A0A671ESN2_RHIFE Loading...

Ubiquitin-ribosomal protein eS31 fusion protein

Component of the 40S subunit of the ribosome. Part of the small subunit (SSU) processome, first precursor of the small eukaryotic ribosomal subunit. During the assembly of the SSU processome in the nucleolus, many ribosome biogenesis factors, an RNA chaperone and ribosomal proteins associate with the nascent pre-rRNA and work in concert to generate RNA folding, modifications, rearrangements and cleavage as well as targeted degradation of pre-ribosomal RNA by the RNA exosome.

AlphaFold DB , UniProt , Accession A0A671ESN2, Species RHIFE (Rhinolophus ferrumequinum, Greater horseshoe bat), Gene LOC117012346, Length 156 aa.

						>A0A671ESN2_RHIFE|A0A671ESN2|LOC117012346
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	93	Very high	93.1	Very high	74 Å²	74	66.3 Å²	66.3	37%	0.365	36%	0.359	S	S	.	.				0	159.7	0	71.2	169.4	107.9	0	0	110.2	I3 V17 P19 K63	M1-I3 HydrophobicContact SD-CG2 4.39Å; M1-V17 HydrophobicContact CG-CG2 3.93Å; M1-V17 VanDerWaalsContact CG-O 3.31Å; M1-V17 WeakPolarHBondContact CG-O 3.39Å; M1-V17 PolarHBondContact N-O 2.79Å; M1-V17 PolarHBondContact O-N 2.77Å; M1-P19 HydrophobicContact CE-CB 3.37Å; M1-P19 HydrophobicContact CE-CG 3.82Å; M1-K63 HydrophobicContact CB-CB 4.29Å
2	Q	93.5	Very high	93.2	Very high	74 Å²	74	66.4 Å²	66.4	35%	0.346	36%	0.364	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.3	133.3	178.7	-173.4	174.7	-0.4	0	0	110.3	L15 E64	Q2-L15 WeakPolarHBondContact CA-O 3.23Å; Q2-E64 PolarHBondContact O-N 3.48Å
3	I	96.4	Very high	93.4	Very high	0 Å²	0	62.3 Å²	62.3	0%	0	34%	0.341	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.8	162.3	175	61.2	169.5	0	0	0	110.4	M1 L15 V17 V26 L56 I61 L67	M1-I3 HydrophobicContact SD-CG2 4.39Å; I3-L15 HydrophobicContact CD1-CB 4.43Å; I3-L15 HydrophobicContact CG1-CB 3.95Å; I3-L15 PolarHBondContact N-O 2.93Å; I3-L15 PolarHBondContact O-N 2.91Å; I3-V17 HydrophobicContact CB-CG2 4.44Å; I3-V17 HydrophobicContact CD1-CB 4.47Å; I3-V17 HydrophobicContact CD1-CG1 3.99Å; I3-V17 HydrophobicContact CD1-CG2 3.68Å; I3-V17 HydrophobicContact CG1-CG1 4.31Å; I3-V17 HydrophobicContact CG1-CG2 3.72Å; I3-V17 HydrophobicContact CG2-CG2 3.94Å; I3-V26 HydrophobicContact CD1-CG1 4.39Å; I3-L56 HydrophobicContact CD1-CD1 4.49Å; I3-I61 HydrophobicContact CG2-CG2 4.14Å; I3-L67 HydrophobicContact CB-CD1 4.35Å; I3-L67 HydrophobicContact CD1-CD1 3.69Å; I3-L67 HydrophobicContact CG1-CD1 4.45Å
4	F	96.7	Very high	93.5	Very high	55 Å²	55	62.5 Å²	62.5	24%	0.241	35%	0.345	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.2	138	178.5	-59.6	-76.3	0	0	0	110.9	T12 I13 T14 E64 S65 T66 L67	F4-T12 HydrophobicContact CB-CG2 3.93Å; F4-T12 HydrophobicContact CD1-CG2 3.97Å; F4-T12 HydrophobicContact CG-CG2 4.33Å; F4-I13 CarbonylContact C-O 3.57Å; F4-I13 WeakPolarHBondContact CA-O 3.39Å; F4-T14 HydrophobicContact CD1-CG2 3.83Å; F4-T14 HydrophobicContact CE1-CG2 3.67Å; F4-E64 HydrophobicContact CE2-CB 3.99Å; F4-E64 HydrophobicContact CE2-CG 3.97Å; F4-S65 PolarHBondContact N-O 2.78Å; F4-T66 HydrophobicContact CB-CG2 4.05Å; F4-T66 HydrophobicContact CD2-CG2 4.37Å; F4-T66 CarbonylContact O-C 3.58Å; F4-T66 WeakPolarHBondContact O-CA 3.41Å; F4-L67 PolarHBondContact O-N 3.48Å
