A0A5K4FGJ0_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4FGJ0, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 85 aa.

						>A0A5K4FGJ0_SCHMA|A0A5K4FGJ0
MTKLIHIPIKFDKYDNMYTEFEKLDFYLIHNLTLIIKDDICATIIDFKRPTDVEIQTKSGYRNVTDTCGIWIKNPSKGLRSRRPE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	57	Low	72.2	Confident	244 Å²	244	128.9 Å²	128.9	100%	1.202	65%	0.648	S	S	*	*				0	114.8	0	-169	-178.9	-88.3	0	0	106.9
2	T	59	Low	72.6	Confident	145 Å²	145	122.6 Å²	122.6	89%	0.89	62%	0.618	S	S	*	*	P	Polyproline II helix	trans	-86.9	128	-177.9	-51.5	0	0	0	0	109.1
3	K	69.9	Low	73.1	Confident	176 Å²	176	126.4 Å²	126.4	77%	0.765	63%	0.628	S	S	*	*	P	Polyproline II helix	trans	-96.2	121.5	175.3	-170.7	178.8	179.7	-176.8	0	108.7	I5	K3-I5 HydrophobicContact CD-CD1 4.43Å; K3-I5 HydrophobicContact CD-CG1 4.25Å; K3-I5 HydrophobicContact CG-CG1 4.1Å
4	L	72.7	Confident	73.5	Confident	143 Å²	143	128.5 Å²	128.5	75%	0.749	63%	0.627	S	S	*	*	P	Polyproline II helix	trans	-77.3	123.3	168.7	-169.5	79.2	0	0	0	108.1
5	I	76.1	Confident	73.5	Confident	87 Å²	87	128.9 Å²	128.9	45%	0.446	63%	0.633	S	S	.	*			trans	-118.4	125.6	178.1	-56	176.3	0	0	0	107.5	K3 I7 F21	K3-I5 HydrophobicContact CD-CD1 4.43Å; K3-I5 HydrophobicContact CD-CG1 4.25Å; K3-I5 HydrophobicContact CG-CG1 4.1Å; I5-I7 HydrophobicContact CG2-CG1 4.06Å; I5-F21 HydrophobicContact CD1-CE2 4.15Å; I5-F21 HydrophobicContact CD1-CZ 4.12Å; I5-F21 HydrophobicContact CG2-CE2 4.12Å
6	H	75.5	Confident	73.6	Confident	166 Å²	166	125.1 Å²	125.1	77%	0.769	62%	0.616	S	S	*	*			trans	-93	122.5	171.3	-64.2	90.4	0	0	0	108.2
7	I	74.8	Confident	73.7	Confident	67 Å²	67	123.3 Å²	123.3	34%	0.344	61%	0.607	S	S	.	*			trans	-110.8	129.9	-179.6	-49.6	165.7	0	0	0	107.2	I5 T19 E20 F21	I5-I7 HydrophobicContact CG2-CG1 4.06Å; I7-T19 WeakPolarHBondContact CG2-OG1 3.47Å; I7-E20 VanDerWaalsContact CG2-O 3.26Å; I7-E20 WeakPolarHBondContact CG2-O 3.38Å; I7-F21 HydrophobicContact CD1-CB 3.92Å; I7-F21 HydrophobicContact CD1-CD2 3.63Å; I7-F21 HydrophobicContact CD1-CE2 4.36Å; I7-F21 HydrophobicContact CD1-CG 3.84Å; I7-F21 HydrophobicContact CG1-CD2 3.91Å; I7-F21 HydrophobicContact CG2-CB 4.35Å
8	P	76.6	Confident	74	Confident	87 Å²	87	119.3 Å²	119.3	57%	0.565	59%	0.585	S	S	*	*			trans	-66.5	143.6	-179.2	27.4	-35	0	0	0	111.5	T19	P8-T19 PolarHBondContact O-OG1 2.86Å
9	I	77.1	Confident	74.3	Confident	105 Å²	105	114.8 Å²	114.8	54%	0.538	57%	0.565	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-88.4	137.1	169.8	-63.2	172.1	0	0	0	108.4	F11 M17	I9-F11 HydrophobicContact CG2-CE2 3.94Å; I9-F11 HydrophobicContact CG2-CZ 4.13Å; I9-M17 HydrophobicContact CD1-SD 4.21Å; I9-M17 HydrophobicContact CG2-CG 3.28Å; I9-M17 HydrophobicContact CG2-SD 3.72Å
10	K	79.3	Confident	74.3	Confident	72 Å²	72	113 Å²	113	31%	0.313	56%	0.555	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-122.9	160.9	176.7	-60.5	177.2	-177	178.2	0	109.3	M17 Y18 E20	K10-M17 WeakPolarHBondContact O-CA 3.38Å; K10-Y18 HydrophobicContact CB-CD1 3.9Å; K10-Y18 HydrophobicContact CB-CD2 4.18Å; K10-Y18 HydrophobicContact CB-CE1 3.51Å; K10-Y18 HydrophobicContact CB-CE2 3.83Å; K10-Y18 HydrophobicContact CB-CG 4.2Å; K10-Y18 VanDerWaalsContact CB-CZ 3.45Å; K10-Y18 HydrophobicContact CD-CD2 4.41Å; K10-Y18 HydrophobicContact CD-CE2 3.6Å; K10-Y18 HydrophobicContact CG-CE2 4.34Å; K10-Y18 PolarHBondContact N-O 3.23Å; K10-Y18 PolarHBondContact O-N 3.48Å; K10-E20 IonicContact NZ-OE2 2.66Å; K10-E20 PolarHBondContact NZ-OE2 3.04Å
11	F	76.2	Confident	74.5	Confident	126 Å²	126	110.6 Å²	110.6	55%	0.553	54%	0.542	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-126.1	138.4	174.5	-66.1	-92.1	0	0	0	109.1	I9 N16 M17	I9-F11 HydrophobicContact CG2-CE2 3.94Å; I9-F11 HydrophobicContact CG2-CZ 4.13Å; F11-N16 WeakPolarHBondContact CA-O 3.46Å; F11-M17 HydrophobicContact CD1-CB 4.24Å; F11-M17 HydrophobicContact CE1-CB 3.86Å; F11-M17 HydrophobicContact CE1-CG 4.11Å; F11-M17 HydrophobicContact CZ-CB 4.48Å; F11-M17 HydrophobicContact CZ-CG 4.23Å
12	D	76.9	Confident	75.6	Confident	53 Å²	53	106.4 Å²	106.4	28%	0.283	52%	0.519	S	S	.	.			trans	-81	180	173.4	76.8	4.7	0	0	0	111.2	Y14 D15 N16 Y18	D12-Y14 PolarHBondContact O-N 3.4Å; D12-Y14 VanDerWaalsContact O-N 3.07Å; D12-Y14 VanDerWaalsContact OD1-C 3.27Å; D12-Y14 VanDerWaalsContact OD1-CA 3.28Å; D12-Y14 WeakPolarHBondContact OD1-CA 3.34Å; D12-Y14 WeakPolarHBondContact OD1-CB 3.22Å; D12-Y14 PolarHBondContact OD1-N 2.81Å; D12-D15 PolarHBondContact O-N 3.22Å; D12-D15 VanDerWaalsContact O-N 3.09Å; D12-D15 PolarHBondContact OD1-N 2.94Å; D12-N16 PolarHBondContact N-O 3.23Å; D12-N16 WeakPolarHBondContact OD1-CB 3.39Å; D12-N16 PolarHBondContact OD1-N 3.38Å; D12-N16 PolarHBondContact OD1-ND2 2.67Å; D12-N16 PolarHBondContact OD2-ND2 3.33Å; D12-Y18 HydrophobicContact CB-CD1 4.48Å; D12-Y18 HydrophobicContact CB-CE1 4.25Å
