A0A5K4FEI9_SCHMA Loading...

Glutathione peroxidase

AlphaFold DB , UniProt , Accession A0A5K4FEI9, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 61 aa.

						>A0A5K4FEI9_SCHMA|A0A5K4FEI9
MFDRFTSLLSLIIFLANSEACMRSPASGKIYDFTVTDIDGNEVQLKKYLNKVCIIVNVATE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.4	Low	81.8	Confident	194 Å²	194	127.5 Å²	127.5	96%	0.956	64%	0.642	S	S	*	*				0	-36	0	-163.6	170	-174.6	0	0	112	D3	M1-D3 PolarHBondContact O-N 3.45Å
2	F	67.9	Low	82.4	Confident	174 Å²	174	125.1 Å²	125.1	76%	0.763	63%	0.631	S	S	*	*	H	α-helix	trans	-64.5	-31	179.9	-86.1	-89.3	0	0	0	115.6	R4 F5 T6	F2-R4 VanDerWaalsContact C-N 3.29Å; F2-R4 PolarHBondContact O-N 3.14Å; F2-F5 PolarHBondContact O-N 3.14Å; F2-F5 VanDerWaalsContact O-N 3.08Å; F2-T6 PolarHBondContact O-N 3.35Å; F2-T6 PolarHBondContact O-OG1 3.07Å
3	D	78.9	Confident	82.8	Confident	129 Å²	129	122.5 Å²	122.5	69%	0.69	62%	0.618	S	S	*	*	H	α-helix	trans	-62.3	-32.5	-175.9	-55.6	-57.2	0	0	0	114.2	M1 T6 S7	M1-D3 PolarHBondContact O-N 3.45Å; D3-T6 PolarHBondContact O-OG1 3.08Å; D3-S7 VanDerWaalsContact O-CB 3.23Å; D3-S7 WeakPolarHBondContact O-CB 3.23Å; D3-S7 PolarHBondContact O-N 3.24Å; D3-S7 VanDerWaalsContact O-N 3.14Å
4	R	84.8	Confident	83	Confident	208 Å²	208	124.7 Å²	124.7	79%	0.785	62%	0.622	S	S	*	*	H	α-helix	trans	-71.7	-33.9	178	-64.2	-76.8	-177.2	176.4	-1.9	111.3	F2 L8	F2-R4 VanDerWaalsContact C-N 3.29Å; F2-R4 PolarHBondContact O-N 3.14Å; R4-L8 PolarHBondContact O-N 3.08Å; R4-L8 VanDerWaalsContact O-N 3.08Å
5	F	83.7	Confident	83.1	Confident	145 Å²	145	123.3 Å²	123.3	64%	0.636	62%	0.617	S	S	*	*	H	α-helix	trans	-76	-42.6	179.8	-96.1	-82.6	0	0	0	112.3	F2 S7 L8 L9	F2-F5 PolarHBondContact O-N 3.14Å; F2-F5 VanDerWaalsContact O-N 3.08Å; F5-S7 VanDerWaalsContact C-N 3.32Å; F5-L8 PolarHBondContact O-N 2.92Å; F5-L9 WeakPolarHBondContact O-CB 3.43Å; F5-L9 PolarHBondContact O-N 3.3Å
6	T	84.8	Confident	83	Confident	81 Å²	81	119.8 Å²	119.8	50%	0.497	61%	0.613	S	S	.	*	H	α-helix	trans	-64.9	-38.7	175.4	53.9	0	0	0	0	111.3	F2 D3 L9 S10	F2-T6 PolarHBondContact O-N 3.35Å; F2-T6 PolarHBondContact O-OG1 3.07Å; D3-T6 PolarHBondContact O-OG1 3.08Å; T6-L9 PolarHBondContact O-N 3.04Å; T6-S10 WeakPolarHBondContact O-CB 3.37Å; T6-S10 PolarHBondContact O-N 3.48Å
7	S	85.5	Confident	82.5	Confident	77 Å²	77	119.4 Å²	119.4	54%	0.538	61%	0.613	S	S	.	*	H	α-helix	trans	-62.2	-44.2	172.7	178.6	0	0	0	0	112.3	D3 F5 S10 L11	D3-S7 VanDerWaalsContact O-CB 3.23Å; D3-S7 WeakPolarHBondContact O-CB 3.23Å; D3-S7 PolarHBondContact O-N 3.24Å; D3-S7 VanDerWaalsContact O-N 3.14Å; F5-S7 VanDerWaalsContact C-N 3.32Å; S7-S10 PolarHBondContact O-N 3.27Å; S7-L11 PolarHBondContact O-N 3.42Å