5	V	96.1	Very high	93.7	Very high	0 Å²	0	58.6 Å²	58.6	0%	0	32%	0.323	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.3	115	173.6	-177.3	0	0	0	0	108.9	T12 I13 L15 I30 L43 L67 L69	V5-T12 CarbonylContact O-C 3.54Å; V5-T12 WeakPolarHBondContact O-CA 3.44Å; V5-I13 HydrophobicContact CB-CB 4.44Å; V5-I13 PolarHBondContact N-O 2.84Å; V5-I13 PolarHBondContact O-N 3.18Å; V5-L15 HydrophobicContact CG2-CD1 3.56Å; V5-L15 HydrophobicContact CG2-CG 4.33Å; V5-I30 HydrophobicContact CG1-CD1 4.19Å; V5-I30 HydrophobicContact CG2-CD1 4.12Å; V5-L43 HydrophobicContact CG1-CD2 4.33Å; V5-L67 CarbonylContact C-O 3.6Å; V5-L67 WeakPolarHBondContact CA-O 3.29Å; V5-L67 HydrophobicContact CG2-CB 4.47Å; V5-L69 HydrophobicContact CG1-CB 3.64Å
6	K	96.2	Very high	93.7	Very high	89 Å²	89	64.9 Å²	64.9	39%	0.387	35%	0.35	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.3	119.5	173.7	-77.5	-174.6	177.3	178.6	0	110.1	T12 L67 H68 L69	K6-T12 HydrophobicContact CG-CG2 4.28Å; K6-L67 PolarHBondContact N-O 2.7Å; K6-H68 CarbonylContact O-C 3.54Å; K6-H68 WeakPolarHBondContact O-CA 3.31Å; K6-L69 PolarHBondContact O-N 2.77Å
7	T	92.6	Very high	93.8	Very high	17 Å²	17	61.2 Å²	61.2	10%	0.104	33%	0.33	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.3	164.1	172.9	62.3	0	0	0	0	111.3	T9 G10 K11 I13 L69	T7-T9 PolarHBondContact O-N 2.95Å; T7-T9 PolarHBondContact OG1-OG1 2.98Å; T7-G10 PolarHBondContact O-N 2.7Å; T7-K11 PolarHBondContact N-O 2.92Å; T7-K11 WeakPolarHBondContact OG1-CB 3.47Å; T7-K11 PolarHBondContact OG1-N 2.72Å; T7-K11 PolarHBondContact OG1-O 2.75Å; T7-I13 HydrophobicContact CG2-CD1 3.77Å; T7-L69 HydrophobicContact CG2-CD2 4.22Å
8	L	88.3	Confident	93.8	Very high	124 Å²	124	64.6 Å²	64.6	65%	0.649	34%	0.343	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.2	-26.2	174	-69	175.6	0	0	0	113.7	G10 V70	L8-G10 PolarHBondContact O-N 2.97Å; L8-V70 HydrophobicContact CD1-CG1 4.2Å; L8-V70 HydrophobicContact CD2-CG1 4.41Å; L8-V70 HydrophobicContact CD2-CG2 4.05Å
9	T	87.8	Confident	93.7	Very high	125 Å²	125	64.6 Å²	64.6	77%	0.767	35%	0.347	S	S	*	.	T	Hydrogen-bonded Turn	trans	-81.7	1.8	178.7	57.9	0	0	0	0	112.8	T7 K11	T7-T9 PolarHBondContact O-N 2.95Å; T7-T9 PolarHBondContact OG1-OG1 2.98Å; T9-K11 VanDerWaalsContact C-N 3.28Å; T9-K11 PolarHBondContact O-N 2.84Å
10	G	90	Very high	93.7	Very high	58 Å²	58	64.9 Å²	64.9	60%	0.598	35%	0.354	S	S	*	.	S	Bend	trans	83.1	-3.6	-178.1	0	0	0	0	0	114.3	T7 L8	T7-G10 PolarHBondContact O-N 2.7Å; L8-G10 PolarHBondContact O-N 2.97Å
11	K	93.6	Very high	93.7	Very high	113 Å²	113	62.8 Å²	62.8	49%	0.491	34%	0.343	S	S	.	.			trans	-68.6	132.6	174.3	-172.5	-174.2	179.9	-166	0	109.9	T7 T9 E34	T7-K11 PolarHBondContact N-O 2.92Å; T7-K11 WeakPolarHBondContact OG1-CB 3.47Å; T7-K11 PolarHBondContact OG1-N 2.72Å; T7-K11 PolarHBondContact OG1-O 2.75Å; T9-K11 VanDerWaalsContact C-N 3.28Å; T9-K11 PolarHBondContact O-N 2.84Å; K11-E34 WeakPolarHBondContact CE-OE1 3.35Å; K11-E34 IonicContact NZ-OE1 3.53Å; K11-E34 PolarHBondContact NZ-OE1 2.97Å; K11-E34 IonicContact NZ-OE2 2.7Å