13	K	78.7	Confident	76.4	Confident	172 Å²	172	107.2 Å²	107.2	75%	0.748	51%	0.51	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.4	-5.6	179	67.1	179.8	-177.8	170.5	0	114.6
14	Y	78.6	Confident	76.8	Confident	156 Å²	156	101.5 Å²	101.5	61%	0.612	49%	0.488	S	S	*	.	T	Hydrogen-bonded Turn	trans	-112	16	177.7	-55.1	-70.2	0	0	0	111.3	D12 N16	D12-Y14 PolarHBondContact O-N 3.4Å; D12-Y14 VanDerWaalsContact O-N 3.07Å; D12-Y14 VanDerWaalsContact OD1-C 3.27Å; D12-Y14 VanDerWaalsContact OD1-CA 3.28Å; D12-Y14 WeakPolarHBondContact OD1-CA 3.34Å; D12-Y14 WeakPolarHBondContact OD1-CB 3.22Å; D12-Y14 PolarHBondContact OD1-N 2.81Å; Y14-N16 WeakPolarHBondContact CB-ND2 3.43Å; Y14-N16 PolarHBondContact O-N 3Å
15	D	74.3	Confident	77	Confident	135 Å²	135	96.1 Å²	96.1	72%	0.722	46%	0.46	S	S	*	.			trans	60.1	20.3	-176.8	-60.4	-42.2	0	0	0	114.6	D12	D12-D15 PolarHBondContact O-N 3.22Å; D12-D15 VanDerWaalsContact O-N 3.09Å; D12-D15 PolarHBondContact OD1-N 2.94Å
16	N	74.5	Confident	77.1	Confident	68 Å²	68	94.5 Å²	94.5	36%	0.364	45%	0.45	S	S	.	.			trans	-78.7	129.3	172.5	-58.9	-61.5	0	0	0	110.2	F11 D12 Y14	F11-N16 WeakPolarHBondContact CA-O 3.46Å; D12-N16 PolarHBondContact N-O 3.23Å; D12-N16 WeakPolarHBondContact OD1-CB 3.39Å; D12-N16 PolarHBondContact OD1-N 3.38Å; D12-N16 PolarHBondContact OD1-ND2 2.67Å; D12-N16 PolarHBondContact OD2-ND2 3.33Å; Y14-N16 WeakPolarHBondContact CB-ND2 3.43Å; Y14-N16 PolarHBondContact O-N 3Å
17	M	74.9	Confident	77.4	Confident	94 Å²	94	89 Å²	89	46%	0.463	42%	0.423	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.6	136.3	178.7	-169.6	-173.8	72	0	0	111.5	I9 K10 F11	I9-M17 HydrophobicContact CD1-SD 4.21Å; I9-M17 HydrophobicContact CG2-CG 3.28Å; I9-M17 HydrophobicContact CG2-SD 3.72Å; K10-M17 WeakPolarHBondContact O-CA 3.38Å; F11-M17 HydrophobicContact CD1-CB 4.24Å; F11-M17 HydrophobicContact CE1-CB 3.86Å; F11-M17 HydrophobicContact CE1-CG 4.11Å; F11-M17 HydrophobicContact CZ-CB 4.48Å; F11-M17 HydrophobicContact CZ-CG 4.23Å
18	Y	80.4	Confident	77.3	Confident	51 Å²	51	90.8 Å²	90.8	20%	0.2	43%	0.432	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.7	164.5	172.2	74.7	-82.7	0	0	0	112.9	K10 D12 F26 Y27	K10-Y18 HydrophobicContact CB-CD1 3.9Å; K10-Y18 HydrophobicContact CB-CD2 4.18Å; K10-Y18 HydrophobicContact CB-CE1 3.51Å; K10-Y18 HydrophobicContact CB-CE2 3.83Å; K10-Y18 HydrophobicContact CB-CG 4.2Å; K10-Y18 VanDerWaalsContact CB-CZ 3.45Å; K10-Y18 HydrophobicContact CD-CD2 4.41Å; K10-Y18 HydrophobicContact CD-CE2 3.6Å; K10-Y18 HydrophobicContact CG-CE2 4.34Å; K10-Y18 PolarHBondContact N-O 3.23Å; K10-Y18 PolarHBondContact O-N 3.48Å; D12-Y18 HydrophobicContact CB-CD1 4.48Å; D12-Y18 HydrophobicContact CB-CE1 4.25Å; Y18-F26 VanDerWaalsContact CA-O 3.3Å; Y18-F26 WeakPolarHBondContact CA-O 3.28Å; Y18-F26 WeakPolarHBondContact CB-O 3.39Å; Y18-Y27 HydrophobicContact CD1-CD1 4.41Å; Y18-Y27 AromaticContact CD1-CE1 3.99Å; Y18-Y27 HydrophobicContact CD1-CE1 3.99Å; Y18-Y27 HydrophobicContact CD2-CD1 4.44Å; Y18-Y27 AromaticContact CD2-CE1 3.67Å; Y18-Y27 HydrophobicContact CD2-CE1 3.67Å; Y18-Y27 AromaticContact CG-CD1 3.8Å; Y18-Y27 HydrophobicContact CG-CD1 3.8Å; Y18-Y27 AromaticContact CG-CE1 3.38Å; Y18-Y27 HydrophobicContact CG-CE1 3.38Å
19	T	78.8	Confident	77	Confident	34 Å²	34	90.6 Å²	90.6	21%	0.209	43%	0.426	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.9	153.4	172.9	-166.7	0	0	0	0	110	I7 P8 F26	I7-T19 WeakPolarHBondContact CG2-OG1 3.47Å; P8-T19 PolarHBondContact O-OG1 2.86Å; T19-F26 HydrophobicContact CG2-CB 3.87Å; T19-F26 HydrophobicContact CG2-CD2 4.3Å; T19-F26 HydrophobicContact CG2-CG 4.46Å; T19-F26 PolarHBondContact N-O 2.87Å; T19-F26 PolarHBondContact O-N 3.22Å
20	E	75.5	Confident	76.4	Confident	79 Å²	79	93.7 Å²	93.7	37%	0.369	44%	0.437	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.6	125.6	-178	-174.6	-169.5	159.4	0	0	108.7	I7 K10 L24	I7-E20 VanDerWaalsContact CG2-O 3.26Å; I7-E20 WeakPolarHBondContact CG2-O 3.38Å; K10-E20 IonicContact NZ-OE2 2.66Å; K10-E20 PolarHBondContact NZ-OE2 3.04Å; E20-L24 CarbonylContact C-O 3.55Å; E20-L24 VanDerWaalsContact CA-O 3.29Å; E20-L24 WeakPolarHBondContact CA-O 3.24Å
21	F	76.7	Confident	75.9	Confident	62 Å²	62	96.1 Å²	96.1	27%	0.272	45%	0.454	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.4	125.7	177.5	-177.6	-103.4	0	0	0	109.6	I5 I7 K23 L24 F26	I5-F21 HydrophobicContact CD1-CE2 4.15Å; I5-F21 HydrophobicContact CD1-CZ 4.12Å; I5-F21 HydrophobicContact CG2-CE2 4.12Å; I7-F21 HydrophobicContact CD1-CB 3.92Å; I7-F21 HydrophobicContact CD1-CD2 3.63Å; I7-F21 HydrophobicContact CD1-CE2 4.36Å; I7-F21 HydrophobicContact CD1-CG 3.84Å; I7-F21 HydrophobicContact CG1-CD2 3.91Å; I7-F21 HydrophobicContact CG2-CB 4.35Å; F21-K23 PolarHBondContact O-N 3.36Å; F21-L24 PolarHBondContact N-O 2.93Å; F21-L24 WeakPolarHBondContact O-CB 3.22Å; F21-L24 PolarHBondContact O-N 2.9Å; F21-F26 HydrophobicContact CB-CD2 4.5Å; F21-F26 HydrophobicContact CB-CE2 3.89Å
