	S	.	.	H	α-helix	trans	-61.9	-47.4	170.9	0	0	0	0	0	111.4	L33 P47 Q49 I53 G54 M55	L33-A51 HydrophobicContact CG-CB 4.5Å; P47-A51 WeakPolarHBondContact O-CB 3.31Å; P47-A51 PolarHBondContact O-N 2.77Å; Q49-A51 VanDerWaalsContact C-N 3.33Å; Q49-A51 PolarHBondContact O-N 2.77Å; A51-I53 PolarHBondContact O-N 3.39Å; A51-G54 PolarHBondContact O-N 2.91Å; A51-M55 WeakPolarHBondContact O-CG 3.44Å; A51-M55 PolarHBondContact O-N 2.98Å
52	V	84.7	Confident	80.1	Confident	72 Å²	72	68.8 Å²	68.8	44%	0.436	41%	0.407	S	S	.	.	H	α-helix	trans	-62.6	-43.7	177.7	172.3	0	0	0	0	111.2	M48 Q49 G54 M55 M56	M48-V52 VanDerWaalsContact O-CG2 3.28Å; M48-V52 WeakPolarHBondContact O-CG2 3.48Å; M48-V52 PolarHBondContact O-N 2.81Å; M48-V52 VanDerWaalsContact O-N 3.08Å; Q49-V52 PolarHBondContact O-N 3.34Å; V52-G54 VanDerWaalsContact C-N 3.34Å; V52-G54 PolarHBondContact O-N 2.95Å; V52-M55 WeakPolarHBondContact O-CB 3.32Å; V52-M55 PolarHBondContact O-N 3.48Å; V52-M56 HydrophobicContact CG1-CE 4.34Å; V52-M56 WeakPolarHBondContact O-CG 3.47Å; V52-M56 PolarHBondContact O-N 3.16Å
53	I	86.2	Confident	80.3	Confident	91 Å²	91	67.7 Å²	67.7	47%	0.467	39%	0.391	S	S	.	.	H	α-helix	trans	-62	-44.3	175.2	-67.2	164.8	0	0	0	110.3	Q49 A51 M55 M56 I57	Q49-I53 VanDerWaalsContact O-CG1 3.29Å; Q49-I53 WeakPolarHBondContact O-CG1 3.32Å; Q49-I53 PolarHBondContact O-N 3.42Å; A51-I53 PolarHBondContact O-N 3.39Å; I53-M55 VanDerWaalsContact C-N 3.34Å; I53-M55 PolarHBondContact O-N 3.34Å; I53-M56 PolarHBondContact O-N 3.42Å; I53-I57 HydrophobicContact CG2-CD1 3.67Å; I53-I57 HydrophobicContact CG2-CG1 4.29Å; I53-I57 WeakPolarHBondContact O-CG1 3.49Å; I53-I57 PolarHBondContact O-N 2.92Å
54	G	82.6	Confident	81	Confident	12 Å²	12	66.1 Å²	66.1	12%	0.124	39%	0.386	C	S	.	.	H	α-helix	trans	-59.7	-42.1	176.2	0	0	0	0	0	112.5	G32 T50 A51 V52 I57 G58	G32-G54 VanDerWaalsContact C-C 3.49Å; G32-G54 VanDerWaalsContact CA-O 3.28Å; G32-G54 WeakPolarHBondContact CA-O 3.43Å; G32-G54 CarbonylContact O-C 3.47Å; G32-G54 WeakPolarHBondContact O-CA 3.45Å; T50-G54 PolarHBondContact O-N 2.85Å; A51-G54 PolarHBondContact O-N 2.91Å; V52-G54 VanDerWaalsContact C-N 3.34Å; V52-G54 PolarHBondContact O-N 2.95Å; G54-I57 PolarHBondContact O-N 2.93Å; G54-G58 PolarHBondContact O-N 3.14Å