12	T	94.9	Very high	93.9	Very high	68 Å²	68	61.2 Å²	61.2	42%	0.417	34%	0.337	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.8	127.5	176.8	-54.3	0	0	0	0	109.8	F4 V5 K6	F4-T12 HydrophobicContact CB-CG2 3.93Å; F4-T12 HydrophobicContact CD1-CG2 3.97Å; F4-T12 HydrophobicContact CG-CG2 4.33Å; V5-T12 CarbonylContact O-C 3.54Å; V5-T12 WeakPolarHBondContact O-CA 3.44Å; K6-T12 HydrophobicContact CG-CG2 4.28Å
13	I	94.9	Very high	94	Very high	13 Å²	13	57.7 Å²	57.7	7%	0.067	32%	0.321	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.5	135.6	-179.6	-54.9	155.9	0	0	0	108.1	F4 V5 T7 L15 K33 E34	F4-I13 CarbonylContact C-O 3.57Å; F4-I13 WeakPolarHBondContact CA-O 3.39Å; V5-I13 HydrophobicContact CB-CB 4.44Å; V5-I13 PolarHBondContact N-O 2.84Å; V5-I13 PolarHBondContact O-N 3.18Å; T7-I13 HydrophobicContact CG2-CD1 3.77Å; I13-L15 HydrophobicContact CG2-CD2 4.29Å; I13-L15 HydrophobicContact CG2-CG 4.49Å; I13-K33 HydrophobicContact CG2-CD 3.72Å; I13-E34 HydrophobicContact CD1-CG 3.32Å; I13-E34 WeakPolarHBondContact CD1-OE1 3.39Å; I13-E34 HydrophobicContact CG1-CG 4.41Å
14	T	95.7	Very high	93.9	Very high	65 Å²	65	63.4 Å²	63.4	40%	0.399	35%	0.348	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.8	135.2	172.3	51.6	0	0	0	0	110	F4 K33	F4-T14 HydrophobicContact CD1-CG2 3.83Å; F4-T14 HydrophobicContact CE1-CG2 3.67Å; T14-K33 PolarHBondContact O-NZ 3.1Å
15	L	95.3	Very high	93.8	Very high	4 Å²	4	64.4 Å²	64.4	2%	0.021	36%	0.356	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.8	138.8	174.6	-63.6	173.6	0	0	0	110.8	Q2 I3 V5 I13 V17 V26 K29 I30 K33	Q2-L15 WeakPolarHBondContact CA-O 3.23Å; I3-L15 HydrophobicContact CD1-CB 4.43Å; I3-L15 HydrophobicContact CG1-CB 3.95Å; I3-L15 PolarHBondContact N-O 2.93Å; I3-L15 PolarHBondContact O-N 2.91Å; V5-L15 HydrophobicContact CG2-CD1 3.56Å; V5-L15 HydrophobicContact CG2-CG 4.33Å; I13-L15 HydrophobicContact CG2-CD2 4.29Å; I13-L15 HydrophobicContact CG2-CG 4.49Å; L15-V17 HydrophobicContact CB-CG1 4.14Å; L15-V26 HydrophobicContact CD1-CG1 4.2Å; L15-K29 HydrophobicContact CD2-CB 4.3Å; L15-I30 HydrophobicContact CD1-CD1 4.1Å; L15-I30 HydrophobicContact CD1-CG1 3.52Å; L15-K33 HydrophobicContact CD2-CD 3.76Å
16	E	94.6	Very high	93.8	Very high	159 Å²	159	64.4 Å²	64.4	74%	0.743	36%	0.356	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-95.9	118.4	169.8	-67.4	-173.7	169.8	0	0	109.2	K29	E16-K29 PolarHBondContact O-NZ 2.97Å
17	V	94.8	Very high	93.7	Very high	3 Å²	3	60.7 Å²	60.7	2%	0.018	34%	0.34	C	S	.	.			trans	-140.9	155.6	-172.2	-61.6	0	0	0	0	110.8	M1 I3 L15 D21 V26 K29 L56	M1-V17 HydrophobicContact CG-CG2 3.93Å; M1-V17 VanDerWaalsContact CG-O 3.31Å; M1-V17 WeakPolarHBondContact CG-O 3.39Å; M1-V17 PolarHBondContact N-O 2.79Å; M1-V17 PolarHBondContact O-N 2.77Å; I3-V17 HydrophobicContact CB-CG2 4.44Å; I3-V17 HydrophobicContact CD1-CB 4.47Å; I3-V17 HydrophobicContact CD1-CG1 3.99Å; I3-V17 HydrophobicContact CD1-CG2 3.68Å; I3-V17 HydrophobicContact CG1-CG1 4.31Å; I3-V17 HydrophobicContact CG1-CG2 3.72Å; I3-V17 HydrophobicContact CG2-CG2 3.94Å; L15-V17 HydrophobicContact CB-CG1 4.14Å; V17-D21 WeakPolarHBondContact CA-OD2 3.48Å; V17-V26 HydrophobicContact CG1-CG2 4.18Å; V17-K29 HydrophobicContact CG1-CD 4.14Å; V17-L56 HydrophobicContact CB-CD1 3.75Å; V17-L56 HydrophobicContact CG1-CD1 4.41Å; V17-L56 HydrophobicContact CG2-CD1 3.45Å; V17-L56 VanDerWaalsContact CG2-CD1 3.45Å