8	L	89.2	Confident	81.7	Confident	107 Å²	107	117 Å²	117	56%	0.56	61%	0.608	S	S	*	*	H	α-helix	trans	-63.2	-43.8	175.9	-122.4	103.1	0	0	0	112.1	R4 F5 L11 I12	R4-L8 PolarHBondContact O-N 3.08Å; R4-L8 VanDerWaalsContact O-N 3.08Å; F5-L8 PolarHBondContact O-N 2.92Å; L8-L11 PolarHBondContact O-N 2.99Å; L8-I12 WeakPolarHBondContact O-CG1 3.32Å; L8-I12 PolarHBondContact O-N 3.01Å
9	L	89.5	Confident	80.5	Confident	107 Å²	107	120.3 Å²	120.3	56%	0.56	62%	0.62	S	S	*	*	H	α-helix	trans	-64.6	-41.1	179.3	-174	62.9	0	0	0	111.4	F5 T6 L11 I12 I13	F5-L9 WeakPolarHBondContact O-CB 3.43Å; F5-L9 PolarHBondContact O-N 3.3Å; T6-L9 PolarHBondContact O-N 3.04Å; L9-L11 VanDerWaalsContact C-N 3.34Å; L9-L11 PolarHBondContact O-N 3.33Å; L9-I12 PolarHBondContact O-N 3.44Å; L9-I13 HydrophobicContact CG-CD1 4.25Å; L9-I13 WeakPolarHBondContact O-CG1 3.48Å; L9-I13 PolarHBondContact O-N 3.49Å
10	S	87.2	Confident	79.2	Confident	78 Å²	78	119 Å²	119	55%	0.545	63%	0.629	S	S	.	*	H	α-helix	trans	-61.5	-40.6	174.1	177.5	0	0	0	0	112.2	T6 S7 I13 F14	T6-S10 WeakPolarHBondContact O-CB 3.37Å; T6-S10 PolarHBondContact O-N 3.48Å; S7-S10 PolarHBondContact O-N 3.27Å; S10-I13 PolarHBondContact O-N 3.43Å; S10-F14 PolarHBondContact O-N 2.92Å
11	L	87.5	Confident	77.5	Confident	102 Å²	102	118.9 Å²	118.9	53%	0.534	64%	0.636	S	S	.	*	H	α-helix	trans	-65	-42.6	176	-176.1	65.1	0	0	0	112	S7 L8 L9 I13 F14 L15	S7-L11 PolarHBondContact O-N 3.42Å; L8-L11 PolarHBondContact O-N 2.99Å; L9-L11 VanDerWaalsContact C-N 3.34Å; L9-L11 PolarHBondContact O-N 3.33Å; L11-I13 PolarHBondContact O-N 2.98Å; L11-F14 PolarHBondContact O-N 3.04Å; L11-L15 HydrophobicContact CG-CD1 4.37Å; L11-L15 WeakPolarHBondContact O-CG 3.36Å; L11-L15 PolarHBondContact O-N 3.26Å
12	I	89.4	Confident	76.9	Confident	99 Å²	99	118.4 Å²	118.4	51%	0.508	63%	0.634	S	S	.	*	H	α-helix	trans	-62	-43.4	177.1	-69.7	161.2	0	0	0	110.9	L8 L9 F14 L15 A16	L8-I12 WeakPolarHBondContact O-CG1 3.32Å; L8-I12 PolarHBondContact O-N 3.01Å; L9-I12 PolarHBondContact O-N 3.44Å; I12-F14 VanDerWaalsContact C-N 3.35Å; I12-F14 PolarHBondContact O-N 3.02Å; I12-L15 PolarHBondContact O-N 3.49Å; I12-A16 WeakPolarHBondContact O-CB 3.37Å; I12-A16 PolarHBondContact O-N 3.38Å
13	I	87.8	Confident	76.4	Confident	91 Å²	91	120.1 Å²	120.1	47%	0.467	64%	0.635	S	S	.	*	H	α-helix	trans	-62.5	-42.5	176.2	-67.5	166.6	0	0	0	110.7	L9 S10 L11 L15 A16 N17	L9-I13 HydrophobicContact CG-CD1 4.25Å; L9-I13 WeakPolarHBondContact O-CG1 3.48Å; L9-I13 PolarHBondContact O-N 3.49Å; S10-I13 PolarHBondContact O-N 3.43Å; L11-I13 PolarHBondContact O-N 2.98Å; I13-L15 VanDerWaalsContact C-N 3.34Å; I13-L15 PolarHBondContact O-N 3.31Å; I13-A16 PolarHBondContact O-N 3.45Å; I13-N17 WeakPolarHBondContact CG2-ND2 3.48Å; I13-N17 PolarHBondContact O-N 3.45Å; I13-N17 VanDerWaalsContact O-N 3.12Å; I13-N17 PolarHBondContact O-ND2 3.37Å
