A0A5K4FG77_SCHMA Loading...

30S ribosomal protein S4

AlphaFold DB , UniProt , Accession A0A5K4FG77, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 71 aa.

						>A0A5K4FG77_SCHMA|A0A5K4FG77
MPAGKPSGLKTARKLRDHRRTQRWSDKAYKKLILEQDGKRIPSRVPHTQRVLYLKRLVLKLNNRILPFVNV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48	Very low	81.1	Confident	221 Å²	221	115.1 Å²	115.1	100%	1.089	69%	0.689	S	S	*	*				0	122.1	0	-60.1	-63.7	176.1	0	0	108.2	A3	M1-A3 HydrophobicContact CB-CB 4.41Å; M1-A3 PolarHBondContact O-N 3.33Å
2	P	56.7	Low	82.2	Confident	139 Å²	139	110.2 Å²	110.2	90%	0.903	67%	0.67	S	S	*	*			trans	-78.9	67.1	170	34.5	-31.5	0	0	0	108.7	G4	P2-G4 VanDerWaalsContact C-N 3.3Å; P2-G4 PolarHBondContact O-N 3.13Å
3	A	73.5	Confident	83.2	Confident	101 Å²	101	116.9 Å²	116.9	84%	0.835	68%	0.676	S	S	*	*			trans	-81.1	80.3	174.6	0	0	0	0	0	108.2	M1	M1-A3 HydrophobicContact CB-CB 4.41Å; M1-A3 PolarHBondContact O-N 3.33Å
4	G	84.1	Confident	84	Confident	63 Å²	63	118.8 Å²	118.8	65%	0.649	67%	0.672	S	S	*	*	S	Bend	trans	-158	-167.3	-173.7	0	0	0	0	0	113.4	P2	P2-G4 VanDerWaalsContact C-N 3.3Å; P2-G4 PolarHBondContact O-N 3.13Å
5	K	87.6	Confident	84.7	Confident	109 Å²	109	115.2 Å²	115.2	47%	0.474	65%	0.65	S	S	.	*	S	Bend	trans	-59.5	144.8	177.1	-66.4	177.4	-174.7	-177.1	0	110.2	S7 L15 H18	K5-S7 PolarHBondContact O-N 3.01Å; K5-L15 HydrophobicContact CB-CD2 3.84Å; K5-L15 HydrophobicContact CD-CD2 4.33Å; K5-L15 HydrophobicContact CG-CD2 4.42Å; K5-H18 VanDerWaalsContact CE-CD2 3.48Å; K5-H18 WeakPolarHBondContact CE-CD2 3.4Å; K5-H18 WeakPolarHBondContact CE-NE2 3.49Å
6	P	90.6	Very high	85.4	Confident	40 Å²	40	119.4 Å²	119.4	26%	0.26	65%	0.652	S	S	.	*			trans	-67.7	132.4	179.9	31.8	-38.3	0	0	0	110.9	T11 K14 L15	P6-T11 HydrophobicContact CB-CG2 3.83Å; P6-T11 HydrophobicContact CG-CG2 4.33Å; P6-T11 PolarHBondContact O-OG1 3.34Å; P6-K14 HydrophobicContact CG-CB 4.41Å; P6-K14 HydrophobicContact CG-CD 3.89Å; P6-K14 HydrophobicContact CG-CG 4.01Å; P6-L15 HydrophobicContact CG-CD2 4.19Å
7	S	86.5	Confident	86	Confident	126 Å²	126	116.5 Å²	116.5	88%	0.881	64%	0.636	S	S	*	*			trans	-102.3	2.8	-174.1	54.3	0	0	0	0	115.3	K5	K5-S7 PolarHBondContact O-N 3.01Å
8	G	88.4	Confident	86.5	Confident	39 Å²	39	114.4 Å²	114.4	40%	0.402	62%	0.621	S	S	.	*	S	Bend	trans	-72.7	155.2	-178.4	0	0	0	0	0	114.7	K10 T11	G8-K10 VanDerWaalsContact C-N 3.26Å; G8-K10 PolarHBondContact O-N 3.47Å; G8-T11 WeakPolarHBondContact O-CB 3.48Å; G8-T11 VanDerWaalsContact O-CG2 3.29Å; G8-T11 WeakPolarHBondContact O-CG2 3.38Å; G8-T11 PolarHBondContact O-N 3.32Å; G8-T11 PolarHBondContact O-OG1 3.13Å
9	L	90.7	Very high	87	Confident	183 Å²	183	115.7 Å²	115.7	96%	0.958	62%	0.616	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.1	-29.7	-177.2	-65.8	171.5	0	0	0	114.2
10	K	92.7	Very high	87.4	Confident	212 Å²	212	117.8 Å²	117.8	92%	0.922	62%	0.615	S	S	*	*	T	Hydrogen-bonded Turn	trans	-97.3	16.7	-178.1	-64.9	-177.4	177.5	178.1	0	114	G8	G8-K10 VanDerWaalsContact C-N 3.26Å; G8-K10 PolarHBondContact O-N 3.47Å
11	T	93.1	Very high	87.7	Confident	33 Å²	33	117.2 Å²	117.2	20%	0.202	62%	0.616	C	S	.	*			trans	-96	5.3	-172.3	70.3	0	0	0	0	114.2	P6 G8 R13 K14 L15	P6-T11 HydrophobicContact CB-CG2 3.83Å; P6-T11 HydrophobicContact CG-CG2 4.33Å; P6-T11 PolarHBondContact O-OG1 3.34Å; G8-T11 WeakPolarHBondContact O-CB 3.48Å; G8-T11 VanDerWaalsContact O-CG2 3.29Å; G8-T11 WeakPolarHBondContact O-CG2 3.38Å; G8-T11 PolarHBondContact O-N 3.32Å; G8-T11 PolarHBondContact O-OG1 3.13Å; T11-R13 VanDerWaalsContact C-N 3.31Å; T11-R13 PolarHBondContact O-N 3.49Å; T11-K14 PolarHBondContact O-N 3.26Å; T11-K14 VanDerWaalsContact O-N 3.1Å; T11-L15 PolarHBondContact O-N 3.24Å; T11-L15 VanDerWaalsContact O-N 3.15Å