18	E	94.3	Very high	93.8	Very high	122 Å²	122	61.7 Å²	61.7	57%	0.57	35%	0.349	S	S	*	.			trans	-99.2	150.3	170.7	-66.2	-170.4	170.6	0	0	110.5	S20 D21	E18-S20 WeakPolarHBondContact CB-OG 3.33Å; E18-S20 PolarHBondContact O-N 3.39Å; E18-D21 PolarHBondContact N-OD2 2.95Å; E18-D21 VanDerWaalsContact O-CB 3.28Å; E18-D21 WeakPolarHBondContact O-CB 3.4Å; E18-D21 PolarHBondContact O-N 3.22Å
19	P	92.1	Very high	94.1	Very high	64 Å²	64	59 Å²	59	42%	0.416	33%	0.332	S	S	.	.	T	Hydrogen-bonded Turn	trans	-58.1	-29.1	177	17.6	-25.6	0	0	0	113.1	M1 D21 L56 S57	M1-P19 HydrophobicContact CE-CB 3.37Å; M1-P19 HydrophobicContact CE-CG 3.82Å; P19-D21 VanDerWaalsContact C-N 3.31Å; P19-L56 PolarHBondContact O-N 3.08Å; P19-S57 PolarHBondContact O-N 3.36Å; P19-S57 PolarHBondContact O-OG 3.46Å; P19-S57 VanDerWaalsContact O-OG 3.1Å
20	S	93.8	Very high	94.4	Very high	70 Å²	70	53 Å²	53	49%	0.49	30%	0.296	S	S	.	.	T	Hydrogen-bonded Turn	trans	-73.9	-14.2	174.8	41.5	0	0	0	0	114.1	E18 T22	E18-S20 WeakPolarHBondContact CB-OG 3.33Å; E18-S20 PolarHBondContact O-N 3.39Å; S20-T22 PolarHBondContact O-N 2.84Å
21	D	94.1	Very high	94.6	Very high	22 Å²	22	54 Å²	54	12%	0.118	29%	0.285	C	S	.	.			trans	-62.3	134	178.5	-81	-27.9	0	0	0	110	V17 E18 P19 N25 V26 K29 T55 L56	V17-D21 WeakPolarHBondContact CA-OD2 3.48Å; E18-D21 PolarHBondContact N-OD2 2.95Å; E18-D21 VanDerWaalsContact O-CB 3.28Å; E18-D21 WeakPolarHBondContact O-CB 3.4Å; E18-D21 PolarHBondContact O-N 3.22Å; P19-D21 VanDerWaalsContact C-N 3.31Å; D21-N25 HydrophobicContact CB-CB 4.5Å; D21-V26 HydrophobicContact CB-CG2 4.37Å; D21-K29 IonicContact OD2-NZ 3.97Å; D21-K29 PolarHBondContact OD2-NZ 2.9Å; D21-T55 WeakPolarHBondContact O-CA 3.47Å; D21-L56 HydrophobicContact CB-CD1 4.34Å; D21-L56 PolarHBondContact O-N 3.03Å
22	T	95.9	Very high	94.6	Very high	40 Å²	40	55 Å²	55	25%	0.245	30%	0.296	C	S	.	.	B	Isolated β-bridge	trans	-72.9	156.6	171.1	60.6	0	0	0	0	110.8	S20 E24 N25 V26 R54 T55	S20-T22 PolarHBondContact O-N 2.84Å; T22-E24 PolarHBondContact O-N 3.26Å; T22-N25 WeakPolarHBondContact O-CB 3.49Å; T22-N25 PolarHBondContact O-N 3.2Å; T22-N25 VanDerWaalsContact O-N 3.1Å; T22-N25 VanDerWaalsContact OG1-CG 3.26Å; T22-N25 PolarHBondContact OG1-N 2.97Å; T22-N25 PolarHBondContact OG1-OD1 3.18Å; T22-V26 WeakPolarHBondContact O-CG2 3.41Å; T22-V26 PolarHBondContact O-N 2.94Å; T22-V26 VanDerWaalsContact O-N 3.09Å; T22-R54 WeakPolarHBondContact CA-O 3.39Å; T22-T55 HydrophobicContact CG2-CG2 4.47Å