14	F	85.5	Confident	75.3	Confident	154 Å²	154	118.2 Å²	118.2	68%	0.675	63%	0.632	S	S	*	*	H	α-helix	trans	-61.7	-41.9	178.7	-168.3	-96	0	0	0	112.2	S10 L11 I12 N17 S18	S10-F14 PolarHBondContact O-N 2.92Å; L11-F14 PolarHBondContact O-N 3.04Å; I12-F14 VanDerWaalsContact C-N 3.35Å; I12-F14 PolarHBondContact O-N 3.02Å; F14-N17 PolarHBondContact O-N 2.77Å; F14-S18 PolarHBondContact O-N 3.12Å
15	L	84.1	Confident	73.9	Confident	103 Å²	103	113.4 Å²	113.4	54%	0.539	63%	0.628	S	S	.	*	H	α-helix	trans	-67.1	-40.5	176.1	-66	171.7	0	0	0	112.2	L11 I12 I13 N17 S18	L11-L15 HydrophobicContact CG-CD1 4.37Å; L11-L15 WeakPolarHBondContact O-CG 3.36Å; L11-L15 PolarHBondContact O-N 3.26Å; I12-L15 PolarHBondContact O-N 3.49Å; I13-L15 VanDerWaalsContact C-N 3.34Å; I13-L15 PolarHBondContact O-N 3.31Å; L15-N17 VanDerWaalsContact C-N 3.27Å; L15-N17 PolarHBondContact O-N 3.14Å; L15-S18 PolarHBondContact O-N 3.22Å; L15-S18 VanDerWaalsContact O-N 3.14Å; L15-S18 PolarHBondContact O-OG 3.35Å
16	A	81.4	Confident	72.6	Confident	68 Å²	68	108.9 Å²	108.9	56%	0.562	62%	0.617	S	S	*	*	H	α-helix	trans	-64.7	-30.5	178.1	0	0	0	0	0	113.1	I12 I13 S18	I12-A16 WeakPolarHBondContact O-CB 3.37Å; I12-A16 PolarHBondContact O-N 3.38Å; I13-A16 PolarHBondContact O-N 3.45Å; A16-S18 VanDerWaalsContact C-N 3.35Å
17	N	75	Confident	71.4	Confident	113 Å²	113	108.1 Å²	108.1	60%	0.604	62%	0.615	S	S	*	*	G	3₁₀ helix	trans	-83.4	-9	176.7	-73	-80.5	0	0	0	113.3	I13 F14 L15 E19	I13-N17 WeakPolarHBondContact CG2-ND2 3.48Å; I13-N17 PolarHBondContact O-N 3.45Å; I13-N17 VanDerWaalsContact O-N 3.12Å; I13-N17 PolarHBondContact O-ND2 3.37Å; F14-N17 PolarHBondContact O-N 2.77Å; L15-N17 VanDerWaalsContact C-N 3.27Å; L15-N17 PolarHBondContact O-N 3.14Å; N17-E19 PolarHBondContact O-N 3.26Å
18	S	68.3	Low	70.8	Confident	76 Å²	76	108.4 Å²	108.4	53%	0.531	63%	0.63	S	S	.	*	G	3₁₀ helix	trans	-76.2	-5.5	-176.2	91.4	0	0	0	0	113.7	F14 L15 A16 A20	F14-S18 PolarHBondContact O-N 3.12Å; L15-S18 PolarHBondContact O-N 3.22Å; L15-S18 VanDerWaalsContact O-N 3.14Å; L15-S18 PolarHBondContact O-OG 3.35Å; A16-S18 VanDerWaalsContact C-N 3.35Å; S18-A20 PolarHBondContact O-N 3.18Å
19	E	58.4	Low	70.8	Confident	179 Å²	179	109.2 Å²	109.2	84%	0.836	63%	0.629	S	S	*	*	G	3₁₀ helix	trans	-71.6	-4.8	179.6	-59.9	-164	171	0	0	113.5	N17	N17-E19 PolarHBondContact O-N 3.26Å
20	A	54	Low	70.9	Confident	95 Å²	95	106.8 Å²	106.8	79%	0.785	62%	0.616	S	S	*	*	G	3₁₀ helix	trans	-87.4	-1.9	-175	0	0	0	0	0	116.1	S18	S18-A20 PolarHBondContact O-N 3.18Å
21	C	44.8	Very low	71.1	Confident	117 Å²	117	106 Å²	106	79%	0.791	60%	0.602	S	S	*	*	S	Bend	trans	-145.5	48.9	-176.1	-155.1	0	0	0	0	114.9