55	M	83.8	Confident	81.3	Confident	62 Å²	62	63.7 Å²	63.7	31%	0.305	36%	0.362	S	S	.	.	H	α-helix	trans	-61.3	-46.7	172.4	-70.5	178.2	85.1	0	0	111.8	S29 L33 A51 V52 I53 I57 G58 T59	S29-M55 WeakPolarHBondContact OG-CE 3.28Å; L33-M55 HydrophobicContact CB-CG 3.54Å; L33-M55 HydrophobicContact CB-SD 3.99Å; L33-M55 HydrophobicContact CD1-CE 4Å; L33-M55 HydrophobicContact CD1-CG 4.34Å; L33-M55 HydrophobicContact CD1-SD 3.62Å; L33-M55 HydrophobicContact CG-CG 4.14Å; L33-M55 HydrophobicContact CG-SD 3.95Å; A51-M55 WeakPolarHBondContact O-CG 3.44Å; A51-M55 PolarHBondContact O-N 2.98Å; V52-M55 WeakPolarHBondContact O-CB 3.32Å; V52-M55 PolarHBondContact O-N 3.48Å; I53-M55 VanDerWaalsContact C-N 3.34Å; I53-M55 PolarHBondContact O-N 3.34Å; M55-I57 PolarHBondContact O-N 3.19Å; M55-G58 PolarHBondContact O-N 3.34Å; M55-T59 WeakPolarHBondContact O-CB 3.32Å; M55-T59 VanDerWaalsContact O-CG2 3.29Å; M55-T59 WeakPolarHBondContact O-CG2 3.12Å; M55-T59 PolarHBondContact O-N 2.75Å; M55-T59 PolarHBondContact O-OG1 3.09Å
56	M	85.6	Confident	82	Confident	123 Å²	123	58 Å²	58	61%	0.606	34%	0.338	S	S	*	.	H	α-helix	trans	-60.3	-47.1	177.6	-75	-168.4	177.8	0	0	111.3	V52 I53 G58 T59 V60	V52-M56 HydrophobicContact CG1-CE 4.34Å; V52-M56 WeakPolarHBondContact O-CG 3.47Å; V52-M56 PolarHBondContact O-N 3.16Å; I53-M56 PolarHBondContact O-N 3.42Å; M56-G58 PolarHBondContact O-N 3.46Å; M56-T59 WeakPolarHBondContact CA-OG1 3.33Å; M56-T59 PolarHBondContact O-N 3.25Å; M56-T59 PolarHBondContact O-OG1 3.08Å; M56-V60 WeakPolarHBondContact O-CB 3.28Å; M56-V60 WeakPolarHBondContact O-CG2 3.49Å; M56-V60 PolarHBondContact O-N 3.03Å
57	I	86.4	Confident	82.1	Confident	112 Å²	112	62.2 Å²	62.2	57%	0.574	35%	0.349	S	S	*	.	H	α-helix	trans	-63.6	-43.9	178.1	-66.2	170.1	0	0	0	110.5	I53 G54 M55 T59 V60 A61	I53-I57 HydrophobicContact CG2-CD1 3.67Å; I53-I57 HydrophobicContact CG2-CG1 4.29Å; I53-I57 WeakPolarHBondContact O-CG1 3.49Å; I53-I57 PolarHBondContact O-N 2.92Å; G54-I57 PolarHBondContact O-N 2.93Å; M55-I57 PolarHBondContact O-N 3.19Å; I57-T59 PolarHBondContact O-N 2.87Å; I57-V60 PolarHBondContact O-N 3.28Å; I57-A61 VanDerWaalsContact O-CB 3.27Å; I57-A61 WeakPolarHBondContact O-CB 3.33Å; I57-A61 PolarHBondContact O-N 3.18Å
58	G	80.5	Confident	82.2	Confident	9 Å²	9	65.1 Å²	65.1	9%	0.093	36%	0.361	C	S	.	.	H	α-helix	trans	-61.2	-43.8	178.1	0	0	0	0	0	112.7	F28 G54 M55 M56 A62	F28-G58 WeakPolarHBondContact CB-O 3.46Å; G54-G58 PolarHBondContact O-N 3.14Å; M55-G58 PolarHBondContact O-N 3.34Å; M56-G58 PolarHBondContact O-N 3.46Å; G58-A62 WeakPolarHBondContact O-CB 3.47Å; G58-A62 PolarHBondContact O-N 3.3Å