23	I	95.6	Very high	94.4	Very high	0 Å²	0	57.1 Å²	57.1	0%	0	30%	0.299	C	S	.	.	H	α-helix	trans	-60.5	-32.1	174.6	-61.3	-53.9	0	0	0	111.5	V26 K27 L43 L50 E51 R54 L56 Y59	I23-V26 PolarHBondContact O-N 3.34Å; I23-K27 WeakPolarHBondContact O-CG 3.28Å; I23-K27 PolarHBondContact O-N 3.03Å; I23-L43 HydrophobicContact CG2-CD1 4.24Å; I23-L50 HydrophobicContact CD1-CB 4.15Å; I23-L50 HydrophobicContact CD1-CD1 3.63Å; I23-L50 HydrophobicContact CD1-CG 4.47Å; I23-L50 HydrophobicContact CG1-CB 4.02Å; I23-L50 HydrophobicContact CG1-CD1 4.42Å; I23-L50 HydrophobicContact CG2-CB 3.89Å; I23-E51 VanDerWaalsContact CB-O 3.29Å; I23-E51 WeakPolarHBondContact CB-O 3.36Å; I23-E51 WeakPolarHBondContact CG1-O 3.41Å; I23-R54 WeakPolarHBondContact CG1-O 3.38Å; I23-R54 PolarHBondContact N-O 3.22Å; I23-L56 HydrophobicContact CD1-CD2 3.76Å; I23-L56 HydrophobicContact CD1-CG 4.49Å; I23-Y59 HydrophobicContact CD1-CD2 4.44Å; I23-Y59 HydrophobicContact CG1-CD2 4.49Å; I23-Y59 HydrophobicContact CG1-CE2 4.21Å
24	E	95.2	Very high	94.2	Very high	120 Å²	120	59.2 Å²	59.2	56%	0.561	31%	0.309	S	S	*	.	H	α-helix	trans	-60.4	-45.8	172.3	-170.4	169.6	-160.8	0	0	112.4	T22 V26 K27 A28 D52	T22-E24 PolarHBondContact O-N 3.26Å; E24-V26 VanDerWaalsContact C-N 3.31Å; E24-V26 PolarHBondContact O-N 2.91Å; E24-K27 WeakPolarHBondContact O-CB 3.41Å; E24-K27 PolarHBondContact O-N 3.02Å; E24-A28 PolarHBondContact O-N 2.87Å; E24-D52 HydrophobicContact CB-CB 4.29Å; E24-D52 PolarHBondContact N-O 3.27Å
25	N	94.4	Very high	94	Very high	77 Å²	77	59 Å²	59	41%	0.412	32%	0.319	S	S	.	.	H	α-helix	trans	-62.7	-39	176.2	-70	-6.4	0	0	0	111.8	D21 T22 A28 K29	D21-N25 HydrophobicContact CB-CB 4.5Å; T22-N25 WeakPolarHBondContact O-CB 3.49Å; T22-N25 PolarHBondContact O-N 3.2Å; T22-N25 VanDerWaalsContact O-N 3.1Å; T22-N25 VanDerWaalsContact OG1-CG 3.26Å; T22-N25 PolarHBondContact OG1-N 2.97Å; T22-N25 PolarHBondContact OG1-OD1 3.18Å; N25-A28 PolarHBondContact O-N 3.45Å; N25-K29 WeakPolarHBondContact O-CG 3.26Å; N25-K29 PolarHBondContact O-N 3.03Å
26	V	94.9	Very high	93.7	Very high	0 Å²	0	60.3 Å²	60.3	0%	0	33%	0.326	C	S	.	.	H	α-helix	trans	-63.9	-41.3	175.8	178.1	0	0	0	0	111	I3 L15 V17 D21 T22 I23 E24 A28 K29 I30 L43 L56	I3-V26 HydrophobicContact CD1-CG1 4.39Å; L15-V26 HydrophobicContact CD1-CG1 4.2Å; V17-V26 HydrophobicContact CG1-CG2 4.18Å; D21-V26 HydrophobicContact CB-CG2 4.37Å; T22-V26 WeakPolarHBondContact O-CG2 3.41Å; T22-V26 PolarHBondContact O-N 2.94Å; T22-V26 VanDerWaalsContact O-N 3.09Å; I23-V26 PolarHBondContact O-N 3.34Å; E24-V26 VanDerWaalsContact C-N 3.31Å; E24-V26 PolarHBondContact O-N 2.91Å; V26-A28 VanDerWaalsContact C-N 3.35Å; V26-K29 PolarHBondContact O-N 2.76Å; V26-I30 HydrophobicContact CG1-CD1 4.17Å; V26-I30 WeakPolarHBondContact O-CG1 3.14Å; V26-I30 PolarHBondContact O-N 3.31Å; V26-L43 HydrophobicContact CB-CD1 4.5Å; V26-L43 HydrophobicContact CG1-CD1 3.96Å; V26-L56 HydrophobicContact CG2-CD1 3.9Å; V26-L56 HydrophobicContact CG2-CD2 4.12Å; V26-L56 HydrophobicContact CG2-CG 4.1Å