22	M	48.1	Very low	71.2	Confident	184 Å²	184	104 Å²	104	91%	0.906	59%	0.592	S	S	*	*			trans	-137	64	159.8	-73	-153.4	-62.4	0	0	111.1	S24	M22-S24 VanDerWaalsContact C-N 3.26Å; M22-S24 PolarHBondContact O-N 3.17Å
23	R	57.3	Low	71.3	Confident	209 Å²	209	104.7 Å²	104.7	79%	0.789	59%	0.591	S	S	*	*			trans	-80.1	87.7	153.9	-159	168.1	-168.5	148.3	-1.7	106.1
24	S	54.1	Low	71.6	Confident	89 Å²	89	103.1 Å²	103.1	62%	0.622	59%	0.586	S	S	*	*			trans	-44.6	136.3	162.5	-178.8	0	0	0	0	106.7	M22 A26	M22-S24 VanDerWaalsContact C-N 3.26Å; M22-S24 PolarHBondContact O-N 3.17Å; S24-A26 PolarHBondContact O-N 2.67Å
25	P	56.1	Low	72	Confident	107 Å²	107	98.9 Å²	98.9	70%	0.695	57%	0.572	S	S	*	*			trans	-62	95.2	162.3	26.4	-28.1	0	0	0	104.6	S27	P25-S27 PolarHBondContact O-N 3.49Å
26	A	57.1	Low	72.6	Confident	50 Å²	50	98.7 Å²	98.7	41%	0.413	58%	0.576	S	S	.	*	S	Bend	trans	-44.9	120.6	158.4	0	0	0	0	0	103.9	S24 G28 D32	S24-A26 PolarHBondContact O-N 2.67Å; A26-G28 PolarHBondContact O-N 3.06Å; A26-D32 HydrophobicContact CB-CB 3.92Å; A26-D32 WeakPolarHBondContact O-CB 3.48Å
27	S	59.1	Low	73.3	Confident	66 Å²	66	98 Å²	98	46%	0.462	56%	0.562	S	S	.	*	S	Bend	trans	9.2	110.8	-178.5	55.7	0	0	0	0	114.5	P25 K29 D32	P25-S27 PolarHBondContact O-N 3.49Å; S27-K29 WeakPolarHBondContact O-CA 3.42Å; S27-K29 VanDerWaalsContact O-CB 3.29Å; S27-K29 WeakPolarHBondContact O-CB 3.29Å; S27-K29 WeakPolarHBondContact O-CG 3.42Å; S27-K29 PolarHBondContact O-N 2.5Å; S27-D32 PolarHBondContact OG-OD2 2.96Å
28	G	73.4	Confident	74.3	Confident	82 Å²	82	100.6 Å²	100.6	85%	0.845	58%	0.575	S	S	*	*	S	Bend	trans	-49.6	55.9	-174.3	0	0	0	0	0	118.4	A26	A26-G28 PolarHBondContact O-N 3.06Å
29	K	88.3	Confident	75.7	Confident	124 Å²	124	103.2 Å²	103.2	54%	0.539	58%	0.583	S	S	.	*	S	Bend	trans	-114.1	143.8	-175.9	-64.8	-178.5	-176.6	177.5	0	104.6	S27 Y31 D32 F33	S27-K29 WeakPolarHBondContact O-CA 3.42Å; S27-K29 VanDerWaalsContact O-CB 3.29Å; S27-K29 WeakPolarHBondContact O-CB 3.29Å; S27-K29 WeakPolarHBondContact O-CG 3.42Å; S27-K29 PolarHBondContact O-N 2.5Å; K29-Y31 HydrophobicContact CB-CD2 4.15Å; K29-Y31 HydrophobicContact CD-CD2 4.46Å; K29-Y31 PolarHBondContact O-N 3.43Å; K29-D32 PolarHBondContact O-N 3.33Å; K29-F33 VanDerWaalsContact O-CE2 3.31Å; K29-F33 WeakPolarHBondContact O-CE2 3.44Å
30	I	91.1	Very high	77.5	Confident	56 Å²	56	97.2 Å²	97.2	29%	0.287	57%	0.569	S	S	.	*	G	3₁₀ helix	trans	-59.6	-17.8	-179.4	63.4	169.7	0	0	0	113.3	D32 F33 L45 C53 I55	I30-D32 VanDerWaalsContact C-N 3.32Å; I30-D32 PolarHBondContact O-N 2.93Å; I30-F33 WeakPolarHBondContact O-CD2 3.31Å; I30-L45 WeakPolarHBondContact O-CB 3.49Å; I30-L45 WeakPolarHBondContact O-CD1 3.38Å; I30-C53 HydrophobicContact CD1-CB 4.17Å; I30-I55 HydrophobicContact CG2-CD1 4.27Å