12	A	94.1	Very high	89.9	Confident	56 Å²	56	110.4 Å²	110.4	46%	0.463	58%	0.582	S	S	.	*	H	α-helix	trans	-53.6	-40.8	-171.8	0	0	0	0	0	114.4	L15 R16	A12-L15 PolarHBondContact O-N 3.21Å; A12-R16 WeakPolarHBondContact O-CG 3.47Å; A12-R16 PolarHBondContact O-N 3.06Å
13	R	95.6	Very high	91.7	Very high	198 Å²	198	109.8 Å²	109.8	75%	0.747	56%	0.561	S	S	*	*	H	α-helix	trans	-60.2	-51	177.9	-177.7	177.7	-63.9	-81.5	2.2	111.4	T11 L15 R16 D17	T11-R13 VanDerWaalsContact C-N 3.31Å; T11-R13 PolarHBondContact O-N 3.49Å; R13-L15 VanDerWaalsContact C-N 3.29Å; R13-L15 PolarHBondContact O-N 3.44Å; R13-R16 WeakPolarHBondContact O-CB 3.41Å; R13-R16 PolarHBondContact O-N 3.12Å; R13-R16 VanDerWaalsContact O-N 3.08Å; R13-D17 PolarHBondContact O-N 3.15Å
14	K	94.5	Very high	92.7	Very high	143 Å²	143	111 Å²	111	62%	0.622	55%	0.545	S	S	*	.	H	α-helix	trans	-59.1	-39.3	178.9	-177	163.4	173.3	177.9	0	112.1	P6 T11 H18	P6-K14 HydrophobicContact CG-CB 4.41Å; P6-K14 HydrophobicContact CG-CD 3.89Å; P6-K14 HydrophobicContact CG-CG 4.01Å; T11-K14 PolarHBondContact O-N 3.26Å; T11-K14 VanDerWaalsContact O-N 3.1Å; K14-H18 VanDerWaalsContact O-CB 3.26Å; K14-H18 WeakPolarHBondContact O-CB 3.49Å; K14-H18 PolarHBondContact O-N 3.43Å
15	L	94.8	Very high	93.1	Very high	65 Å²	65	112.8 Å²	112.8	34%	0.34	55%	0.547	S	S	.	.	H	α-helix	trans	-65	-40.5	175.7	-67.7	174.4	0	0	0	112.7	K5 P6 T11 A12 R13 R19	K5-L15 HydrophobicContact CB-CD2 3.84Å; K5-L15 HydrophobicContact CD-CD2 4.33Å; K5-L15 HydrophobicContact CG-CD2 4.42Å; P6-L15 HydrophobicContact CG-CD2 4.19Å; T11-L15 PolarHBondContact O-N 3.24Å; T11-L15 VanDerWaalsContact O-N 3.15Å; A12-L15 PolarHBondContact O-N 3.21Å; R13-L15 VanDerWaalsContact C-N 3.29Å; R13-L15 PolarHBondContact O-N 3.44Å; L15-R19 WeakPolarHBondContact O-CB 3.43Å; L15-R19 PolarHBondContact O-N 3.03Å
16	R	95.8	Very high	93.4	Very high	183 Å²	183	111.6 Å²	111.6	69%	0.691	55%	0.546	S	S	*	.	H	α-helix	trans	-65.4	-47.9	177.1	-73.7	179	179	-157.3	0.5	111.7	A12 R13 R19 R20	A12-R16 WeakPolarHBondContact O-CG 3.47Å; A12-R16 PolarHBondContact O-N 3.06Å; R13-R16 WeakPolarHBondContact O-CB 3.41Å; R13-R16 PolarHBondContact O-N 3.12Å; R13-R16 VanDerWaalsContact O-N 3.08Å; R16-R19 PolarHBondContact O-N 3.37Å; R16-R20 WeakPolarHBondContact O-CG 3.44Å; R16-R20 PolarHBondContact O-N 3.46Å
17	D	95.5	Very high	93.5	Very high	70 Å²	70	118.3 Å²	118.3	37%	0.374	57%	0.571	S	S	.	*	H	α-helix	trans	-64.8	-43.2	-178.5	-64	-27.9	0	0	0	111	R13 R19 R20 T21	R13-D17 PolarHBondContact O-N 3.15Å; D17-R19 VanDerWaalsContact C-N 3.33Å; D17-R19 PolarHBondContact O-N 3.44Å; D17-R20 WeakPolarHBondContact O-CB 3.47Å; D17-R20 PolarHBondContact O-N 3.06Å; D17-R20 VanDerWaalsContact O-N 3.09Å; D17-T21 PolarHBondContact O-N 2.96Å; D17-T21 PolarHBondContact O-OG1 3.04Å
18	H	94.6	Very high	93.6	Very high	78 Å²	78	115 Å²	115	36%	0.361	55%	0.551	S	S	.	*	H	α-helix	trans	-59.4	-42.4	174.2	-176.8	76.3	0	0	0	112.4	K5 K14 R20 T21 Q22	K5-H18 VanDerWaalsContact CE-CD2 3.48Å; K5-H18 WeakPolarHBondContact CE-CD2 3.4Å; K5-H18 WeakPolarHBondContact CE-NE2 3.49Å; K14-H18 VanDerWaalsContact O-CB 3.26Å; K14-H18 WeakPolarHBondContact O-CB 3.49Å; K14-H18 PolarHBondContact O-N 3.43Å; H18-R20 VanDerWaalsContact C-N 3.33Å; H18-R20 PolarHBondContact O-N 3.23Å; H18-T21 PolarHBondContact O-N 3.22Å; H18-Q22 PolarHBondContact CE1-NE2 2.93Å; H18-Q22 PolarHBondContact NE2-NE2 3.35Å; H18-Q22 WeakPolarHBondContact O-CB 3.17Å; H18-Q22 WeakPolarHBondContact O-CG 3.45Å; H18-Q22 PolarHBondContact O-N 2.95Å