27	K	94.9	Very high	93.6	Very high	11 Å²	11	54.5 Å²	54.5	5%	0.048	30%	0.302	C	S	.	.	H	α-helix	trans	-64.4	-37.4	175.3	-71.9	177.6	174.8	-177.1	0	112.8	I23 E24 I30 Q31 P38 Q41 L43 D52	I23-K27 WeakPolarHBondContact O-CG 3.28Å; I23-K27 PolarHBondContact O-N 3.03Å; E24-K27 WeakPolarHBondContact O-CB 3.41Å; E24-K27 PolarHBondContact O-N 3.02Å; K27-I30 PolarHBondContact O-N 3.03Å; K27-Q31 PolarHBondContact O-N 3.32Å; K27-P38 HydrophobicContact CB-CB 3.94Å; K27-P38 HydrophobicContact CD-CB 4.42Å; K27-Q41 VanDerWaalsContact CA-OE1 3.26Å; K27-Q41 HydrophobicContact CD-CB 4.23Å; K27-Q41 WeakPolarHBondContact CE-O 3.25Å; K27-Q41 HydrophobicContact CG-CB 4.17Å; K27-Q41 PolarHBondContact NZ-O 3.29Å; K27-Q41 PolarHBondContact O-NE2 3.2Å; K27-Q41 PolarHBondContact O-OE1 2.83Å; K27-L43 HydrophobicContact CG-CD1 3.88Å; K27-L43 HydrophobicContact CG-CG 4.4Å; K27-D52 WeakPolarHBondContact CD-OD1 3.44Å; K27-D52 WeakPolarHBondContact CE-OD1 3.29Å; K27-D52 IonicContact NZ-OD1 2.79Å; K27-D52 PolarHBondContact NZ-OD1 2.83Å; K27-D52 IonicContact NZ-OD2 2.84Å; K27-D52 PolarHBondContact NZ-OD2 3.2Å
28	A	94.7	Very high	93.4	Very high	37 Å²	37	56.1 Å²	56.1	31%	0.306	31%	0.313	S	S	.	.	H	α-helix	trans	-61.7	-47.2	173.3	0	0	0	0	0	111.2	E24 N25 V26 I30 Q31 D32	E24-A28 PolarHBondContact O-N 2.87Å; N25-A28 PolarHBondContact O-N 3.45Å; V26-A28 VanDerWaalsContact C-N 3.35Å; A28-I30 PolarHBondContact O-N 2.99Å; A28-Q31 WeakPolarHBondContact O-CA 3.36Å; A28-Q31 VanDerWaalsContact O-CB 3.26Å; A28-Q31 WeakPolarHBondContact O-CB 3.32Å; A28-Q31 PolarHBondContact O-N 3.3Å; A28-D32 PolarHBondContact O-N 3.41Å
29	K	94.8	Very high	93.1	Very high	68 Å²	68	54.3 Å²	54.3	30%	0.296	31%	0.307	S	S	.	.	H	α-helix	trans	-59.8	-32.9	174.7	-69.5	176.3	177.4	179	0	113	L15 E16 V17 D21 N25 V26	L15-K29 HydrophobicContact CD2-CB 4.3Å; E16-K29 PolarHBondContact O-NZ 2.97Å; V17-K29 HydrophobicContact CG1-CD 4.14Å; D21-K29 IonicContact OD2-NZ 3.97Å; D21-K29 PolarHBondContact OD2-NZ 2.9Å; N25-K29 WeakPolarHBondContact O-CG 3.26Å; N25-K29 PolarHBondContact O-N 3.03Å; V26-K29 PolarHBondContact O-N 2.76Å
30	I	94.1	Very high	93	Very high	0 Å²	0	54 Å²	54	0%	0	30%	0.3	C	S	.	.	H	α-helix	trans	-70.7	-38.8	173.3	-68.3	166.6	0	0	0	111.2	V5 L15 V26 K27 A28 D32 K33 E34 L43 L69	V5-I30 HydrophobicContact CG1-CD1 4.19Å; V5-I30 HydrophobicContact CG2-CD1 4.12Å; L15-I30 HydrophobicContact CD1-CD1 4.1Å; L15-I30 HydrophobicContact CD1-CG1 3.52Å; V26-I30 HydrophobicContact CG1-CD1 4.17Å; V26-I30 WeakPolarHBondContact O-CG1 3.14Å; V26-I30 PolarHBondContact O-N 3.31Å; K27-I30 PolarHBondContact O-N 3.03Å; A28-I30 PolarHBondContact O-N 2.99Å; I30-D32 VanDerWaalsContact C-N 3.29Å; I30-D32 PolarHBondContact O-N 3.32Å; I30-K33 PolarHBondContact O-N 3.09Å; I30-E34 PolarHBondContact O-N 3.42Å; I30-L43 HydrophobicContact CD1-CD1 3.99Å; I30-L43 HydrophobicContact CD1-CD2 3.66Å; I30-L43 HydrophobicContact CD1-CG 4.35Å; I30-L69 HydrophobicContact CG2-CD2 3.8Å
31	Q	94.3	Very high	93	Very high	77 Å²	77	50.8 Å²	50.8	36%	0.36	28%	0.277	S	S	.	.	H	α-helix	trans	-59.3	-42.9	175.3	179.3	-176.2	10.2	0	0	110.8	K27 A28 K33 G35 I36 P38	K27-Q31 PolarHBondContact O-N 3.32Å; A28-Q31 WeakPolarHBondContact O-CA 3.36Å; A28-Q31 VanDerWaalsContact O-CB 3.26Å; A28-Q31 WeakPolarHBondContact O-CB 3.32Å; A28-Q31 PolarHBondContact O-N 3.3Å; Q31-K33 PolarHBondContact O-N 3.28Å; Q31-G35 WeakPolarHBondContact O-CA 3.48Å; Q31-G35 PolarHBondContact O-N 2.88Å; Q31-I36 WeakPolarHBondContact CA-O 3.44Å; Q31-I36 VanDerWaalsContact CB-O 3.25Å; Q31-I36 WeakPolarHBondContact CB-O 3.46Å; Q31-I36 WeakPolarHBondContact CG-O 3.48Å; Q31-P38 HydrophobicContact CB-CG 4.48Å