22	E	80.8	Confident	75.8	Confident	156 Å²	156	93.6 Å²	93.6	73%	0.729	45%	0.446	S	S	*	.	T	Hydrogen-bonded Turn	trans	53.9	36.4	-178.8	-62.4	-177.6	167.7	0	0	114	L24	E22-L24 PolarHBondContact O-N 3.36Å
23	K	75.9	Confident	75.9	Confident	162 Å²	162	92.6 Å²	92.6	70%	0.704	44%	0.442	S	S	*	.	T	Hydrogen-bonded Turn	trans	67.2	13.1	-175.8	-47.1	176.2	179.3	179.9	0	114.8	F21	F21-K23 PolarHBondContact O-N 3.36Å
24	L	77.9	Confident	76.1	Confident	56 Å²	56	86.2 Å²	86.2	29%	0.293	42%	0.416	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.8	126	168	-58.4	178.7	0	0	0	108.4	E20 F21 E22 F26 I36 K37 D38	E20-L24 CarbonylContact C-O 3.55Å; E20-L24 VanDerWaalsContact CA-O 3.29Å; E20-L24 WeakPolarHBondContact CA-O 3.24Å; F21-L24 PolarHBondContact N-O 2.93Å; F21-L24 WeakPolarHBondContact O-CB 3.22Å; F21-L24 PolarHBondContact O-N 2.9Å; E22-L24 PolarHBondContact O-N 3.36Å; L24-F26 HydrophobicContact CB-CD2 4.43Å; L24-F26 HydrophobicContact CB-CE2 3.56Å; L24-F26 HydrophobicContact CB-CZ 3.69Å; L24-F26 HydrophobicContact CD1-CZ 4.07Å; L24-F26 VanDerWaalsContact O-CD2 3.31Å; L24-F26 WeakPolarHBondContact O-CD2 3.27Å; L24-F26 VanDerWaalsContact O-CE2 3.25Å; L24-F26 WeakPolarHBondContact O-CE2 3.38Å; L24-I36 HydrophobicContact CB-CG2 4.35Å; L24-I36 HydrophobicContact CD1-CG2 4.28Å; L24-K37 CarbonylContact C-O 3.5Å; L24-K37 WeakPolarHBondContact CA-O 3.49Å; L24-D38 HydrophobicContact CD2-CB 3.67Å
25	D	77.7	Confident	76.2	Confident	30 Å²	30	80.3 Å²	80.3	16%	0.16	39%	0.394	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.4	132.8	170	-64.3	-47.7	0	0	0	110.1	Y27 I36 K37	D25-Y27 HydrophobicContact CB-CD2 4.24Å; D25-Y27 HydrophobicContact CB-CE1 4.46Å; D25-Y27 HydrophobicContact CB-CE2 3.23Å; D25-Y27 WeakPolarHBondContact CB-OH 3.49Å; D25-Y27 PolarHBondContact OD2-OH 2.87Å; D25-I36 CarbonylContact O-C 3.57Å; D25-I36 WeakPolarHBondContact O-CA 3.44Å; D25-K37 HydrophobicContact CB-CB 4.49Å; D25-K37 PolarHBondContact N-O 3.19Å; D25-K37 PolarHBondContact O-N 2.7Å
26	F	78.4	Confident	76.6	Confident	53 Å²	53	75.8 Å²	75.8	23%	0.232	37%	0.369	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.8	122.2	177.7	-57.6	-94	0	0	0	109.7	Y18 T19 F21 L24 I35 I36	Y18-F26 VanDerWaalsContact CA-O 3.3Å; Y18-F26 WeakPolarHBondContact CA-O 3.28Å; Y18-F26 WeakPolarHBondContact CB-O 3.39Å; T19-F26 HydrophobicContact CG2-CB 3.87Å; T19-F26 HydrophobicContact CG2-CD2 4.3Å; T19-F26 HydrophobicContact CG2-CG 4.46Å; T19-F26 PolarHBondContact N-O 2.87Å; T19-F26 PolarHBondContact O-N 3.22Å; F21-F26 HydrophobicContact CB-CD2 4.5Å; F21-F26 HydrophobicContact CB-CE2 3.89Å; L24-F26 HydrophobicContact CB-CD2 4.43Å; L24-F26 HydrophobicContact CB-CE2 3.56Å; L24-F26 HydrophobicContact CB-CZ 3.69Å; L24-F26 HydrophobicContact CD1-CZ 4.07Å; L24-F26 VanDerWaalsContact O-CD2 3.31Å; L24-F26 WeakPolarHBondContact O-CD2 3.27Å; L24-F26 VanDerWaalsContact O-CE2 3.25Å; L24-F26 WeakPolarHBondContact O-CE2 3.38Å; F26-I35 WeakPolarHBondContact CA-O 3.16Å; F26-I36 HydrophobicContact CD1-CG1 3.93Å; F26-I36 HydrophobicContact CD1-CG2 4.31Å; F26-I36 HydrophobicContact CE1-CB 4.44Å; F26-I36 HydrophobicContact CE1-CD1 4.21Å; F26-I36 HydrophobicContact CE1-CG1 3.96Å; F26-I36 HydrophobicContact CE1-CG2 3.84Å; F26-I36 HydrophobicContact CZ-CG2 4.31Å
27	Y	80.5	Confident	76.9	Confident	52 Å²	52	74.7 Å²	74.7	20%	0.204	36%	0.362	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.1	138.6	179	-43.2	-101.8	0	0	0	109.8	Y18 D25 L34 I35 K37	Y18-Y27 HydrophobicContact CD1-CD1 4.41Å; Y18-Y27 AromaticContact CD1-CE1 3.99Å; Y18-Y27 HydrophobicContact CD1-CE1 3.99Å; Y18-Y27 HydrophobicContact CD2-CD1 4.44Å; Y18-Y27 AromaticContact CD2-CE1 3.67Å; Y18-Y27 HydrophobicContact CD2-CE1 3.67Å; Y18-Y27 AromaticContact CG-CD1 3.8Å; Y18-Y27 HydrophobicContact CG-CD1 3.8Å; Y18-Y27 AromaticContact CG-CE1 3.38Å; Y18-Y27 HydrophobicContact CG-CE1 3.38Å; D25-Y27 HydrophobicContact CB-CD2 4.24Å; D25-Y27 HydrophobicContact CB-CE1 4.46Å; D25-Y27 HydrophobicContact CB-CE2 3.23Å; D25-Y27 WeakPolarHBondContact CB-OH 3.49Å; D25-Y27 PolarHBondContact OD2-OH 2.87Å; Y27-L34 WeakPolarHBondContact O-CA 3.2Å; Y27-I35 HydrophobicContact CD2-CB 4.22Å; Y27-I35 HydrophobicContact CD2-CG2 4.37Å; Y27-I35 PolarHBondContact N-O 2.83Å; Y27-I35 PolarHBondContact O-N 3.48Å; Y27-K37 HydrophobicContact CE2-CB 4.42Å
28	L	73.3	Confident	77.2	Confident	104 Å²	104	73 Å²	73	55%	0.545	35%	0.354	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.5	113.7	169.5	-169	74.8	0	0	0	108.8
29	I	71.1	Confident	77	Confident	83 Å²	83	76.8 Å²	76.8	43%	0.426	38%	0.378	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.9	160.4	175.9	-56.3	-180	0	0	0	109.1	N31 L32 T33 I35	I29-N31 PolarHBondContact O-N 2.98Å; I29-L32 PolarHBondContact O-N 3.44Å; I29-T33 PolarHBondContact N-O 3.37Å; I29-T33 VanDerWaalsContact N-O 3.08Å; I29-I35 HydrophobicContact CD1-CD1 3.46Å; I29-I35 VanDerWaalsContact CD1-CD1 3.46Å; I29-I35 HydrophobicContact CD1-CG1 4.24Å; I29-I35 HydrophobicContact CG1-CD1 4.39Å