31	Y	91.6	Very high	79.6	Confident	62 Å²	62	97 Å²	97	24%	0.243	56%	0.555	C	S	.	*	G	3₁₀ helix	trans	-77.4	-15.5	-173.9	-49.7	-53.9	0	0	0	114.5	K29 F33 L49	K29-Y31 HydrophobicContact CB-CD2 4.15Å; K29-Y31 HydrophobicContact CD-CD2 4.46Å; K29-Y31 PolarHBondContact O-N 3.43Å; Y31-F33 VanDerWaalsContact C-N 3.3Å; Y31-L49 HydrophobicContact CD1-CD1 4.26Å; Y31-L49 HydrophobicContact CD2-CD1 3.82Å; Y31-L49 HydrophobicContact CE1-CB 4.28Å; Y31-L49 HydrophobicContact CE1-CD1 3.98Å; Y31-L49 HydrophobicContact CE2-CD1 3.49Å; Y31-L49 VanDerWaalsContact CE2-CD1 3.49Å; Y31-L49 HydrophobicContact CG-CD1 4.19Å
32	D	89.4	Confident	82.1	Confident	61 Å²	61	99.1 Å²	99.1	33%	0.326	55%	0.553	S	S	.	*	G	3₁₀ helix	trans	-86.8	-4.9	-177	-66.9	-44	0	0	0	112.7	A26 S27 K29 I30	A26-D32 HydrophobicContact CB-CB 3.92Å; A26-D32 WeakPolarHBondContact O-CB 3.48Å; S27-D32 PolarHBondContact OG-OD2 2.96Å; K29-D32 PolarHBondContact O-N 3.33Å; I30-D32 VanDerWaalsContact C-N 3.32Å; I30-D32 PolarHBondContact O-N 2.93Å
33	F	92.3	Very high	84.3	Confident	113 Å²	113	91.2 Å²	91.2	50%	0.496	52%	0.515	S	S	.	.			trans	-92	143.4	179	-57.3	-84.4	0	0	0	112.2	K29 I30 Y31 L45	K29-F33 VanDerWaalsContact O-CE2 3.31Å; K29-F33 WeakPolarHBondContact O-CE2 3.44Å; I30-F33 WeakPolarHBondContact O-CD2 3.31Å; Y31-F33 VanDerWaalsContact C-N 3.3Å; F33-L45 HydrophobicContact CB-CD1 3.91Å; F33-L45 HydrophobicContact CB-CG 4.26Å; F33-L45 PolarHBondContact O-N 3.31Å
34	T	94.2	Very high	86.1	Confident	57 Å²	57	87.1 Å²	87.1	35%	0.35	51%	0.505	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.2	131.5	167.4	-53.2	0	0	0	0	107.2	E42 V43 Q44	T34-E42 HydrophobicContact CG2-CB 4.13Å; T34-V43 WeakPolarHBondContact CA-O 3.46Å; T34-Q44 HydrophobicContact CG2-CG 4.2Å
35	V	94.4	Very high	88	Confident	65 Å²	65	84.4 Å²	84.4	39%	0.394	48%	0.483	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.1	154.1	-178.7	-59.9	0	0	0	0	109.6	V43 L45	V35-V43 HydrophobicContact CG2-CB 4.2Å; V35-V43 PolarHBondContact N-O 2.88Å; V35-V43 WeakPolarHBondContact O-CA 3.4Å; V35-V43 PolarHBondContact O-N 3.09Å; V35-L45 HydrophobicContact CG1-CD1 4.32Å; V35-L45 HydrophobicContact CG1-CD2 4.3Å; V35-L45 HydrophobicContact CG1-CG 4.29Å; V35-L45 HydrophobicContact CG2-CD2 3.72Å; V35-L45 HydrophobicContact CG2-CG 4.44Å
36	T	96.9	Very high	89.9	Confident	100 Å²	100	85.5 Å²	85.5	61%	0.613	48%	0.477	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-90.1	129.6	170.8	-49	0	0	0	0	108.7	N41	T36-N41 WeakPolarHBondContact CA-O 3.5Å