19	R	95.4	Very high	93.7	Very high	139 Å²	139	116.6 Å²	116.6	53%	0.525	55%	0.546	S	S	.	.	H	α-helix	trans	-62.9	-39.6	174.9	179.4	63.3	71.3	141.3	6.3	111.8	L15 R16 D17 Q22 R23	L15-R19 WeakPolarHBondContact O-CB 3.43Å; L15-R19 PolarHBondContact O-N 3.03Å; R16-R19 PolarHBondContact O-N 3.37Å; D17-R19 VanDerWaalsContact C-N 3.33Å; D17-R19 PolarHBondContact O-N 3.44Å; R19-Q22 PolarHBondContact O-N 3.35Å; R19-R23 WeakPolarHBondContact O-CG 3.31Å; R19-R23 PolarHBondContact O-N 3.07Å
20	R	95.1	Very high	93.7	Very high	158 Å²	158	113 Å²	113	60%	0.596	52%	0.522	S	S	*	.	H	α-helix	trans	-61.5	-47.9	177.6	-74.4	173	170.9	-176.8	-7.2	111	R16 D17 H18 Q22 R23 W24	R16-R20 WeakPolarHBondContact O-CG 3.44Å; R16-R20 PolarHBondContact O-N 3.46Å; D17-R20 WeakPolarHBondContact O-CB 3.47Å; D17-R20 PolarHBondContact O-N 3.06Å; D17-R20 VanDerWaalsContact O-N 3.09Å; H18-R20 VanDerWaalsContact C-N 3.33Å; H18-R20 PolarHBondContact O-N 3.23Å; R20-Q22 VanDerWaalsContact C-N 3.35Å; R20-Q22 PolarHBondContact O-N 3.08Å; R20-R23 PolarHBondContact O-N 3.45Å; R20-W24 VanDerWaalsContact O-CD1 3.3Å
21	T	94.3	Very high	93.4	Very high	105 Å²	105	108.5 Å²	108.5	64%	0.644	50%	0.503	S	S	*	.	H	α-helix	trans	-61.7	-42.8	176.1	-53.3	0	0	0	0	111.6	D17 H18 R23 W24	D17-T21 PolarHBondContact O-N 2.96Å; D17-T21 PolarHBondContact O-OG1 3.04Å; H18-T21 PolarHBondContact O-N 3.22Å; T21-R23 VanDerWaalsContact C-N 3.34Å; T21-R23 PolarHBondContact O-N 3.1Å; T21-W24 PolarHBondContact O-N 3.45Å
22	Q	94.8	Very high	93	Very high	79 Å²	79	110.3 Å²	110.3	37%	0.369	51%	0.511	S	S	.	.	H	α-helix	trans	-65.2	-31	177.3	-75.3	-173.7	-30.2	0	0	113.7	H18 R19 R20 W24 S25	H18-Q22 PolarHBondContact CE1-NE2 2.93Å; H18-Q22 PolarHBondContact NE2-NE2 3.35Å; H18-Q22 WeakPolarHBondContact O-CB 3.17Å; H18-Q22 WeakPolarHBondContact O-CG 3.45Å; H18-Q22 PolarHBondContact O-N 2.95Å; R19-Q22 PolarHBondContact O-N 3.35Å; R20-Q22 VanDerWaalsContact C-N 3.35Å; R20-Q22 PolarHBondContact O-N 3.08Å; Q22-W24 PolarHBondContact O-N 3.26Å; Q22-S25 PolarHBondContact O-N 2.93Å; Q22-S25 PolarHBondContact O-OG 3.03Å
23	R	95	Very high	92.6	Very high	125 Å²	125	109.4 Å²	109.4	47%	0.472	50%	0.498	S	S	.	.	H	α-helix	trans	-63.5	-32.1	177.9	-78.9	178.5	-170.5	172.7	1.8	112.3	R19 R20 T21 S25 D26 Y29	R19-R23 WeakPolarHBondContact O-CG 3.31Å; R19-R23 PolarHBondContact O-N 3.07Å; R20-R23 PolarHBondContact O-N 3.45Å; T21-R23 VanDerWaalsContact C-N 3.34Å; T21-R23 PolarHBondContact O-N 3.1Å; R23-S25 PolarHBondContact O-N 2.88Å; R23-D26 WeakPolarHBondContact O-CB 3.43Å; R23-D26 PolarHBondContact O-N 3.4Å; R23-Y29 HydrophobicContact CB-CD1 3.83Å; R23-Y29 HydrophobicContact CB-CE1 3.81Å; R23-Y29 HydrophobicContact CB-CG 4.29Å; R23-Y29 VanDerWaalsContact O-CD1 3.26Å; R23-Y29 WeakPolarHBondContact O-CD1 3.27Å
24	W	92.9	Very high	92	Very high	128 Å²	128	104.6 Å²	104.6	49%	0.485	49%	0.486	S	S	.	.	T	Hydrogen-bonded Turn	trans	-67.2	-19.1	179.5	-74	111.3	0	0	0	114.2	R20 T21 Q22 D26 Y29 K30 I33	R20-W24 VanDerWaalsContact O-CD1 3.3Å; T21-W24 PolarHBondContact O-N 3.45Å; Q22-W24 PolarHBondContact O-N 3.26Å; W24-D26 VanDerWaalsContact C-N 3.35Å; W24-Y29 HydrophobicContact CD2-CE1 4.45Å; W24-K30 HydrophobicContact CE3-CG 4.39Å; W24-I33 HydrophobicContact CH2-CG2 4Å; W24-I33 HydrophobicContact CZ3-CG2 4.43Å
25	S	93.2	Very high	91.1	Very high	100 Å²	100	98.7 Å²	98.7	70%	0.699	46%	0.461	S	S	*	.	T	Hydrogen-bonded Turn	trans	-80	-16.9	172.8	65.7	0	0	0	0	113.2	Q22 R23 K27	Q22-S25 PolarHBondContact O-N 2.93Å; Q22-S25 PolarHBondContact O-OG 3.03Å; R23-S25 PolarHBondContact O-N 2.88Å; S25-K27 PolarHBondContact O-N 3.26Å