30	H	63.8	Low	76.9	Confident	169 Å²	169	78.2 Å²	78.2	78%	0.782	38%	0.384	S	S	*	.	T	Hydrogen-bonded Turn	trans	-45.8	-9	-174.9	-65.7	-47.6	0	0	0	118.2
31	N	68.6	Low	77	Confident	124 Å²	124	75.8 Å²	75.8	66%	0.663	38%	0.375	S	S	*	.	T	Hydrogen-bonded Turn	trans	-124.5	37.3	-173.7	-66.1	-29.1	0	0	0	113.7	I29 T33	I29-N31 PolarHBondContact O-N 2.98Å; N31-T33 PolarHBondContact O-N 3.34Å; N31-T33 PolarHBondContact O-OG1 3.24Å
32	L	73.7	Confident	77.3	Confident	72 Å²	72	73.6 Å²	73.6	38%	0.377	37%	0.368	S	S	.	.	T	Hydrogen-bonded Turn	trans	56.8	33.5	-178.4	-54	166.6	0	0	0	111.5	I29 F47 R49	I29-L32 PolarHBondContact O-N 3.44Å; L32-F47 HydrophobicContact CB-CB 4.24Å; L32-F47 WeakPolarHBondContact CB-O 3.12Å; L32-F47 CarbonylContact O-C 3.58Å; L32-F47 WeakPolarHBondContact O-CA 3.4Å; L32-F47 WeakPolarHBondContact O-CB 3.18Å; L32-F47 PolarHBondContact O-N 2.81Å; L32-R49 HydrophobicContact CD1-CG 4.01Å
33	T	78.8	Confident	77.3	Confident	33 Å²	33	68.1 Å²	68.1	20%	0.202	35%	0.346	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.9	118.1	176.9	-50.6	0	0	0	0	108.1	I29 N31 I44 I45	I29-T33 PolarHBondContact N-O 3.37Å; I29-T33 VanDerWaalsContact N-O 3.08Å; N31-T33 PolarHBondContact O-N 3.34Å; N31-T33 PolarHBondContact O-OG1 3.24Å; T33-I44 HydrophobicContact CG2-CG2 3.35Å; T33-I45 WeakPolarHBondContact CA-O 3.45Å
34	L	83.3	Confident	77.6	Confident	38 Å²	38	63 Å²	63	20%	0.199	33%	0.325	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.1	127.3	172.1	-178.6	68	0	0	0	108.3	Y27 I36 I45 F47	Y27-L34 WeakPolarHBondContact O-CA 3.2Å; L34-I36 HydrophobicContact CD2-CD1 4.14Å; L34-I36 HydrophobicContact CD2-CG1 4.04Å; L34-I36 HydrophobicContact CG-CG1 4.14Å; L34-I45 PolarHBondContact N-O 3.41Å; L34-I45 PolarHBondContact O-N 3.08Å; L34-F47 HydrophobicContact CB-CD2 3.5Å; L34-F47 VanDerWaalsContact CB-CD2 3.5Å; L34-F47 HydrophobicContact CB-CE2 3.4Å; L34-F47 HydrophobicContact CD2-CD2 4.39Å; L34-F47 HydrophobicContact CD2-CE2 3.49Å; L34-F47 VanDerWaalsContact CD2-CE2 3.49Å; L34-F47 HydrophobicContact CD2-CZ 3.93Å; L34-F47 HydrophobicContact CG-CE2 4.08Å
35	I	81.7	Confident	77.7	Confident	31 Å²	31	62 Å²	62	16%	0.159	32%	0.32	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.5	124.7	169	-55.9	-171.1	0	0	0	107.7	F26 Y27 I29 K37 A42 T43 I44	F26-I35 WeakPolarHBondContact CA-O 3.16Å; Y27-I35 HydrophobicContact CD2-CB 4.22Å; Y27-I35 HydrophobicContact CD2-CG2 4.37Å; Y27-I35 PolarHBondContact N-O 2.83Å; Y27-I35 PolarHBondContact O-N 3.48Å; I29-I35 HydrophobicContact CD1-CD1 3.46Å; I29-I35 VanDerWaalsContact CD1-CD1 3.46Å; I29-I35 HydrophobicContact CD1-CG1 4.24Å; I29-I35 HydrophobicContact CG1-CD1 4.39Å; I35-K37 HydrophobicContact CG2-CB 4.37Å; I35-A42 HydrophobicContact CG2-CB 4.46Å; I35-T43 WeakPolarHBondContact CA-O 3.27Å; I35-I44 HydrophobicContact CD1-CG1 4.32Å; I35-I44 HydrophobicContact CG1-CG1 4.15Å; I35-I44 HydrophobicContact CG1-CG2 4.25Å; I35-I44 HydrophobicContact CG2-CG1 4.35Å
36	I	83.3	Confident	77.8	Confident	40 Å²	40	63 Å²	63	21%	0.205	33%	0.325	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.8	121.2	170.8	-51.6	176.1	0	0	0	106.1	L24 D25 F26 L34 A42 T43 I45	L24-I36 HydrophobicContact CB-CG2 4.35Å; L24-I36 HydrophobicContact CD1-CG2 4.28Å; D25-I36 CarbonylContact O-C 3.57Å; D25-I36 WeakPolarHBondContact O-CA 3.44Å; F26-I36 HydrophobicContact CD1-CG1 3.93Å; F26-I36 HydrophobicContact CD1-CG2 4.31Å; F26-I36 HydrophobicContact CE1-CB 4.44Å; F26-I36 HydrophobicContact CE1-CD1 4.21Å; F26-I36 HydrophobicContact CE1-CG1 3.96Å; F26-I36 HydrophobicContact CE1-CG2 3.84Å; F26-I36 HydrophobicContact CZ-CG2 4.31Å; L34-I36 HydrophobicContact CD2-CD1 4.14Å; L34-I36 HydrophobicContact CD2-CG1 4.04Å; L34-I36 HydrophobicContact CG-CG1 4.14Å; I36-A42 CarbonylContact O-C 3.57Å; I36-A42 WeakPolarHBondContact O-CA 3.48Å; I36-T43 PolarHBondContact N-O 2.83Å; I36-T43 PolarHBondContact O-N 2.9Å; I36-I45 HydrophobicContact CD1-CD1 3.99Å
37	K	79	Confident	77.8	Confident	46 Å²	46	65.7 Å²	65.7	20%	0.2	34%	0.337	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.2	134.6	-174.5	174.3	172.1	168.9	-65.7	0	111	L24 D25 Y27 I35 C41 A42	L24-K37 CarbonylContact C-O 3.5Å; L24-K37 WeakPolarHBondContact CA-O 3.49Å; D25-K37 HydrophobicContact CB-CB 4.49Å; D25-K37 PolarHBondContact N-O 3.19Å; D25-K37 PolarHBondContact O-N 2.7Å; Y27-K37 HydrophobicContact CE2-CB 4.42Å; I35-K37 HydrophobicContact CG2-CB 4.37Å; K37-C41 WeakPolarHBondContact CA-O 3.46Å; K37-A42 HydrophobicContact CB-CB 4.1Å; K37-A42 HydrophobicContact CD-CB 4.25Å; K37-A42 HydrophobicContact CG-CB 4.1Å
38	D	81	Confident	77.8	Confident	58 Å²	58	69.4 Å²	69.4	31%	0.31	35%	0.354	S	S	.	.			trans	-106.5	-164.5	164.2	71.3	25.2	0	0	0	110.4	L24 I40 C41	L24-D38 HydrophobicContact CD2-CB 3.67Å; D38-I40 PolarHBondContact O-N 2.72Å; D38-I40 WeakPolarHBondContact OD1-CA 3.4Å; D38-I40 PolarHBondContact OD1-N 3.35Å; D38-C41 PolarHBondContact N-O 2.91Å; D38-C41 PolarHBondContact OD1-N 2.8Å