37	D	95.6	Very high	91.6	Very high	53 Å²	53	88.7 Å²	88.7	28%	0.283	48%	0.481	S	S	.	.			trans	-78.9	177.2	173	68.4	20.1	0	0	0	112.3	D39 G40 N41 V43	D37-D39 PolarHBondContact O-N 2.96Å; D37-D39 WeakPolarHBondContact OD1-CA 3.09Å; D37-D39 PolarHBondContact OD1-N 3.18Å; D37-G40 PolarHBondContact O-N 3.44Å; D37-G40 VanDerWaalsContact O-N 3.13Å; D37-G40 PolarHBondContact OD1-N 2.75Å; D37-N41 PolarHBondContact N-O 3.1Å; D37-N41 PolarHBondContact OD1-N 3.24Å; D37-N41 PolarHBondContact OD1-ND2 3.01Å; D37-N41 WeakPolarHBondContact OD2-CB 3.49Å; D37-N41 PolarHBondContact OD2-ND2 3.05Å; D37-V43 HydrophobicContact CB-CG2 4.02Å
38	I	95.2	Very high	93.3	Very high	168 Å²	168	90 Å²	90	86%	0.862	48%	0.477	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64.7	-21.8	-178.8	-167.1	165.9	0	0	0	113.1
39	D	97.6	Very high	94.3	Very high	131 Å²	131	90 Å²	90	70%	0.701	46%	0.457	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.4	-0.2	179.3	-59.8	-48.8	0	0	0	112.1	D37 N41	D37-D39 PolarHBondContact O-N 2.96Å; D37-D39 WeakPolarHBondContact OD1-CA 3.09Å; D37-D39 PolarHBondContact OD1-N 3.18Å; D39-N41 WeakPolarHBondContact CB-ND2 3.39Å
40	G	97	Very high	94.5	Very high	53 Å²	53	91.2 Å²	91.2	55%	0.546	47%	0.469	S	S	.	.	S	Bend	trans	87.9	7.4	178	0	0	0	0	0	115.1	D37	D37-G40 PolarHBondContact O-N 3.44Å; D37-G40 VanDerWaalsContact O-N 3.13Å; D37-G40 PolarHBondContact OD1-N 2.75Å
41	N	97.3	Very high	94.8	Very high	90 Å²	90	94.7 Å²	94.7	48%	0.481	48%	0.482	S	S	.	.			trans	-84.5	144.5	179.8	-50.1	-71.4	0	0	0	111.4	T36 D37 D39 V43	T36-N41 WeakPolarHBondContact CA-O 3.5Å; D37-N41 PolarHBondContact N-O 3.1Å; D37-N41 PolarHBondContact OD1-N 3.24Å; D37-N41 PolarHBondContact OD1-ND2 3.01Å; D37-N41 WeakPolarHBondContact OD2-CB 3.49Å; D37-N41 PolarHBondContact OD2-ND2 3.05Å; D39-N41 WeakPolarHBondContact CB-ND2 3.39Å; N41-V43 PolarHBondContact O-N 3.08Å
42	E	97.2	Very high	94.9	Very high	162 Å²	162	98.9 Å²	98.9	76%	0.757	51%	0.514	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-76.6	120.8	170.8	-68.2	-162.9	142	0	0	111.3	T34	T34-E42 HydrophobicContact CG2-CB 4.13Å
43	V	95.1	Very high	95.1	Very high	17 Å²	17	98.3 Å²	98.3	10%	0.103	52%	0.515	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.3	115.8	-177.7	176.5	0	0	0	0	110	T34 V35 D37 N41 K47	T34-V43 WeakPolarHBondContact CA-O 3.46Å; V35-V43 HydrophobicContact CG2-CB 4.2Å; V35-V43 PolarHBondContact N-O 2.88Å; V35-V43 WeakPolarHBondContact O-CA 3.4Å; V35-V43 PolarHBondContact O-N 3.09Å; D37-V43 HydrophobicContact CB-CG2 4.02Å; N41-V43 PolarHBondContact O-N 3.08Å; V43-K47 HydrophobicContact CG1-CD 3.76Å
44	Q	95.4	Very high	95.3	Very high	124 Å²	124	100.2 Å²	100.2	58%	0.579	53%	0.528	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-77.1	126.9	171	-65.8	176.5	51.5	0	0	110.4	T34 K46 K47	T34-Q44 HydrophobicContact CG2-CG 4.2Å; Q44-K46 HydrophobicContact CB-CB 4.5Å; Q44-K46 PolarHBondContact O-N 3.44Å; Q44-K47 WeakPolarHBondContact O-CG 3.41Å; Q44-K47 PolarHBondContact O-N 3.4Å