26	D	94.5	Very high	90.1	Very high	84 Å²	84	102.4 Å²	102.4	45%	0.449	48%	0.476	S	S	.	.			trans	-73.6	116	172.9	175	20.2	0	0	0	110	R23 W24 A28 Y29 K30	R23-D26 WeakPolarHBondContact O-CB 3.43Å; R23-D26 PolarHBondContact O-N 3.4Å; W24-D26 VanDerWaalsContact C-N 3.35Å; D26-A28 VanDerWaalsContact C-N 3.25Å; D26-A28 PolarHBondContact O-N 3.48Å; D26-A28 PolarHBondContact OD1-N 3.24Å; D26-Y29 PolarHBondContact O-N 3.18Å; D26-Y29 WeakPolarHBondContact OD2-CB 3.24Å; D26-Y29 PolarHBondContact OD2-N 3.36Å; D26-K30 WeakPolarHBondContact O-CB 2.76Å; D26-K30 PolarHBondContact O-N 3.33Å
27	K	91.4	Very high	88.8	Confident	180 Å²	180	99.9 Å²	99.9	78%	0.783	48%	0.477	S	S	*	.	H	α-helix	trans	-60	-37.2	179.7	-65.6	-179.3	-178.6	177.4	0	111.5	S25 K31	S25-K27 PolarHBondContact O-N 3.26Å; K27-K31 WeakPolarHBondContact O-CB 3.3Å; K27-K31 PolarHBondContact O-N 3.05Å
28	A	90	Very high	87.2	Confident	57 Å²	57	99.5 Å²	99.5	47%	0.471	49%	0.489	S	S	.	.	H	α-helix	trans	-67.8	-50.7	-179.8	0	0	0	0	0	110.3	D26 K30 K31 L32	D26-A28 VanDerWaalsContact C-N 3.25Å; D26-A28 PolarHBondContact O-N 3.48Å; D26-A28 PolarHBondContact OD1-N 3.24Å; A28-K30 PolarHBondContact O-N 2.94Å; A28-K31 PolarHBondContact O-N 3.07Å; A28-L32 VanDerWaalsContact O-CG 3.3Å; A28-L32 WeakPolarHBondContact O-CG 3.18Å; A28-L32 PolarHBondContact O-N 3.37Å
29	Y	90.9	Very high	85.6	Confident	72 Å²	72	104.2 Å²	104.2	28%	0.282	51%	0.509	S	S	.	.	H	α-helix	trans	-55.6	-50.3	174.5	-178.4	-101.5	0	0	0	112.4	R23 W24 D26 K31 L32 I33	R23-Y29 HydrophobicContact CB-CD1 3.83Å; R23-Y29 HydrophobicContact CB-CE1 3.81Å; R23-Y29 HydrophobicContact CB-CG 4.29Å; R23-Y29 VanDerWaalsContact O-CD1 3.26Å; R23-Y29 WeakPolarHBondContact O-CD1 3.27Å; W24-Y29 HydrophobicContact CD2-CE1 4.45Å; D26-Y29 PolarHBondContact O-N 3.18Å; D26-Y29 WeakPolarHBondContact OD2-CB 3.24Å; D26-Y29 PolarHBondContact OD2-N 3.36Å; Y29-K31 PolarHBondContact O-N 3.04Å; Y29-L32 PolarHBondContact O-N 2.96Å; Y29-I33 HydrophobicContact CE1-CG1 4.14Å; Y29-I33 HydrophobicContact CE2-CD1 4.36Å; Y29-I33 HydrophobicContact CE2-CG1 4.24Å; Y29-I33 WeakPolarHBondContact O-CG1 3.44Å; Y29-I33 PolarHBondContact O-N 2.86Å; Y29-I33 VanDerWaalsContact O-N 3.17Å
30	K	89.9	Confident	83.9	Confident	107 Å²	107	107.1 Å²	107.1	47%	0.465	52%	0.52	S	S	.	.	H	α-helix	trans	-59.9	-43.9	179.9	-175.7	176.3	-179.3	177.2	0	112.1	W24 D26 A28 I33 L34	W24-K30 HydrophobicContact CE3-CG 4.39Å; D26-K30 WeakPolarHBondContact O-CB 2.76Å; D26-K30 PolarHBondContact O-N 3.33Å; A28-K30 PolarHBondContact O-N 2.94Å; K30-I33 PolarHBondContact O-N 3.04Å; K30-L34 HydrophobicContact CD-CD1 4.46Å; K30-L34 HydrophobicContact CG-CD1 3.82Å; K30-L34 HydrophobicContact CG-CG 4.4Å; K30-L34 WeakPolarHBondContact O-CB 3.41Å; K30-L34 VanDerWaalsContact O-CG 3.3Å; K30-L34 WeakPolarHBondContact O-CG 3.26Å; K30-L34 PolarHBondContact O-N 3.11Å
31	K	86	Confident	82.3	Confident	119 Å²	119	103.6 Å²	103.6	52%	0.517	51%	0.512	S	S	.	.	H	α-helix	trans	-61.9	-43.4	178.2	177.9	172.6	171	176.5	0	111.5	K27 A28 Y29 E35	K27-K31 WeakPolarHBondContact O-CB 3.3Å; K27-K31 PolarHBondContact O-N 3.05Å; A28-K31 PolarHBondContact O-N 3.07Å; Y29-K31 PolarHBondContact O-N 3.04Å; K31-E35 WeakPolarHBondContact CE-OE1 3.39Å; K31-E35 HydrophobicContact CG-CG 4.24Å; K31-E35 VanDerWaalsContact CG-OE1 3.29Å; K31-E35 WeakPolarHBondContact CG-OE1 3.29Å; K31-E35 IonicContact NZ-OE1 3.93Å; K31-E35 VanDerWaalsContact O-CB 3.24Å; K31-E35 WeakPolarHBondContact O-CB 3.48Å; K31-E35 WeakPolarHBondContact O-CG 3.45Å; K31-E35 PolarHBondContact O-N 3.11Å
32	L	85.1	Confident	80.7	Confident	70 Å²	70	103.1 Å²	103.1	37%	0.366	51%	0.51	S	S	.	.	H	α-helix	trans	-61.4	-46.3	178.7	-69.3	173.9	0	0	0	112.7	A28 Y29 E35 Q36	A28-L32 VanDerWaalsContact O-CG 3.3Å; A28-L32 WeakPolarHBondContact O-CG 3.18Å; A28-L32 PolarHBondContact O-N 3.37Å; Y29-L32 PolarHBondContact O-N 2.96Å; L32-E35 PolarHBondContact O-N 3.15Å; L32-Q36 VanDerWaalsContact O-CG 3.27Å; L32-Q36 WeakPolarHBondContact O-CG 3.4Å; L32-Q36 PolarHBondContact O-N 2.91Å