32	D	93.2	Very high	93	Very high	135 Å²	135	53.8 Å²	53.8	72%	0.722	29%	0.286	S	S	*	.	H	α-helix	trans	-62.9	-29.3	179.6	-64.3	-30.3	0	0	0	112.8	A28 I30	A28-D32 PolarHBondContact O-N 3.41Å; I30-D32 VanDerWaalsContact C-N 3.29Å; I30-D32 PolarHBondContact O-N 3.32Å
33	K	91.6	Very high	92.9	Very high	112 Å²	112	51.9 Å²	51.9	49%	0.487	28%	0.275	S	S	.	.	H	α-helix	trans	-91.6	-39.4	-179	-66.9	-165.1	-179.1	-165.9	0	114.6	I13 T14 L15 I30 Q31	I13-K33 HydrophobicContact CG2-CD 3.72Å; T14-K33 PolarHBondContact O-NZ 3.1Å; L15-K33 HydrophobicContact CD2-CD 3.76Å; I30-K33 PolarHBondContact O-N 3.09Å; Q31-K33 PolarHBondContact O-N 3.28Å
34	E	89.9	Confident	92.9	Very high	58 Å²	58	54.3 Å²	54.3	27%	0.271	29%	0.287	S	S	.	.	H	α-helix	trans	-108.7	-10.2	-174.7	-69.3	-73.5	133.5	0	0	113.3	K11 I13 I30 I36	K11-E34 WeakPolarHBondContact CE-OE1 3.35Å; K11-E34 IonicContact NZ-OE1 3.53Å; K11-E34 PolarHBondContact NZ-OE1 2.97Å; K11-E34 IonicContact NZ-OE2 2.7Å; I13-E34 HydrophobicContact CD1-CG 3.32Å; I13-E34 WeakPolarHBondContact CD1-OE1 3.39Å; I13-E34 HydrophobicContact CG1-CG 4.41Å; I30-E34 PolarHBondContact O-N 3.42Å; E34-I36 HydrophobicContact CB-CD1 3.84Å; E34-I36 HydrophobicContact CB-CG1 4.01Å; E34-I36 PolarHBondContact O-N 3Å
35	G	90.6	Very high	92.9	Very high	60 Å²	60	50.8 Å²	50.8	62%	0.619	27%	0.27	S	S	*	.			trans	73.1	9.5	-177.5	0	0	0	0	0	114.5	Q31	Q31-G35 WeakPolarHBondContact O-CA 3.48Å; Q31-G35 PolarHBondContact O-N 2.88Å
36	I	89.8	Confident	92.9	Very high	32 Å²	32	51.4 Å²	51.4	16%	0.164	29%	0.286	C	S	.	.			trans	-87.9	123.4	-177.1	-57.5	166.5	0	0	0	108.7	Q31 E34 Q40 Q41 L69 L71	Q31-I36 WeakPolarHBondContact CA-O 3.44Å; Q31-I36 VanDerWaalsContact CB-O 3.25Å; Q31-I36 WeakPolarHBondContact CB-O 3.46Å; Q31-I36 WeakPolarHBondContact CG-O 3.48Å; E34-I36 HydrophobicContact CB-CD1 3.84Å; E34-I36 HydrophobicContact CB-CG1 4.01Å; E34-I36 PolarHBondContact O-N 3Å; I36-Q40 HydrophobicContact CG2-CB 4.2Å; I36-Q41 HydrophobicContact CB-CG 4.38Å; I36-Q41 HydrophobicContact CG2-CG 3.78Å; I36-Q41 PolarHBondContact O-NE2 3.46Å; I36-L69 HydrophobicContact CD1-CD2 4.18Å; I36-L71 HydrophobicContact CD1-CD2 4.09Å; I36-L71 HydrophobicContact CG1-CD2 4.49Å; I36-L71 HydrophobicContact CG2-CD2 3.49Å; I36-L71 VanDerWaalsContact CG2-CD2 3.49Å
37	P	91.8	Very high	92.7	Very high	36 Å²	36	54.9 Å²	54.9	23%	0.234	32%	0.322	C	S	.	.			trans	-69.4	146.9	-176.6	29.6	-35.7	0	0	0	111.9	D39 Q40 Q41	P37-D39 VanDerWaalsContact C-N 3.25Å; P37-D39 VanDerWaalsContact CB-OD1 3.29Å; P37-D39 WeakPolarHBondContact CB-OD1 3.48Å; P37-D39 WeakPolarHBondContact CG-OD1 3.48Å; P37-D39 PolarHBondContact O-N 3.1Å; P37-Q40 HydrophobicContact CG-CB 4.09Å; P37-Q40 HydrophobicContact CG-CG 3.82Å; P37-Q40 WeakPolarHBondContact O-CB 3.36Å; P37-Q40 PolarHBondContact O-N 2.82Å; P37-Q41 PolarHBondContact O-N 2.76Å