59	T	83.1	Confident	81.8	Confident	42 Å²	42	63.4 Å²	63.4	26%	0.258	35%	0.349	S	S	.	.	H	α-helix	trans	-65.2	-45.7	177	53.3	0	0	0	0	111.8	V25 M55 M56 I57 A62 V63	V25-T59 HydrophobicContact CG1-CG2 3.92Å; M55-T59 WeakPolarHBondContact O-CB 3.32Å; M55-T59 VanDerWaalsContact O-CG2 3.29Å; M55-T59 WeakPolarHBondContact O-CG2 3.12Å; M55-T59 PolarHBondContact O-N 2.75Å; M55-T59 PolarHBondContact O-OG1 3.09Å; M56-T59 WeakPolarHBondContact CA-OG1 3.33Å; M56-T59 PolarHBondContact O-N 3.25Å; M56-T59 PolarHBondContact O-OG1 3.08Å; I57-T59 PolarHBondContact O-N 2.87Å; T59-A62 PolarHBondContact O-N 3.5Å; T59-V63 VanDerWaalsContact O-CG2 3.32Å; T59-V63 WeakPolarHBondContact O-CG2 3.24Å; T59-V63 PolarHBondContact O-N 2.93Å
60	V	85.3	Confident	81	Confident	89 Å²	89	60.9 Å²	60.9	54%	0.539	34%	0.344	S	S	.	.	H	α-helix	trans	-60.7	-49	176.8	173.6	0	0	0	0	110.7	M56 I57 A62 V63 C64	M56-V60 WeakPolarHBondContact O-CB 3.28Å; M56-V60 WeakPolarHBondContact O-CG2 3.49Å; M56-V60 PolarHBondContact O-N 3.03Å; I57-V60 PolarHBondContact O-N 3.28Å; V60-A62 VanDerWaalsContact C-N 3.3Å; V60-A62 PolarHBondContact O-N 2.82Å; V60-V63 PolarHBondContact O-N 2.63Å; V60-V63 VanDerWaalsContact O-N 3.16Å; V60-C64 PolarHBondContact O-N 2.98Å; V60-C64 PolarHBondContact O-SG 2.92Å; V60-C64 VanDerWaalsContact O-SG 3.33Å
61	A	83.3	Confident	80.5	Confident	43 Å²	43	63.8 Å²	63.8	36%	0.355	36%	0.364	S	S	.	.	H	α-helix	trans	-57.9	-43	178	0	0	0	0	0	111.7	I57 C64 C65	I57-A61 VanDerWaalsContact O-CB 3.27Å; I57-A61 WeakPolarHBondContact O-CB 3.33Å; I57-A61 PolarHBondContact O-N 3.18Å; A61-C64 PolarHBondContact O-N 3.16Å; A61-C65 WeakPolarHBondContact O-CB 2.99Å; A61-C65 PolarHBondContact O-N 3.45Å; A61-C65 PolarHBondContact O-SG 2.94Å
62	A	80.3	Confident	79.6	Confident	0 Å²	0	67.1 Å²	67.1	0%	0	38%	0.384	C	S	.	.	H	α-helix	trans	-67.4	-37.3	177.9	0	0	0	0	0	113.4	V25 F28 G58 T59 V60 C65 N66	V25-A62 HydrophobicContact CB-CB 4.13Å; V25-A62 HydrophobicContact CG2-CB 3.73Å; F28-A62 HydrophobicContact CB-CB 3.74Å; F28-A62 HydrophobicContact CD2-CB 3.58Å; F28-A62 HydrophobicContact CE2-CB 4.45Å; F28-A62 HydrophobicContact CG-CB 3.88Å; G58-A62 WeakPolarHBondContact O-CB 3.47Å; G58-A62 PolarHBondContact O-N 3.3Å; T59-A62 PolarHBondContact O-N 3.5Å; V60-A62 VanDerWaalsContact C-N 3.3Å; V60-A62 PolarHBondContact O-N 2.82Å; A62-C65 PolarHBondContact O-N 3.01Å; A62-N66 WeakPolarHBondContact O-CB 3.11Å; A62-N66 PolarHBondContact O-N 3.14Å; A62-N66 PolarHBondContact O-ND2 3.33Å