33	I	85.8	Confident	79.3	Confident	38 Å²	38	103.9 Å²	103.9	20%	0.195	53%	0.525	C	S	.	.	H	α-helix	trans	-66.4	-46.5	180	-60.4	-63.2	0	0	0	110.5	W24 Y29 K30 E35 Q36 D37	W24-I33 HydrophobicContact CH2-CG2 4Å; W24-I33 HydrophobicContact CZ3-CG2 4.43Å; Y29-I33 HydrophobicContact CE1-CG1 4.14Å; Y29-I33 HydrophobicContact CE2-CD1 4.36Å; Y29-I33 HydrophobicContact CE2-CG1 4.24Å; Y29-I33 WeakPolarHBondContact O-CG1 3.44Å; Y29-I33 PolarHBondContact O-N 2.86Å; Y29-I33 VanDerWaalsContact O-N 3.17Å; K30-I33 PolarHBondContact O-N 3.04Å; I33-E35 VanDerWaalsContact C-N 3.31Å; I33-E35 PolarHBondContact O-N 3.42Å; I33-Q36 WeakPolarHBondContact O-CB 3.3Å; I33-Q36 PolarHBondContact O-N 3.46Å; I33-D37 PolarHBondContact O-N 2.96Å
34	L	82.5	Confident	77.8	Confident	97 Å²	97	105.7 Å²	105.7	51%	0.508	53%	0.531	S	S	.	.	H	α-helix	trans	-64.4	-33	177	-68.9	174.3	0	0	0	113.1	K30 Q36	K30-L34 HydrophobicContact CD-CD1 4.46Å; K30-L34 HydrophobicContact CG-CD1 3.82Å; K30-L34 HydrophobicContact CG-CG 4.4Å; K30-L34 WeakPolarHBondContact O-CB 3.41Å; K30-L34 VanDerWaalsContact O-CG 3.3Å; K30-L34 WeakPolarHBondContact O-CG 3.26Å; K30-L34 PolarHBondContact O-N 3.11Å; L34-Q36 VanDerWaalsContact C-N 3.31Å
35	E	74.8	Confident	76.5	Confident	19 Å²	19	102.9 Å²	102.9	9%	0.089	53%	0.528	C	S	.	.	H	α-helix	trans	-67.2	-32.3	172.7	-80.2	175.6	-177.7	0	0	112	K31 L32 I33 R40 R44	K31-E35 WeakPolarHBondContact CE-OE1 3.39Å; K31-E35 HydrophobicContact CG-CG 4.24Å; K31-E35 VanDerWaalsContact CG-OE1 3.29Å; K31-E35 WeakPolarHBondContact CG-OE1 3.29Å; K31-E35 IonicContact NZ-OE1 3.93Å; K31-E35 VanDerWaalsContact O-CB 3.24Å; K31-E35 WeakPolarHBondContact O-CB 3.48Å; K31-E35 WeakPolarHBondContact O-CG 3.45Å; K31-E35 PolarHBondContact O-N 3.11Å; L32-E35 PolarHBondContact O-N 3.15Å; I33-E35 VanDerWaalsContact C-N 3.31Å; I33-E35 PolarHBondContact O-N 3.42Å; E35-R40 PolarHBondContact O-N 3.17Å; E35-R44 IonicContact OE2-NH1 3.11Å; E35-R44 PolarHBondContact OE2-NH1 3.48Å; E35-R44 VanDerWaalsContact OE2-NH1 3.11Å
36	Q	74	Confident	75.3	Confident	142 Å²	142	103.8 Å²	103.8	66%	0.664	53%	0.532	S	S	*	.	H	α-helix	trans	-76	-36.2	178.5	-75.4	174.7	-28.1	0	0	112.3	L32 I33 L34 G38	L32-Q36 VanDerWaalsContact O-CG 3.27Å; L32-Q36 WeakPolarHBondContact O-CG 3.4Å; L32-Q36 PolarHBondContact O-N 2.91Å; I33-Q36 WeakPolarHBondContact O-CB 3.3Å; I33-Q36 PolarHBondContact O-N 3.46Å; L34-Q36 VanDerWaalsContact C-N 3.31Å; Q36-G38 PolarHBondContact O-N 3.33Å
37	D	68.9	Low	74.2	Confident	130 Å²	130	102.8 Å²	102.8	70%	0.695	52%	0.524	S	S	*	.	T	Hydrogen-bonded Turn	trans	-72.4	19.5	-180	-71.4	-21.4	0	0	0	114.7	I33	I33-D37 PolarHBondContact O-N 2.96Å
38	G	61.7	Low	73.8	Confident	62 Å²	62	98.3 Å²	98.3	64%	0.639	51%	0.512	S	S	*	.	T	Hydrogen-bonded Turn	trans	116	15.5	162	0	0	0	0	0	117.3	Q36	Q36-G38 PolarHBondContact O-N 3.33Å
39	K	60.9	Low	73.5	Confident	178 Å²	178	104 Å²	104	77%	0.774	53%	0.529	S	S	*	.			trans	-137.4	67.2	170.9	-62	-177	-173.2	178.8	0	111.1	I41	K39-I41 PolarHBondContact O-N 3.41Å
40	R	60.7	Low	73.2	Confident	200 Å²	200	109.9 Å²	109.9	76%	0.755	55%	0.551	S	S	*	*			trans	-56.7	124.2	169.5	-84.6	-171	178.8	-164.8	1.3	109.2	E35 P42	E35-R40 PolarHBondContact O-N 3.17Å; R40-P42 WeakPolarHBondContact O-CD 3.44Å
41	I	60.8	Low	72.9	Confident	83 Å²	83	107.4 Å²	107.4	43%	0.426	55%	0.545	S	S	.	.			trans	-67	123.3	169.4	-55.4	175.2	0	0	0	107.2	K39 S43 R44	K39-I41 PolarHBondContact O-N 3.41Å; I41-S43 VanDerWaalsContact CG2-OG 3.31Å; I41-S43 WeakPolarHBondContact CG2-OG 3.47Å; I41-S43 PolarHBondContact O-N 3.26Å; I41-R44 PolarHBondContact O-N 3.26Å