39	D	76.3	Confident	78.1	Confident	130 Å²	130	74 Å²	74	70%	0.695	36%	0.364	S	S	*	.	S	Bend	trans	-68.1	-18.1	179.6	-73.5	-32.1	0	0	0	113.9
40	I	78.6	Confident	78.6	Confident	65 Å²	65	73.9 Å²	73.9	33%	0.333	37%	0.369	S	S	.	.	S	Bend	trans	-120.3	-45.8	-168.2	-54.5	172.5	0	0	0	111	D38 G69 W71	D38-I40 PolarHBondContact O-N 2.72Å; D38-I40 WeakPolarHBondContact OD1-CA 3.4Å; D38-I40 PolarHBondContact OD1-N 3.35Å; I40-G69 PolarHBondContact O-N 3.04Å; I40-W71 HydrophobicContact CD1-CZ2 3.69Å; I40-W71 HydrophobicContact CG1-CZ2 3.53Å
41	C	76.7	Confident	79.6	Confident	28 Å²	28	69.2 Å²	69.2	19%	0.189	35%	0.352	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.6	147.6	-168.2	-60.7	0	0	0	0	111.1	K37 D38 T67 C68	K37-C41 WeakPolarHBondContact CA-O 3.46Å; D38-C41 PolarHBondContact N-O 2.91Å; D38-C41 PolarHBondContact OD1-N 2.8Å; C41-T67 CarbonylContact C-O 3.54Å; C41-T67 VanDerWaalsContact CA-O 3.27Å; C41-T67 WeakPolarHBondContact CA-O 3.3Å; C41-C68 HydrophobicContact CB-CB 4.12Å; C41-C68 WeakPolarHBondContact CB-SG 3.45Å; C41-C68 WeakPolarHBondContact SG-CB 3.01Å; C41-C68 CovalentContact SG-SG 2.04Å; C41-C68 PolarHBondContact SG-SG 2.85Å
42	A	82.3	Confident	80.7	Confident	15 Å²	15	69.1 Å²	69.1	12%	0.124	35%	0.352	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128	121.6	167.3	0	0	0	0	0	108.9	I35 I36 K37 T67	I35-A42 HydrophobicContact CG2-CB 4.46Å; I36-A42 CarbonylContact O-C 3.57Å; I36-A42 WeakPolarHBondContact O-CA 3.48Å; K37-A42 HydrophobicContact CB-CB 4.1Å; K37-A42 HydrophobicContact CD-CB 4.25Å; K37-A42 HydrophobicContact CG-CB 4.1Å; A42-T67 PolarHBondContact N-O 2.97Å; A42-T67 PolarHBondContact O-N 2.79Å; A42-T67 PolarHBondContact O-OG1 2.78Å
43	T	81.3	Confident	81.5	Confident	41 Å²	41	70.3 Å²	70.3	25%	0.252	36%	0.362	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.7	122.8	172.5	-52.5	0	0	0	0	108.8	I35 I36 I45 V64 T65 D66	I35-T43 WeakPolarHBondContact CA-O 3.27Å; I36-T43 PolarHBondContact N-O 2.83Å; I36-T43 PolarHBondContact O-N 2.9Å; T43-I45 HydrophobicContact CG2-CD1 4.42Å; T43-I45 HydrophobicContact CG2-CG1 4.1Å; T43-V64 HydrophobicContact CG2-CG1 3.54Å; T43-T65 WeakPolarHBondContact CA-O 3.46Å; T43-D66 PolarHBondContact OG1-OD1 2.79Å; T43-D66 VanDerWaalsContact OG1-OD1 3.11Å
44	I	82.6	Confident	81.8	Confident	55 Å²	55	70.3 Å²	70.3	28%	0.282	36%	0.36	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.9	120	-177.1	-54.6	174.5	0	0	0	107.7	T33 I35 V64 T65	T33-I44 HydrophobicContact CG2-CG2 3.35Å; I35-I44 HydrophobicContact CD1-CG1 4.32Å; I35-I44 HydrophobicContact CG1-CG1 4.15Å; I35-I44 HydrophobicContact CG1-CG2 4.25Å; I35-I44 HydrophobicContact CG2-CG1 4.35Å; I44-V64 WeakPolarHBondContact O-CA 3.31Å; I44-T65 PolarHBondContact N-O 3.03Å; I44-T65 PolarHBondContact O-N 2.9Å
45	I	80.5	Confident	81.8	Confident	34 Å²	34	73.4 Å²	73.4	17%	0.174	38%	0.376	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.6	127.5	-175.7	-53.2	173.4	0	0	0	108.9	T33 L34 I36 T43 F47 V64	T33-I45 WeakPolarHBondContact CA-O 3.45Å; L34-I45 PolarHBondContact N-O 3.41Å; L34-I45 PolarHBondContact O-N 3.08Å; I36-I45 HydrophobicContact CD1-CD1 3.99Å; T43-I45 HydrophobicContact CG2-CD1 4.42Å; T43-I45 HydrophobicContact CG2-CG1 4.1Å; I45-F47 HydrophobicContact CB-CD2 4.15Å; I45-F47 HydrophobicContact CB-CE2 3.72Å; I45-F47 HydrophobicContact CD1-CE2 4.41Å; I45-F47 HydrophobicContact CG2-CD2 3.83Å; I45-F47 HydrophobicContact CG2-CE2 3.43Å; I45-F47 VanDerWaalsContact CG2-CE2 3.43Å; I45-F47 HydrophobicContact CG2-CZ 4.1Å; I45-V64 HydrophobicContact CG1-CG1 4.29Å; I45-V64 HydrophobicContact CG1-CG2 4.31Å; I45-V64 HydrophobicContact CG2-CG2 4.45Å
46	D	78.6	Confident	82.1	Confident	51 Å²	51	79.5 Å²	79.5	27%	0.273	40%	0.403	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78	119.2	170.1	-175	9.5	0	0	0	110.5	K48 R62 N63	D46-K48 VanDerWaalsContact OD1-CB 3.27Å; D46-K48 WeakPolarHBondContact OD1-CB 3.48Å; D46-K48 PolarHBondContact OD1-N 2.87Å; D46-R62 WeakPolarHBondContact O-CB 3.39Å; D46-R62 WeakPolarHBondContact O-CD 3.25Å; D46-R62 WeakPolarHBondContact O-CG 3.09Å; D46-N63 PolarHBondContact N-O 2.69Å
47	F	78.5	Confident	82.4	Confident	111 Å²	111	81.3 Å²	81.3	49%	0.487	42%	0.416	S	S	.	.			trans	-104.5	27.9	172.9	-77.9	-95	0	0	0	112.1	L32 L34 I45 R49	L32-F47 HydrophobicContact CB-CB 4.24Å; L32-F47 WeakPolarHBondContact CB-O 3.12Å; L32-F47 CarbonylContact O-C 3.58Å; L32-F47 WeakPolarHBondContact O-CA 3.4Å; L32-F47 WeakPolarHBondContact O-CB 3.18Å; L32-F47 PolarHBondContact O-N 2.81Å; L34-F47 HydrophobicContact CB-CD2 3.5Å; L34-F47 VanDerWaalsContact CB-CD2 3.5Å; L34-F47 HydrophobicContact CB-CE2 3.4Å; L34-F47 HydrophobicContact CD2-CD2 4.39Å; L34-F47 HydrophobicContact CD2-CE2 3.49Å; L34-F47 VanDerWaalsContact CD2-CE2 3.49Å; L34-F47 HydrophobicContact CD2-CZ 3.93Å; L34-F47 HydrophobicContact CG-CE2 4.08Å; I45-F47 HydrophobicContact CB-CD2 4.15Å; I45-F47 HydrophobicContact CB-CE2 3.72Å; I45-F47 HydrophobicContact CD1-CE2 4.41Å; I45-F47 HydrophobicContact CG2-CD2 3.83Å; I45-F47 HydrophobicContact CG2-CE2 3.43Å; I45-F47 VanDerWaalsContact CG2-CE2 3.43Å; I45-F47 HydrophobicContact CG2-CZ 4.1Å; F47-R49 PolarHBondContact O-N 3.11Å