63	V	81.8	Confident	78.4	Confident	66 Å²	66	67.4 Å²	67.4	40%	0.4	39%	0.389	S	S	.	.	H	α-helix	trans	-62.9	-46.3	172.9	171.6	0	0	0	0	110.1	V25 T59 V60 C65 N66 Q67	V25-V63 HydrophobicContact CG2-CG2 3.94Å; T59-V63 VanDerWaalsContact O-CG2 3.32Å; T59-V63 WeakPolarHBondContact O-CG2 3.24Å; T59-V63 PolarHBondContact O-N 2.93Å; V60-V63 PolarHBondContact O-N 2.63Å; V60-V63 VanDerWaalsContact O-N 3.16Å; V63-C65 PolarHBondContact O-N 3.22Å; V63-N66 WeakPolarHBondContact O-CB 3.29Å; V63-N66 PolarHBondContact O-N 3.32Å; V63-N66 VanDerWaalsContact O-N 3.14Å; V63-Q67 WeakPolarHBondContact O-CG 3.27Å; V63-Q67 PolarHBondContact O-N 3.46Å
64	C	82.2	Confident	77.2	Confident	57 Å²	57	68.9 Å²	68.9	39%	0.385	40%	0.402	S	S	.	.	H	α-helix	trans	-59.2	-45.8	174.9	-66.1	0	0	0	0	111.7	V60 A61 N66 Q67 I68	V60-C64 PolarHBondContact O-N 2.98Å; V60-C64 PolarHBondContact O-SG 2.92Å; V60-C64 VanDerWaalsContact O-SG 3.33Å; A61-C64 PolarHBondContact O-N 3.16Å; C64-N66 VanDerWaalsContact C-N 3.28Å; C64-N66 PolarHBondContact O-N 3.23Å; C64-Q67 PolarHBondContact O-N 3.49Å; C64-I68 VanDerWaalsContact O-CG1 3.32Å; C64-I68 WeakPolarHBondContact O-CG1 3.2Å; C64-I68 PolarHBondContact O-N 3.46Å
65	C	79.6	Confident	75.8	Confident	58 Å²	58	76.7 Å²	76.7	39%	0.392	44%	0.436	S	S	.	.	H	α-helix	trans	-62.3	-33.9	176	-70.5	0	0	0	0	112.9	A61 A62 V63 K69	A61-C65 WeakPolarHBondContact O-CB 2.99Å; A61-C65 PolarHBondContact O-N 3.45Å; A61-C65 PolarHBondContact O-SG 2.94Å; A62-C65 PolarHBondContact O-N 3.01Å; V63-C65 PolarHBondContact O-N 3.22Å; C65-K69 WeakPolarHBondContact O-CB 3.29Å; C65-K69 PolarHBondContact O-N 3.43Å
66	N	78.2	Confident	74.1	Confident	15 Å²	15	85.3 Å²	85.3	8%	0.08	47%	0.472	C	S	.	.	