42	P	60.4	Low	72.8	Confident	95 Å²	95	105.2 Å²	105.2	62%	0.617	54%	0.538	S	S	*	.	G	3₁₀ helix	trans	-56.4	-22.2	-174.6	-27.2	33.8	0	0	0	114.8	R40 R44 V45	R40-P42 WeakPolarHBondContact O-CD 3.44Å; P42-R44 PolarHBondContact O-N 3.46Å; P42-V45 PolarHBondContact O-N 3.04Å
43	S	65.9	Low	72.7	Confident	95 Å²	95	108.8 Å²	108.8	66%	0.664	55%	0.548	S	S	*	.	G	3₁₀ helix	trans	-66.8	-18.3	-177	61	0	0	0	0	114.5	I41	I41-S43 VanDerWaalsContact CG2-OG 3.31Å; I41-S43 WeakPolarHBondContact CG2-OG 3.47Å; I41-S43 PolarHBondContact O-N 3.26Å
44	R	62.9	Low	72.6	Confident	163 Å²	163	111.2 Å²	111.2	62%	0.615	56%	0.561	S	S	*	*	G	3₁₀ helix	trans	-92.4	-3.9	-178.6	-148.1	173.6	-173.9	-155.1	-3.8	114	E35 I41 P42 P46	E35-R44 IonicContact OE2-NH1 3.11Å; E35-R44 PolarHBondContact OE2-NH1 3.48Å; E35-R44 VanDerWaalsContact OE2-NH1 3.11Å; I41-R44 PolarHBondContact O-N 3.26Å; P42-R44 PolarHBondContact O-N 3.46Å; R44-P46 WeakPolarHBondContact O-CD 3.37Å
45	V	67.1	Low	72.5	Confident	70 Å²	70	111.2 Å²	111.2	42%	0.424	56%	0.557	S	S	.	*	S	Bend	trans	-76	119.9	174.1	-176.7	0	0	0	0	107.9	P42 H47	P42-V45 PolarHBondContact O-N 3.04Å; V45-H47 PolarHBondContact O-CE1 3.06Å; V45-H47 PolarHBondContact O-N 3.34Å; V45-H47 PolarHBondContact O-ND1 3.32Å
46	P	66.7	Low	72.8	Confident	119 Å²	119	119.3 Å²	119.3	77%	0.773	59%	0.586	S	S	*	*	P	Polyproline II helix	trans	-59.3	117.1	175.2	23.6	-31.1	0	0	0	108.6	R44	R44-P46 WeakPolarHBondContact O-CD 3.37Å
47	H	72.3	Confident	73	Confident	62 Å²	62	116 Å²	116	29%	0.287	57%	0.573	S	S	.	*	P	Polyproline II helix	trans	-81.2	127	176.4	-63.9	-28.8	0	0	0	108.7	V45 V51 L52 K55	V45-H47 PolarHBondContact O-CE1 3.06Å; V45-H47 PolarHBondContact O-N 3.34Å; V45-H47 PolarHBondContact O-ND1 3.32Å; H47-V51 HydrophobicContact CB-CB 4.23Å; H47-V51 HydrophobicContact CB-CG1 4.07Å; H47-L52 HydrophobicContact CB-CD1 4.47Å; H47-L52 HydrophobicContact CB-CD2 3.54Å; H47-L52 HydrophobicContact CB-CG 3.67Å; H47-K55 PolarHBondContact CE1-NZ 2.96Å; H47-K55 PolarHBondContact NE2-NZ 3.47Å
48	T	81.5	Confident	73.5	Confident	87 Å²	87	113.8 Å²	113.8	53%	0.534	56%	0.564	S	S	.	*	P	Polyproline II helix	trans	-63.7	156.1	168.1	61.2	0	0	0	0	109.5	R50 V51 L52	T48-R50 PolarHBondContact O-N 3.26Å; T48-R50 VanDerWaalsContact O-N 3.1Å; T48-V51 PolarHBondContact O-N 3.32Å; T48-V51 WeakPolarHBondContact OG1-CG2 3.32Å; T48-L52 PolarHBondContact O-N 3.37Å
49	Q	85.1	Confident	73.8	Confident	177 Å²	177	116 Å²	116	83%	0.827	56%	0.561	S	S	*	*	H	α-helix	trans	-52	-37.7	178.9	-63	-174.2	30.6	0	0	111.9	L52 Y53	Q49-L52 PolarHBondContact O-N 3.34Å; Q49-Y53 WeakPolarHBondContact O-CB 3.47Å; Q49-Y53 PolarHBondContact O-N 3.23Å
50	R	83.9	Confident	74.2	Confident	194 Å²	194	115.5 Å²	115.5	73%	0.732	56%	0.558	S	S	*	*	H	α-helix	trans	-58.1	-48.6	174.3	-175.1	-179.3	-179.2	-153	0.5	112.9	T48 L52 Y53 L54	T48-R50 PolarHBondContact O-N 3.26Å; T48-R50 VanDerWaalsContact O-N 3.1Å; R50-L52 VanDerWaalsContact C-N 3.34Å; R50-Y53 PolarHBondContact O-N 2.99Å; R50-L54 HydrophobicContact CG-CD1 4.41Å; R50-L54 WeakPolarHBondContact O-CG 3.26Å; R50-L54 PolarHBondContact O-N 3.28Å
51	V	84.8	Confident	74.4	Confident	56 Å²	56	113.1 Å²	113.1	34%	0.339	56%	0.56	S	S	.	*	H	α-helix	trans	-65.7	-39.9	-179.9	173	0	0	0	0	110.8	H47 T48 L54 K55	H47-V51 HydrophobicContact CB-CB 4.23Å; H47-V51 HydrophobicContact CB-CG1 4.07Å; T48-V51 PolarHBondContact O-N 3.32Å; T48-V51 WeakPolarHBondContact OG1-CG2 3.32Å; V51-L54 PolarHBondContact O-N 3.31Å; V51-K55 WeakPolarHBondContact O-CG 3.41Å; V51-K55 PolarHBondContact O-N 3.08Å