45	L	94.3	Very high	95.4	Very high	31 Å²	31	103.9 Å²	103.9	16%	0.162	54%	0.544	C	S	.	.	G	3₁₀ helix	trans	-68.3	-14.5	179.1	-65.3	-165.8	0	0	0	113	I30 F33 V35 K47 Y48	I30-L45 WeakPolarHBondContact O-CB 3.49Å; I30-L45 WeakPolarHBondContact O-CD1 3.38Å; F33-L45 HydrophobicContact CB-CD1 3.91Å; F33-L45 HydrophobicContact CB-CG 4.26Å; F33-L45 PolarHBondContact O-N 3.31Å; V35-L45 HydrophobicContact CG1-CD1 4.32Å; V35-L45 HydrophobicContact CG1-CD2 4.3Å; V35-L45 HydrophobicContact CG1-CG 4.29Å; V35-L45 HydrophobicContact CG2-CD2 3.72Å; V35-L45 HydrophobicContact CG2-CG 4.44Å; L45-K47 PolarHBondContact O-N 2.83Å; L45-Y48 HydrophobicContact CD2-CD2 4.36Å; L45-Y48 HydrophobicContact CD2-CE2 4.23Å; L45-Y48 PolarHBondContact O-N 3.13Å
46	K	94.5	Very high	95.5	Very high	130 Å²	130	105.7 Å²	105.7	57%	0.565	56%	0.555	S	S	*	*	G	3₁₀ helix	trans	-50.7	-26.6	169	-170	174.7	-178.9	178.7	0	113.6	Q44 Y48 L49	Q44-K46 HydrophobicContact CB-CB 4.5Å; Q44-K46 PolarHBondContact O-N 3.44Å; K46-Y48 PolarHBondContact O-N 3.02Å; K46-Y48 VanDerWaalsContact O-N 3.1Å; K46-L49 WeakPolarHBondContact O-CB 3.48Å; K46-L49 PolarHBondContact O-N 3.41Å; K46-L49 VanDerWaalsContact O-N 3.09Å
47	K	94.2	Very high	95.5	Very high	118 Å²	118	108 Å²	108	51%	0.513	56%	0.564	S	S	.	*	G	3₁₀ helix	trans	-61.5	-16.7	176.4	78	-177.5	-174.5	177.6	0	114.1	V43 Q44 L45	V43-K47 HydrophobicContact CG1-CD 3.76Å; Q44-K47 WeakPolarHBondContact O-CG 3.41Å; Q44-K47 PolarHBondContact O-N 3.4Å; L45-K47 PolarHBondContact O-N 2.83Å
48	Y	94.8	Very high	95.5	Very high	92 Å²	92	111.4 Å²	111.4	36%	0.361	59%	0.586	S	S	.	*	G	3₁₀ helix	trans	-99.2	15.7	177.7	-57.6	-75.3	0	0	0	113.8	L45 K46 N50 K51 C53	L45-Y48 HydrophobicContact CD2-CD2 4.36Å; L45-Y48 HydrophobicContact CD2-CE2 4.23Å; L45-Y48 PolarHBondContact O-N 3.13Å; K46-Y48 PolarHBondContact O-N 3.02Å; K46-Y48 VanDerWaalsContact O-N 3.1Å; Y48-N50 PolarHBondContact O-N 3.35Å; Y48-K51 HydrophobicContact CD1-CD 4.39Å; Y48-K51 WeakPolarHBondContact O-CB 3.46Å; Y48-K51 PolarHBondContact O-N 3.34Å; Y48-K51 VanDerWaalsContact O-N 3.08Å; Y48-C53 VanDerWaalsContact CB-SG 3.58Å
49	L	93.7	Very high	95.5	Very high	83 Å²	83	107.9 Å²	107.9	44%	0.435	58%	0.582	S	S	.	*	T	Hydrogen-bonded Turn	trans	-51.5	136.5	174.2	-170.7	67.2	0	0	0	111.2	Y31 K46 K51	Y31-L49 HydrophobicContact CD1-CD1 4.26Å; Y31-L49 HydrophobicContact CD2-CD1 3.82Å; Y31-L49 HydrophobicContact CE1-CB 4.28Å; Y31-L49 HydrophobicContact CE1-CD1 3.98Å; Y31-L49 HydrophobicContact CE2-CD1 3.49Å; Y31-L49 VanDerWaalsContact CE2-CD1 3.49Å; Y31-L49 HydrophobicContact CG-CD1 4.19Å; K46-L49 WeakPolarHBondContact O-CB 3.48Å; K46-L49 PolarHBondContact O-N 3.41Å; K46-L49 VanDerWaalsContact O-N 3.09Å; L49-K51 PolarHBondContact O-N 2.98Å