H	α-helix	trans	-69.3	-41.5	174.8	-72.4	-22.1	0	0	0	111.5	N21 R24 A62 V63 C64 K69 S70	N21-N66 WeakPolarHBondContact CA-ND2 3.33Å; N21-N66 HydrophobicContact CB-CB 4.42Å; N21-N66 WeakPolarHBondContact CB-ND2 3.49Å; N21-N66 PolarHBondContact O-ND2 3.03Å; R24-N66 VanDerWaalsContact CD-OD1 3.32Å; R24-N66 WeakPolarHBondContact CD-OD1 3.2Å; R24-N66 PolarHBondContact NH1-OD1 2.84Å; A62-N66 WeakPolarHBondContact O-CB 3.11Å; A62-N66 PolarHBondContact O-N 3.14Å; A62-N66 PolarHBondContact O-ND2 3.33Å; V63-N66 WeakPolarHBondContact O-CB 3.29Å; V63-N66 PolarHBondContact O-N 3.32Å; V63-N66 VanDerWaalsContact O-N 3.14Å; C64-N66 VanDerWaalsContact C-N 3.28Å; C64-N66 PolarHBondContact O-N 3.23Å; N66-K69 PolarHBondContact O-N 2.81Å; N66-S70 PolarHBondContact O-N 3.49Å; N66-S70 PolarHBondContact O-OG 2.84Å
67	Q	78.2	Confident	73.5	Confident	120 Å²	120	83.5 Å²	83.5	56%	0.561	47%	0.465	S	S	*	.	H	α-helix	trans	-64.3	-43.8	176.6	-73.9	-176.9	-18.8	0	0	112.3	V63 C64 K69 S70 S71	V63-Q67 WeakPolarHBondContact O-CG 3.27Å; V63-Q67 PolarHBondContact O-N 3.46Å; C64-Q67 PolarHBondContact O-N 3.49Å; Q67-K69 VanDerWaalsContact C-N 3.29Å; Q67-K69 PolarHBondContact O-N 2.86Å; Q67-S70 WeakPolarHBondContact CA-OG 3.47Å; Q67-S70 PolarHBondContact O-N 3.39Å; Q67-S70 PolarHBondContact O-OG 3.18Å; Q67-S71 PolarHBondContact O-N 3.1Å; Q67-S71 PolarHBondContact O-OG 2.81Å; Q67-S71 VanDerWaalsContact O-OG 3.09Å
68	I	77.8	Confident	72.9	Confident	111 Å²	111	81.9 Å²	81.9	57%	0.569	46%	0.459	S	S	*	.	H	α-helix	trans	-58.7	-45.8	175.4	-65.8	163.4	0	0	0	109.8	C64 S70 S71 T72	C64-I68 VanDerWaalsContact O-CG1 3.32Å; C64-I68 WeakPolarHBondContact O-CG1 3.2Å; C64-I68 PolarHBondContact O-N 3.46Å; I68-S70 VanDerWaalsContact C-N 3.35Å; I68-S70 PolarHBondContact O-N 2.98Å; I68-S71 PolarHBondContact O-N 3.22Å; I68-T72 PolarHBondContact O-N 3.16Å; I68-T72 PolarHBondContact O-OG1 2.85Å
69	K	72.8	Confident	72.4	Confident	115 Å²	115	86 Å²	86	50%	0.5	48%	0.479	S	S	.	.	H	α-helix	trans	-62.6	-39.9	178.4	-173.1	174.8	178.5	-177.4	0	112.4	C65 N66 Q67 T72 S73	C65-K69 WeakPolarHBondContact O-CB 3.29Å; C65-K69 PolarHBondContact O-N 3.43Å; N66-K69 PolarHBondContact O-N 2.81Å; Q67-K69 VanDerWaalsContact C-N 3.29Å; Q67-K69 PolarHBondContact O-N 2.86Å; K69-T72 PolarHBondContact O-N 2.87Å; K69-S73 PolarHBondContact O-N 2.95Å; K69-S73 VanDerWaalsContact O-N 3.08Å; K69-S73 PolarHBondContact O-OG 3.49Å