52	L	82.3	Confident	74.6	Confident	73 Å²	73	114.9 Å²	114.9	38%	0.382	57%	0.57	S	S	.	*	H	α-helix	trans	-61.9	-45.1	175.5	-67.5	176	0	0	0	111.8	H47 T48 Q49 R50 K55 R56	H47-L52 HydrophobicContact CB-CD1 4.47Å; H47-L52 HydrophobicContact CB-CD2 3.54Å; H47-L52 HydrophobicContact CB-CG 3.67Å; T48-L52 PolarHBondContact O-N 3.37Å; Q49-L52 PolarHBondContact O-N 3.34Å; R50-L52 VanDerWaalsContact C-N 3.34Å; L52-K55 PolarHBondContact O-N 2.99Å; L52-R56 WeakPolarHBondContact O-CG 3.42Å; L52-R56 PolarHBondContact O-N 3.36Å
53	Y	84.4	Confident	74.6	Confident	145 Å²	145	115.3 Å²	115.3	57%	0.569	57%	0.567	S	S	*	*	H	α-helix	trans	-58.7	-48.7	176.9	175.1	-100.1	0	0	0	111.8	Q49 R50 K55 R56 L57	Q49-Y53 WeakPolarHBondContact O-CB 3.47Å; Q49-Y53 PolarHBondContact O-N 3.23Å; R50-Y53 PolarHBondContact O-N 2.99Å; Y53-K55 PolarHBondContact O-N 3.09Å; Y53-R56 PolarHBondContact O-N 3.22Å; Y53-L57 HydrophobicContact CD1-CD1 4Å; Y53-L57 HydrophobicContact CE1-CD1 3.36Å; Y53-L57 HydrophobicContact CE1-CG 4.17Å; Y53-L57 HydrophobicContact CE2-CD1 4.47Å; Y53-L57 PolarHBondContact O-N 3.04Å; Y53-L57 VanDerWaalsContact O-N 3.08Å
54	L	83.1	Confident	74.5	Confident	88 Å²	88	122.5 Å²	122.5	46%	0.461	58%	0.58	S	S	.	*	H	α-helix	trans	-60.9	-43.1	177.8	-68.8	173.3	0	0	0	112.4	R50 V51 R56 L57 V58	R50-L54 HydrophobicContact CG-CD1 4.41Å; R50-L54 WeakPolarHBondContact O-CG 3.26Å; R50-L54 PolarHBondContact O-N 3.28Å; V51-L54 PolarHBondContact O-N 3.31Å; L54-R56 VanDerWaalsContact C-N 3.35Å; L54-R56 PolarHBondContact O-N 3.06Å; L54-L57 PolarHBondContact O-N 3.01Å; L54-V58 WeakPolarHBondContact O-CG2 3.48Å; L54-V58 PolarHBondContact O-N 3.41Å; L54-V58 VanDerWaalsContact O-N 3.12Å
55	K	80.8	Confident	74.5	Confident	98 Å²	98	121.8 Å²	121.8	43%	0.426	59%	0.587	S	S	.	*	H	α-helix	trans	-61.4	-40.9	175.9	-77.6	-174.8	174	-167.9	0	112.5	H47 V51 L52 Y53 L57 V58 L59	H47-K55 PolarHBondContact CE1-NZ 2.96Å; H47-K55 PolarHBondContact NE2-NZ 3.47Å; V51-K55 WeakPolarHBondContact O-CG 3.41Å; V51-K55 PolarHBondContact O-N 3.08Å; L52-K55 PolarHBondContact O-N 2.99Å; Y53-K55 PolarHBondContact O-N 3.09Å; K55-L57 VanDerWaalsContact C-N 3.34Å; K55-V58 PolarHBondContact O-N 2.95Å; K55-L59 WeakPolarHBondContact O-CG 3.29Å; K55-L59 PolarHBondContact O-N 2.8Å; K55-L59 VanDerWaalsContact O-N 3.13Å
56	R	81	Confident	74	Confident	188 Å²	188	125.9 Å²	125.9	71%	0.709	61%	0.605	S	S	*	*	H	α-helix	trans	-62.4	-39.8	175.5	-74.3	-177.1	-167.3	-176.8	3.8	112	L52 Y53 L54 K60	L52-R56 WeakPolarHBondContact O-CG 3.42Å; L52-R56 PolarHBondContact O-N 3.36Å; Y53-R56 PolarHBondContact O-N 3.22Å; L54-R56 VanDerWaalsContact C-N 3.35Å; L54-R56 PolarHBondContact O-N 3.06Å; R56-K60 PolarHBondContact O-N 3.1Å
57	L	78.3	Confident	73.8	Confident	72 Å²	72	125.3 Å²	125.3	38%	0.377	60%	0.602	S	S	.	*	H	α-helix	trans	-64.2	-44.7	177.2	-72.7	178	0	0	0	112.5	Y53 L54 K55 L59 K60 L61	Y53-L57 HydrophobicContact CD1-CD1 4Å; Y53-L57 HydrophobicContact CE1-CD1 3.36Å; Y53-L57 HydrophobicContact CE1-CG 4.17Å; Y53-L57 HydrophobicContact CE2-CD1 4.47Å; Y53-L57 PolarHBondContact O-N 3.04Å; Y53-L57 VanDerWaalsContact O-N 3.08Å; L54-L57 PolarHBondContact O-N 3.01Å; K55-L57 VanDerWaalsContact C-N 3.34Å; L57-L59 PolarHBondContact O-N 3.27Å; L57-K60 WeakPolarHBondContact O-CB 3.46Å; L57-K60 PolarHBondContact O-N 2.91Å; L57-L61 PolarHBondContact O-N 3.46Å
58	V	78.4	Confident	73.3	Confident	85 Å²	85	131.7 Å²	131.7	52%	0.515	63%	0.629	S	S	.	*	H	α-helix	trans	-63.2	-41.6	178.6	176	0	0	0	0	111.5	L54 K55 K60 L61 N62	L54-V58 WeakPolarHBondContact O-CG2 3.48Å; L54-V58 PolarHBondContact O-N 3.41Å; L54-V58 VanDerWaalsContact O-N 3.12Å; K55-V58 PolarHBondContact O-N 2.95Å; V58-K60 VanDerWaalsContact C-N 3.34Å; V58-K60 PolarHBondContact O-N 3.37Å; V58-L61 PolarHBondContact O-N 2.96Å; V58-N62 PolarHBondContact O-N 3.42Å; V58-N62 PolarHBondContact O-ND2 3.18Å