48	K	80.9	Confident	82.7	Confident	130 Å²	130	88.4 Å²	88.4	57%	0.565	45%	0.447	S	S	*	.			trans	-44.5	136.5	169	-173.4	175.6	-179.4	-178.3	0	110.6	D46 R62	D46-K48 VanDerWaalsContact OD1-CB 3.27Å; D46-K48 WeakPolarHBondContact OD1-CB 3.48Å; D46-K48 PolarHBondContact OD1-N 2.87Å; K48-R62 PolarHBondContact O-NE 2.79Å; K48-R62 PolarHBondContact O-NH2 3.36Å
49	R	79.1	Confident	82.6	Confident	200 Å²	200	89.2 Å²	89.2	76%	0.755	46%	0.457	S	S	*	.	P	Polyproline II helix	trans	-52.1	139.9	179.8	-67.9	-175.4	-173.6	164.3	2.3	110.5	L32 F47	L32-R49 HydrophobicContact CD1-CG 4.01Å; F47-R49 PolarHBondContact O-N 3.11Å
50	P	82.1	Confident	82.9	Confident	80 Å²	80	85 Å²	85	52%	0.519	45%	0.445	S	S	.	.	P	Polyproline II helix	trans	-53.3	140.7	174.9	-26.6	35.4	0	0	0	112.4	E54 I55	P50-E54 VanDerWaalsContact CA-OE2 3.28Å; P50-E54 WeakPolarHBondContact CA-OE2 3.39Å; P50-E54 HydrophobicContact CB-CB 4.31Å; P50-I55 HydrophobicContact CB-CD1 4.2Å; P50-I55 HydrophobicContact CB-CG1 3.75Å
51	T	85.5	Confident	83.1	Confident	71 Å²	71	92.1 Å²	92.1	44%	0.436	47%	0.469	S	S	.	.	P	Polyproline II helix	trans	-77.7	163	169.2	68.7	0	0	0	0	110.8	V53 E54 I55	T51-V53 PolarHBondContact O-N 2.99Å; T51-E54 PolarHBondContact N-OE2 3.22Å; T51-E54 WeakPolarHBondContact O-CB 3.37Å; T51-E54 PolarHBondContact O-N 2.96Å; T51-E54 WeakPolarHBondContact OG1-CG 3.45Å; T51-E54 PolarHBondContact OG1-N 3.23Å; T51-I55 WeakPolarHBondContact O-CG1 3.28Å; T51-I55 PolarHBondContact O-N 3.18Å
52	D	90.5	Very high	83.3	Confident	123 Å²	123	94.6 Å²	94.6	66%	0.658	47%	0.474	S	S	*	.	H	α-helix	trans	-56.8	-37	177.7	-63.6	-25.5	0	0	0	112.4	I55 Q56	D52-I55 PolarHBondContact O-N 3.25Å; D52-Q56 WeakPolarHBondContact O-CB 3.46Å; D52-Q56 VanDerWaalsContact O-CG 3.22Å; D52-Q56 WeakPolarHBondContact O-CG 3.36Å; D52-Q56 PolarHBondContact O-N 2.82Å
53	V	90.5	Very high	83.2	Confident	96 Å²	96	100.2 Å²	100.2	58%	0.582	50%	0.502	S	S	*	.	H	α-helix	trans	-65.8	-41.5	176.8	179.2	0	0	0	0	111.2	T51 I55 Q56 T57	T51-V53 PolarHBondContact O-N 2.99Å; V53-I55 VanDerWaalsContact C-N 3.33Å; V53-Q56 PolarHBondContact O-N 2.76Å; V53-T57 HydrophobicContact CG1-CG2 4.35Å; V53-T57 WeakPolarHBondContact O-CB 3.22Å; V53-T57 WeakPolarHBondContact O-CG2 3.05Å; V53-T57 PolarHBondContact O-N 2.84Å; V53-T57 PolarHBondContact O-OG1 3.05Å
54	E	86.8	Confident	83	Confident	33 Å²	33	102.3 Å²	102.3	15%	0.154	52%	0.515	C	S	.	.	H	α-helix	trans	-65.8	-39.1	177.3	-68	177.5	133.9	0	0	111.5	P50 T51 K58 S59 R62	P50-E54 VanDerWaalsContact CA-OE2 3.28Å; P50-E54 WeakPolarHBondContact CA-OE2 3.39Å; P50-E54 HydrophobicContact CB-CB 4.31Å; T51-E54 PolarHBondContact N-OE2 3.22Å; T51-E54 WeakPolarHBondContact O-CB 3.37Å; T51-E54 PolarHBondContact O-N 2.96Å; T51-E54 WeakPolarHBondContact OG1-CG 3.45Å; T51-E54 PolarHBondContact OG1-N 3.23Å; E54-K58 VanDerWaalsContact O-CA 3.24Å; E54-K58 WeakPolarHBondContact O-CA 3.36Å; E54-K58 PolarHBondContact O-N 3.43Å; E54-S59 WeakPolarHBondContact CA-O 3.07Å; E54-S59 WeakPolarHBondContact CB-O 3.39Å; E54-S59 WeakPolarHBondContact CG-O 3.48Å; E54-S59 PolarHBondContact O-N 3.07Å; E54-R62 VanDerWaalsContact CD-NH1 3.34Å; E54-R62 IonicContact OE1-CZ 2.67Å; E54-R62 IonicContact OE1-NH1 3.22Å; E54-R62 PolarHBondContact OE1-NH1 2.89Å; E54-R62 IonicContact OE1-NH2 2.93Å; E54-R62 IonicContact OE2-CZ 3.55Å; E54-R62 IonicContact OE2-NH1 3.7Å; E54-R62 PolarHBondContact OE2-NH1 2.04Å; E54-R62 IonicContact OE2-NH2 3.56Å; E54-R62 PolarHBondContact OE2-NH2 2.89Å
55	I	81.3	Confident	82.9	Confident	104 Å²	104	103.4 Å²	103.4	53%	0.533	52%	0.524	S	S	.	.	H	α-helix	trans	-65	-46.6	176.1	-65.4	168	0	0	0	110.4	P50 T51 D52 V53 K58	P50-I55 HydrophobicContact CB-CD1 4.2Å; P50-I55 HydrophobicContact CB-CG1 3.75Å; T51-I55 WeakPolarHBondContact O-CG1 3.28Å; T51-I55 PolarHBondContact O-N 3.18Å; D52-I55 PolarHBondContact O-N 3.25Å; V53-I55 VanDerWaalsContact C-N 3.33Å; I55-K58 PolarHBondContact O-N 3.09Å
56	Q	88.7	Confident	82.9	Confident	158 Å²	158	106.5 Å²	106.5	74%	0.738	54%	0.541	S	S	*	.	H	α-helix	trans	-63.9	-44	-179.5	-75.5	174.5	14	0	0	112.2	D52 V53 K58	D52-Q56 WeakPolarHBondContact O-CB 3.46Å; D52-Q56 VanDerWaalsContact O-CG 3.22Å; D52-Q56 WeakPolarHBondContact O-CG 3.36Å; D52-Q56 PolarHBondContact O-N 2.82Å; V53-Q56 PolarHBondContact O-N 2.76Å; Q56-K58 VanDerWaalsContact C-N 3.33Å
57	T	89.9	Confident	82.8	Confident	78 Å²	78	106.8 Å²	106.8	48%	0.479	55%	0.545	S	S	.	.	H	α-helix	trans	-82.7	-11.9	-179.7	61.2	0	0	0	0	113.3	V53 S59	V53-T57 HydrophobicContact CG1-CG2 4.35Å; V53-T57 WeakPolarHBondContact O-CB 3.22Å; V53-T57 WeakPolarHBondContact O-CG2 3.05Å; V53-T57 PolarHBondContact O-N 2.84Å; V53-T57 PolarHBondContact O-OG1 3.05Å; T57-S59 WeakPolarHBondContact CB-OG 3.37Å; T57-S59 PolarHBondContact O-N 3Å; T57-S59 PolarHBondContact OG1-N 3.36Å; T57-S59 PolarHBondContact OG1-O 3.25Å; T57-S59 PolarHBondContact OG1-OG 3.16Å