50	N	93.8	Very high	95.4	Very high	149 Å²	149	108.2 Å²	108.2	80%	0.797	59%	0.589	S	S	*	*	T	Hydrogen-bonded Turn	trans	64.4	18.2	-178.2	-52.7	-34.8	0	0	0	115.1	Y48	Y48-N50 PolarHBondContact O-N 3.35Å
51	K	95.5	Very high	95.1	Very high	129 Å²	129	118.4 Å²	118.4	56%	0.561	62%	0.622	S	S	*	*	S	Bend	trans	-113.8	141.7	171.7	-58.4	-177	-178.8	-179.8	0	110.3	Y48 L49 C53	Y48-K51 HydrophobicContact CD1-CD 4.39Å; Y48-K51 WeakPolarHBondContact O-CB 3.46Å; Y48-K51 PolarHBondContact O-N 3.34Å; Y48-K51 VanDerWaalsContact O-N 3.08Å; L49-K51 PolarHBondContact O-N 2.98Å; K51-C53 PolarHBondContact O-N 3.04Å; K51-C53 PolarHBondContact O-SG 3.25Å
52	V	94.9	Very high	95	Very high	150 Å²	150	119.8 Å²	119.8	91%	0.909	63%	0.63	S	S	*	*			trans	-71.1	123.3	167	-179.6	0	0	0	0	107.7
53	C	94.2	Very high	94.9	Very high	50 Å²	50	117.6 Å²	117.6	34%	0.338	62%	0.623	S	S	.	*			trans	-114.5	137.3	-177.4	-60.1	0	0	0	0	110	I30 Y48 K51	I30-C53 HydrophobicContact CD1-CB 4.17Å; Y48-C53 VanDerWaalsContact CB-SG 3.58Å; K51-C53 PolarHBondContact O-N 3.04Å; K51-C53 PolarHBondContact O-SG 3.25Å
54	I	96	Very high	94.9	Very high	152 Å²	152	123.2 Å²	123.2	78%	0.779	65%	0.652	S	S	*	*			trans	-107.7	126.9	168.6	-55.6	177	0	0	0	107	V56	I54-V56 HydrophobicContact CG2-CG2 3.69Å
55	I	94.8	Very high	94.8	Very high	134 Å²	134	123.1 Å²	123.1	69%	0.687	66%	0.656	S	S	*	*			trans	-107.2	120.5	176.8	-59.2	172.5	0	0	0	107.1	I30	I30-I55 HydrophobicContact CG2-CD1 4.27Å
56	V	97.7	Very high	94.9	Very high	103 Å²	103	128.9 Å²	128.9	62%	0.624	69%	0.687	S	S	*	*			trans	-123.6	124	-176.3	-173.3	0	0	0	0	109.3	I54 V58	I54-V56 HydrophobicContact CG2-CG2 3.69Å; V56-V58 HydrophobicContact CG1-CG1 3.96Å
57	N	96.1	Very high	94.9	Very high	150 Å²	150	128.8 Å²	128.8	80%	0.802	70%	0.695	S	S	*	*			trans	-73.7	126.8	163.1	160.9	-11.3	0	0	0	107.9
58	V	96.2	Very high	94.9	Very high	123 Å²	123	129.6 Å²	129.6	75%	0.745	71%	0.708	S	S	*	*			trans	-123	151.5	173.5	-61.2	0	0	0	0	110	V56	V56-V58 HydrophobicContact CG1-CG1 3.96Å
59	A	96.2	Very high	94.9	Very high	94 Å²	94	132.5 Å²	132.5	78%	0.777	74%	0.735	S	S	*	*			trans	-132.8	147.5	171.1	0	0	0	0	0	109
60	T	93.9	Very high	95	Very high	139 Å²	139	136.6 Å²	136.6	85%	0.853	76%	0.76	S	S	*	*			trans	-84.8	159.7	172.3	56.6	0	0	0	0	110.5
61	E	91.1	Very high	95.1	Very high	266 Å²	266	135.5 Å²	135.5	100%	1.243	76%	0.756	S	S	*	*			trans	-63.9	0	168	-62.9	-169	168.9	0	0	112.5

Retrieved 61 of 61 residues in 26.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).