59	L	69.2	Low	72.6	Confident	108 Å²	108	132.9 Å²	132.9	57%	0.565	64%	0.636	S	S	*	*	H	α-helix	trans	-62.4	-41.6	175.4	-71.9	166.9	0	0	0	111.2	K55 L57 L61 N62 N63	K55-L59 WeakPolarHBondContact O-CG 3.29Å; K55-L59 PolarHBondContact O-N 2.8Å; K55-L59 VanDerWaalsContact O-N 3.13Å; L57-L59 PolarHBondContact O-N 3.27Å; L59-L61 VanDerWaalsContact C-N 3.26Å; L59-L61 PolarHBondContact O-N 3.06Å; L59-N62 PolarHBondContact O-N 3.17Å; L59-N62 VanDerWaalsContact O-N 3.15Å; L59-N63 PolarHBondContact O-N 2.84Å; L59-N63 VanDerWaalsContact O-N 3.13Å; L59-N63 PolarHBondContact O-ND2 3.37Å; L59-N63 PolarHBondContact O-OD1 3.15Å
60	K	68.3	Low	71.2	Confident	167 Å²	167	131.4 Å²	131.4	73%	0.726	63%	0.634	S	S	*	*	H	α-helix	trans	-60.3	-33.4	178.8	-164.3	176.3	-177.6	-176.4	0	113.1	R56 L57 V58	R56-K60 PolarHBondContact O-N 3.1Å; L57-K60 WeakPolarHBondContact O-CB 3.46Å; L57-K60 PolarHBondContact O-N 2.91Å; V58-K60 VanDerWaalsContact C-N 3.34Å; V58-K60 PolarHBondContact O-N 3.37Å
61	L	66.4	Low	70.1	Confident	151 Å²	151	131.8 Å²	131.8	79%	0.791	66%	0.657	S	S	*	*	H	α-helix	trans	-78.5	-25.5	178.5	-67.6	172.9	0	0	0	113.5	L57 V58 L59	L57-L61 PolarHBondContact O-N 3.46Å; V58-L61 PolarHBondContact O-N 2.96Å; L59-L61 VanDerWaalsContact C-N 3.26Å; L59-L61 PolarHBondContact O-N 3.06Å
62	N	63.5	Low	69.4	Low	120 Å²	120	135.6 Å²	135.6	64%	0.642	67%	0.673	S	S	*	*	H	α-helix	trans	-104.7	2.1	-174.2	-68.5	-34.4	0	0	0	114.1	V58 L59 R64	V58-N62 PolarHBondContact O-N 3.42Å; V58-N62 PolarHBondContact O-ND2 3.18Å; L59-N62 PolarHBondContact O-N 3.17Å; L59-N62 VanDerWaalsContact O-N 3.15Å; N62-R64 PolarHBondContact O-N 3.21Å
63	N	60.6	Low	68.7	Low	103 Å²	103	138.8 Å²	138.8	55%	0.551	69%	0.688	S	S	*	*			trans	-72.6	97	177.5	-75.1	-12.3	0	0	0	110.5	L59	L59-N63 PolarHBondContact O-N 2.84Å; L59-N63 VanDerWaalsContact O-N 3.13Å; L59-N63 PolarHBondContact O-ND2 3.37Å; L59-N63 PolarHBondContact O-OD1 3.15Å
64	R	63.5	Low	67.8	Low	246 Å²	246	138.5 Å²	138.5	93%	0.928	70%	0.695	S	S	*	*			trans	-85.5	4.6	162.1	-67.2	-172.6	-177.6	-179.6	0.9	113	N62	N62-R64 PolarHBondContact O-N 3.21Å
65	I	63.6	Low	66.9	Low	148 Å²	148	141.5 Å²	141.5	76%	0.759	71%	0.709	S	S	*	*	S	Bend	trans	-95.7	119.3	-175.1	-57.8	172.5	0	0	0	107.8
66	L	57.4	Low	66	Low	156 Å²	156	144.2 Å²	144.2	82%	0.817	73%	0.726	S	S	*	*	P	Polyproline II helix	trans	-53.3	137.3	173.2	-66.7	166.6	0	0	0	109.3	F68	L66-F68 PolarHBondContact O-N 3.26Å
67	P	61.8	Low	65	Low	108 Å²	108	141.3 Å²	141.3	70%	0.701	73%	0.727	S	S	*	*	P	Polyproline II helix	trans	-57.2	136.1	172.9	26.3	-32.1	0	0	0	108.3	V69	P67-V69 PolarHBondContact O-N 3.07Å
68	F	60.6	Low	64.1	Low	195 Å²	195	146.2 Å²	146.2	86%	0.855	75%	0.752	S	S	*	*			trans	-58.3	108.9	169.6	-154.1	-92.6	0	0	0	106.5	L66 N70	L66-F68 PolarHBondContact O-N 3.26Å; F68-N70 PolarHBondContact O-N 3.47Å; F68-N70 VanDerWaalsContact O-N 3.15Å
69	V	68	Low	63	Low	113 Å²	113	150.9 Å²	150.9	69%	0.685	77%	0.771	S	S	*	*			trans	-71.8	107.8	174.1	-171.5	0	0	0	0	105.1	P67 V71	P67-V69 PolarHBondContact O-N 3.07Å; V69-V71 VanDerWaalsContact C-N 3.35Å; V69-V71 HydrophobicContact CG1-CG2 4.16Å; V69-V71 PolarHBondContact O-N 2.86Å; V69-V71 VanDerWaalsContact O-N 3.11Å
70	N	54.8	Low	62.5	Low	146 Å²	146	154.5 Å²	154.5	78%	0.781	79%	0.788	S	S	*	*			trans	-69.2	102.4	159.5	-83.9	-6.1	0	0	0	105.9	F68	F68-N70 PolarHBondContact O-N 3.47Å; F68-N70 VanDerWaalsContact O-N 3.15Å
71	V	61.2	Low	61.9	Low	201 Å²	201	153.4 Å²	153.4	100%	1.218	79%	0.793	S	S	*	*			trans	-75.8	0	157.5	-179	0	0	0	0	107.8	V69	V69-V71 VanDerWaalsContact C-N 3.35Å; V69-V71 HydrophobicContact CG1-CG2 4.16Å; V69-V71 PolarHBondContact O-N 2.86Å; V69-V71 VanDerWaalsContact O-N 3.11Å

Retrieved 71 of 71 residues in 102.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).