58	K	84.7	Confident	82.7	Confident	196 Å²	196	104.3 Å²	104.3	85%	0.852	54%	0.54	S	S	*	.	T	Hydrogen-bonded Turn	trans	52.4	33.6	-171.3	-56.7	-179.2	179.2	178.5	0	112.5	E54 I55 Q56	E54-K58 VanDerWaalsContact O-CA 3.24Å; E54-K58 WeakPolarHBondContact O-CA 3.36Å; E54-K58 PolarHBondContact O-N 3.43Å; I55-K58 PolarHBondContact O-N 3.09Å; Q56-K58 VanDerWaalsContact C-N 3.33Å
59	S	78.8	Confident	82	Confident	75 Å²	75	98.4 Å²	98.4	52%	0.524	52%	0.516	S	S	.	.			trans	-147.5	154.3	-176	74.4	0	0	0	0	110.3	E54 T57	E54-S59 WeakPolarHBondContact CA-O 3.07Å; E54-S59 WeakPolarHBondContact CB-O 3.39Å; E54-S59 WeakPolarHBondContact CG-O 3.48Å; E54-S59 PolarHBondContact O-N 3.07Å; T57-S59 WeakPolarHBondContact CB-OG 3.37Å; T57-S59 PolarHBondContact O-N 3Å; T57-S59 PolarHBondContact OG1-N 3.36Å; T57-S59 PolarHBondContact OG1-O 3.25Å; T57-S59 PolarHBondContact OG1-OG 3.16Å
60	G	83.6	Confident	81.2	Confident	42 Å²	42	95.3 Å²	95.3	43%	0.433	51%	0.514	S	S	.	.			trans	175	173	-179.2	0	0	0	0	0	111.4
61	Y	83.2	Confident	79.6	Confident	214 Å²	214	96.9 Å²	96.9	84%	0.839	51%	0.509	S	S	*	.			trans	-130.4	150.9	178.6	-61.7	-84	0	0	0	109.8
62	R	79.9	Confident	78	Confident	79 Å²	79	97.7 Å²	97.7	30%	0.298	51%	0.51	S	S	.	.			trans	-124.1	143.7	171.2	-66.3	-63.7	178.8	-110.3	2.3	108.7	D46 K48 E54 V64	D46-R62 WeakPolarHBondContact O-CB 3.39Å; D46-R62 WeakPolarHBondContact O-CD 3.25Å; D46-R62 WeakPolarHBondContact O-CG 3.09Å; K48-R62 PolarHBondContact O-NE 2.79Å; K48-R62 PolarHBondContact O-NH2 3.36Å; E54-R62 VanDerWaalsContact CD-NH1 3.34Å; E54-R62 IonicContact OE1-CZ 2.67Å; E54-R62 IonicContact OE1-NH1 3.22Å; E54-R62 PolarHBondContact OE1-NH1 2.89Å; E54-R62 IonicContact OE1-NH2 2.93Å; E54-R62 IonicContact OE2-CZ 3.55Å; E54-R62 IonicContact OE2-NH1 3.7Å; E54-R62 PolarHBondContact OE2-NH1 2.04Å; E54-R62 IonicContact OE2-NH2 3.56Å; E54-R62 PolarHBondContact OE2-NH2 2.89Å; R62-V64 PolarHBondContact O-N 3.33Å
63	N	79.5	Confident	75.6	Confident	134 Å²	134	99.7 Å²	99.7	72%	0.717	51%	0.513	S	S	*	.			trans	-72.2	127.8	173.6	-68.3	-25.7	0	0	0	108.1	D46	D46-N63 PolarHBondContact N-O 2.69Å
64	V	77.4	Confident	73.4	Confident	85 Å²	85	98.4 Å²	98.4	52%	0.515	50%	0.502	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.6	123.3	173.6	-178.9	0	0	0	0	106.8	T43 I44 I45 R62	T43-V64 HydrophobicContact CG2-CG1 3.54Å; I44-V64 WeakPolarHBondContact O-CA 3.31Å; I45-V64 HydrophobicContact CG1-CG1 4.29Å; I45-V64 HydrophobicContact CG1-CG2 4.31Å; I45-V64 HydrophobicContact CG2-CG2 4.45Å; R62-V64 PolarHBondContact O-N 3.33Å
65	T	81.4	Confident	71.7	Confident	78 Å²	78	103.1 Å²	103.1	48%	0.479	54%	0.536	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.3	120.9	172.2	-53.1	0	0	0	0	107.9	T43 I44 T67	T43-T65 WeakPolarHBondContact CA-O 3.46Å; I44-T65 PolarHBondContact N-O 3.03Å; I44-T65 PolarHBondContact O-N 2.9Å; T65-T67 HydrophobicContact CG2-CG2 4.1Å
66	D	79.2	Confident	70.6	Confident	99 Å²	99	102.7 Å²	102.7	53%	0.529	54%	0.542	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.3	127.1	175.8	-165.9	24.4	0	0	0	109.9	T43	T43-D66 PolarHBondContact OG1-OD1 2.79Å; T43-D66 VanDerWaalsContact OG1-OD1 3.11Å
67	T	77.3	Confident	68.9	Low	57 Å²	57	101.5 Å²	101.5	35%	0.35	54%	0.535	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.8	107.1	-176.2	55.3	0	0	0	0	109.9	C41 A42 T65	C41-T67 CarbonylContact C-O 3.54Å; C41-T67 VanDerWaalsContact CA-O 3.27Å; C41-T67 WeakPolarHBondContact CA-O 3.3Å; A42-T67 PolarHBondContact N-O 2.97Å; A42-T67 PolarHBondContact O-N 2.79Å; A42-T67 PolarHBondContact O-OG1 2.78Å; T65-T67 HydrophobicContact CG2-CG2 4.1Å
68	C	76.5	Confident	67	Low	58 Å²	58	99.7 Å²	99.7	39%	0.392	53%	0.531	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.9	132.3	176.6	-65.3	0	0	0	0	110.9	C41 I70	C41-C68 HydrophobicContact CB-CB 4.12Å; C41-C68 WeakPolarHBondContact CB-SG 3.45Å; C41-C68 WeakPolarHBondContact SG-CB 3.01Å; C41-C68 CovalentContact SG-SG 2.04Å; C41-C68 PolarHBondContact SG-SG 2.85Å; C68-I70 PolarHBondContact O-N 2.79Å
69	G	67	Low	65.2	Low	6 Å²	6	95.5 Å²	95.5	6%	0.062	52%	0.518	C	S	.	.			trans	-67.3	124.2	169.1	0	0	0	0	0	110.4	I40 W71 R82	I40-G69 PolarHBondContact O-N 3.04Å; G69-W71 PolarHBondContact O-N 3.34Å; G69-R82 WeakPolarHBondContact CA-O 3.35Å
70	I	60.4	Low	63.8	Low	136 Å²	136	99.3 Å²	99.3	70%	0.697	52%	0.521	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-72.2	122.4	170.5	-59	172	0	0	0	107.3	C68 I72 R82	C68-I70 PolarHBondContact O-N 2.79Å; I70-I72 PolarHBondContact O-N 3.17Å; I70-I72 VanDerWaalsContact O-N 3.16Å; I70-R82 PolarHBondContact O-N 3.37Å