70	S	67.6	Low	71.8	Confident	56 Å²	56	88.6 Å²	88.6	39%	0.392	49%	0.493	S	S	.	.	H	α-helix	trans	-65.6	-40	175.3	52	0	0	0	0	112.1	N66 Q67 I68 T72 S73 T74	N66-S70 PolarHBondContact O-N 3.49Å; N66-S70 PolarHBondContact O-OG 2.84Å; Q67-S70 WeakPolarHBondContact CA-OG 3.47Å; Q67-S70 PolarHBondContact O-N 3.39Å; Q67-S70 PolarHBondContact O-OG 3.18Å; I68-S70 VanDerWaalsContact C-N 3.35Å; I68-S70 PolarHBondContact O-N 2.98Å; S70-T72 VanDerWaalsContact C-N 3.33Å; S70-T72 PolarHBondContact O-N 2.93Å; S70-S73 WeakPolarHBondContact CA-OG 3.38Å; S70-S73 PolarHBondContact O-N 3.48Å; S70-S73 PolarHBondContact O-OG 3.47Å; S70-T74 PolarHBondContact O-N 3.33Å; S70-T74 PolarHBondContact O-OG1 3.37Å; S70-T74 VanDerWaalsContact O-OG1 3.08Å
71	S	68.3	Low	71	Confident	76 Å²	76	88.6 Å²	88.6	53%	0.531	49%	0.49	S	S	.	.	H	α-helix	trans	-65.4	-36.6	177.4	-59.3	0	0	0	0	112.1	Q67 I68	Q67-S71 PolarHBondContact O-N 3.1Å; Q67-S71 PolarHBondContact O-OG 2.81Å; Q67-S71 VanDerWaalsContact O-OG 3.09Å; I68-S71 PolarHBondContact O-N 3.22Å
72	T	63.9	Low	70.1	Confident	81 Å²	81	91.6 Å²	91.6	50%	0.497	50%	0.499	S	S	.	.	H	α-helix	trans	-70.4	-33.7	175	-49.5	0	0	0	0	112.6	I68 K69 S70 T74 Q75	I68-T72 PolarHBondContact O-N 3.16Å; I68-T72 PolarHBondContact O-OG1 2.85Å; K69-T72 PolarHBondContact O-N 2.87Å; S70-T72 VanDerWaalsContact C-N 3.33Å; S70-T72 PolarHBondContact O-N 2.93Å; T72-T74 VanDerWaalsContact C-N 3.33Å; T72-Q75 PolarHBondContact O-N 3.25Å
73	S	59.6	Low	69.4	Low	78 Å²	78	98.1 Å²	98.1	55%	0.545	53%	0.534	S	S	.	.	H	α-helix	trans	-71.6	-25.5	177	53	0	0	0	0	113.9	K69 S70 Q75	K69-S73 PolarHBondContact O-N 2.95Å; K69-S73 VanDerWaalsContact O-N 3.08Å; K69-S73 PolarHBondContact O-OG 3.49Å; S70-S73 WeakPolarHBondContact CA-OG 3.38Å; S70-S73 PolarHBondContact O-N 3.48Å; S70-S73 PolarHBondContact O-OG 3.47Å; S73-Q75 PolarHBondContact O-N 3.44Å
74	T	59.4	Low	68.5	Low	121 Å²	121	100.6 Å²	100.6	74%	0.742	54%	0.544	S	S	*	.	T	Hydrogen-bonded Turn	trans	-77	-11.3	175.5	-48.5	0	0	0	0	112.5	S70 T72	S70-T74 PolarHBondContact O-N 3.33Å; S70-T74 PolarHBondContact O-OG1 3.37Å; S70-T74 VanDerWaalsContact O-OG1 3.08Å; T72-T74 VanDerWaalsContact C-N 3.33Å
75	Q	54.8	Low	67.3	Low	176 Å²	176	104.3 Å²	104.3	82%	0.822	56%	0.558	S	S	*	*	T	Hydrogen-bonded Turn	trans	-101.3	1.9	-179.2	-81.1	-102.4	-25	0	0	113.9	T72 S73	T72-Q75 PolarHBondContact O-N 3.25Å; S73-Q75 PolarHBondContact O-N 3.44Å
76	K	47.8	Very low	66.2	Low	244 Å²	244	108.5 Å²	108.5	100%	1.061	57%	0.573	S	S	*	*			trans	-109.7	0	172.4	-81	-169.2	174.1	-168.6	0	110.4

Retrieved 76 of 76 residues in 125.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).