71	W	50.2	Low	62.1	Low	113 Å²	113	100 Å²	100	43%	0.428	52%	0.519	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.4	111.3	172.3	-67.6	94.6	0	0	0	109.6	I40 G69 L79 R80 S81	I40-W71 HydrophobicContact CD1-CZ2 3.69Å; I40-W71 HydrophobicContact CG1-CZ2 3.53Å; G69-W71 PolarHBondContact O-N 3.34Å; W71-L79 HydrophobicContact CB-CD2 4.1Å; W71-L79 HydrophobicContact CD2-CB 4.5Å; W71-L79 HydrophobicContact CE3-CB 3.68Å; W71-L79 HydrophobicContact CZ3-CB 4.09Å; W71-R80 VanDerWaalsContact CE3-C 3.43Å; W71-S81 VanDerWaalsContact CE3-N 3.32Å
72	I	50.9	Low	60.5	Low	87 Å²	87	97.8 Å²	97.8	45%	0.446	51%	0.509	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.5	117.8	168.2	-56.9	-174	0	0	0	107.2	I70 N74 R80 R82	I70-I72 PolarHBondContact O-N 3.17Å; I70-I72 VanDerWaalsContact O-N 3.16Å; I72-N74 PolarHBondContact O-N 2.9Å; I72-R80 PolarHBondContact N-O 2.73Å; I72-R82 HydrophobicContact CD1-CB 4.42Å; I72-R82 HydrophobicContact CG1-CB 4.43Å
73	K	39.5	Very low	58.8	Low	166 Å²	166	102.8 Å²	102.8	72%	0.722	53%	0.528	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-68.5	101.6	170.7	-169.2	176.9	-178	179.2	0	108.2	P75 L79	K73-P75 WeakPolarHBondContact O-CD 3.29Å; K73-L79 HydrophobicContact CB-CD2 3.85Å; K73-L79 HydrophobicContact CG-CD2 4.21Å
74	N	44.2	Very low	57.1	Low	68 Å²	68	100.3 Å²	100.3	36%	0.364	52%	0.519	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.6	117	167.6	-173.8	-29.8	0	0	0	107.7	I72 S76 K77 G78	I72-N74 PolarHBondContact O-N 2.9Å; N74-S76 PolarHBondContact O-N 3.03Å; N74-S76 PolarHBondContact OD1-N 2.71Å; N74-S76 PolarHBondContact OD1-OG 3.05Å; N74-K77 HydrophobicContact CB-CB 4.36Å; N74-K77 PolarHBondContact O-N 3.2Å; N74-K77 VanDerWaalsContact O-N 3.13Å; N74-G78 PolarHBondContact N-O 2.93Å; N74-G78 VanDerWaalsContact N-O 3.17Å; N74-G78 PolarHBondContact O-N 2.66Å
75	P	52.8	Low	55.5	Low	133 Å²	133	108.6 Å²	108.6	86%	0.864	55%	0.552	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55.1	-29	-177.8	-23.1	31.7	0	0	0	113.4	K73	K73-P75 WeakPolarHBondContact O-CD 3.29Å
76	S	57.1	Low	54.2	Low	95 Å²	95	110.2 Å²	110.2	66%	0.664	56%	0.556	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.8	-17	-176.5	65.5	0	0	0	0	114.9	N74	N74-S76 PolarHBondContact O-N 3.03Å; N74-S76 PolarHBondContact OD1-N 2.71Å; N74-S76 PolarHBondContact OD1-OG 3.05Å
77	K	53.4	Low	52.9	Low	132 Å²	132	110.7 Å²	110.7	57%	0.574	56%	0.557	S	S	*	*	T	Hydrogen-bonded Turn	trans	-135.7	9.4	-169.7	-66.9	-171.9	-179	-179.4	0	114.9	N74	N74-K77 HydrophobicContact CB-CB 4.36Å; N74-K77 PolarHBondContact O-N 3.2Å; N74-K77 VanDerWaalsContact O-N 3.13Å
78	G	49.2	Very low	51.5	Low	40 Å²	40	113.7 Å²	113.7	41%	0.412	57%	0.569	S	S	.	*	E	Extended strand (participates in β ladder)	trans	75.7	-170.6	-177.6	0	0	0	0	0	113.4	N74 R80	N74-G78 PolarHBondContact N-O 2.93Å; N74-G78 VanDerWaalsContact N-O 3.17Å; N74-G78 PolarHBondContact O-N 2.66Å; G78-R80 PolarHBondContact O-N 3.13Å
79	L	48.3	Very low	50	Low	109 Å²	109	117 Å²	117	57%	0.571	58%	0.579	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-71.7	121	174.6	-69.6	164.3	0	0	0	108.6	W71 K73	W71-L79 HydrophobicContact CB-CD2 4.1Å; W71-L79 HydrophobicContact CD2-CB 4.5Å; W71-L79 HydrophobicContact CE3-CB 3.68Å; W71-L79 HydrophobicContact CZ3-CB 4.09Å; K73-L79 HydrophobicContact CB-CD2 3.85Å; K73-L79 HydrophobicContact CG-CD2 4.21Å
80	R	49.6	Very low	49	Very low	155 Å²	155	123.9 Å²	123.9	59%	0.585	61%	0.612	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-121.3	135.1	167.9	-68.1	-171.9	178.9	-162.1	-5.7	108.6	W71 I72 G78 R82	W71-R80 VanDerWaalsContact CE3-C 3.43Å; I72-R80 PolarHBondContact N-O 2.73Å; G78-R80 PolarHBondContact O-N 3.13Å; R80-R82 PolarHBondContact O-N 3.02Å
81	S	48.2	Very low	48.2	Very low	55 Å²	55	123.1 Å²	123.1	39%	0.385	61%	0.606	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-65.3	124.3	173.3	59.6	0	0	0	0	108.2	W71 R83	W71-S81 VanDerWaalsContact CE3-N 3.32Å; S81-R83 PolarHBondContact O-N 3.44Å
82	R	48.5	Very low	48.1	Very low	168 Å²	168	123.9 Å²	123.9	63%	0.634	62%	0.619	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-85	101.5	168.8	-165.7	-177.7	-165.8	-177.8	2.2	106.2	G69 I70 I72 R80 P84	G69-R82 WeakPolarHBondContact CA-O 3.35Å; I70-R82 PolarHBondContact O-N 3.37Å; I72-R82 HydrophobicContact CD1-CB 4.42Å; I72-R82 HydrophobicContact CG1-CB 4.43Å; R80-R82 PolarHBondContact O-N 3.02Å; R82-P84 WeakPolarHBondContact O-CD 3.26Å
83	R	44.2	Very low	47.9	Very low	185 Å²	185	126.7 Å²	126.7	70%	0.698	63%	0.632	S	S	*	*			trans	-57.4	124.7	169.1	-159.7	171.8	-168.8	138.6	-1.7	106.9	S81 E85	S81-R83 PolarHBondContact O-N 3.44Å; R83-E85 PolarHBondContact O-N 3.35Å
84	P	43.9	Very low	48.6	Very low	82 Å²	82	123.4 Å²	123.4	53%	0.532	62%	0.624	S	S	.	*			trans	-57.1	126	167	-17.4	30.1	0	0	0	107.1	R82	R82-P84 WeakPolarHBondContact O-CD 3.26Å
85	E	43.3	Very low	48.9	Very low	259 Å²	259	128.5 Å²	128.5	100%	1.21	65%	0.648	S	S	*	*			trans	-63.7	0	174.5	-70	179.1	-178.9	0	0	111.1	R83	R83-E85 PolarHBondContact O-N 3.35Å

Retrieved 85 of 85 residues in 24.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).