38	P	91.6	Very high	92.7	Very high	38 Å²	38	61.4 Å²	61.4	25%	0.247	35%	0.35	C	S	.	.	G	3₁₀ helix	trans	-59.8	-30.9	-171.2	-27.4	36.5	0	0	0	114.2	K27 Q31 Q40 Q41	K27-P38 HydrophobicContact CB-CB 3.94Å; K27-P38 HydrophobicContact CD-CB 4.42Å; Q31-P38 HydrophobicContact CB-CG 4.48Å; P38-Q40 PolarHBondContact O-N 3.45Å; P38-Q41 PolarHBondContact O-N 2.97Å; P38-Q41 VanDerWaalsContact O-N 3.11Å
39	D	88.9	Confident	92.6	Very high	83 Å²	83	64.1 Å²	64.1	44%	0.444	36%	0.357	S	S	.	.	G	3₁₀ helix	trans	-65	-26.3	176.9	72.9	-44.8	0	0	0	112.5	P37 R72 R74	P37-D39 VanDerWaalsContact C-N 3.25Å; P37-D39 VanDerWaalsContact CB-OD1 3.29Å; P37-D39 WeakPolarHBondContact CB-OD1 3.48Å; P37-D39 WeakPolarHBondContact CG-OD1 3.48Å; P37-D39 PolarHBondContact O-N 3.1Å; D39-R72 WeakPolarHBondContact O-CD 3.41Å; D39-R74 IonicContact OD2-CZ 2.63Å; D39-R74 IonicContact OD2-NE 2.92Å; D39-R74 IonicContact OD2-NH2 3.3Å; D39-R74 PolarHBondContact OD2-NH2 3.46Å
40	Q	89.8	Confident	92.6	Very high	58 Å²	58	61 Å²	61	27%	0.271	34%	0.343	S	S	.	.	G	3₁₀ helix	trans	-91.2	-6.3	177	-65.5	176.7	22.9	0	0	112.9	I36 P37 P38 L71 R72	I36-Q40 HydrophobicContact CG2-CB 4.2Å; P37-Q40 HydrophobicContact CG-CB 4.09Å; P37-Q40 HydrophobicContact CG-CG 3.82Å; P37-Q40 WeakPolarHBondContact O-CB 3.36Å; P37-Q40 PolarHBondContact O-N 2.82Å; P38-Q40 PolarHBondContact O-N 3.45Å; Q40-L71 CarbonylContact O-C 3.51Å; Q40-L71 WeakPolarHBondContact O-CA 3.47Å; Q40-R72 PolarHBondContact O-N 3.04Å
41	Q	92.5	Very high	92.6	Very high	2 Å²	2	66 Å²	66	1%	0.009	37%	0.366	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.8	132.5	-178.8	-61.6	-179.7	29.2	0	0	111.8	K27 I36 P37 P38 L69	K27-Q41 VanDerWaalsContact CA-OE1 3.26Å; K27-Q41 HydrophobicContact CD-CB 4.23Å; K27-Q41 WeakPolarHBondContact CE-O 3.25Å; K27-Q41 HydrophobicContact CG-CB 4.17Å; K27-Q41 PolarHBondContact NZ-O 3.29Å; K27-Q41 PolarHBondContact O-NE2 3.2Å; K27-Q41 PolarHBondContact O-OE1 2.83Å; I36-Q41 HydrophobicContact CB-CG 4.38Å; I36-Q41 HydrophobicContact CG2-CG 3.78Å; I36-Q41 PolarHBondContact O-NE2 3.46Å; P37-Q41 PolarHBondContact O-N 2.76Å; P38-Q41 PolarHBondContact O-N 2.97Å; P38-Q41 VanDerWaalsContact O-N 3.11Å; Q41-L69 HydrophobicContact CB-CD1 3.75Å; Q41-L69 HydrophobicContact CG-CD1 3.95Å
42	R	93.8	Very high	92.5	Very high	85 Å²	85	65.6 Å²	65.6	32%	0.321	37%	0.367	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.3	117.8	164.5	-67.7	-176.9	176.5	-160.2	0.2	109.1	V70 R72	R42-V70 WeakPolarHBondContact CA-O 3.42Å; R42-V70 HydrophobicContact CB-CB 4.35Å; R42-V70 WeakPolarHBondContact CB-O 3.43Å; R42-V70 PolarHBondContact N-O 3.05Å; R42-V70 PolarHBondContact O-N 3.32Å; R42-R72 HydrophobicContact CG-CB 4.26Å
43	L	94.8	Very high	92.4	Very high	0 Å²	0	62.8 Å²	62.8	0%	0	37%	0.37	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.8	133.5	173.8	-65.6	175.8	0	0	0	109.6	V5 I23 V26 K27 I30 L50 L67 H68 L69	V5-L43 HydrophobicContact CG1-CD2 4.33Å; I23-L43 HydrophobicContact CG2-CD1 4.24Å; V26-L43 HydrophobicContact CB-CD1 4.5Å; V26-L43 HydrophobicContact CG1-CD1 3.96Å; K27-L43 HydrophobicContact CG-CD1 3.88Å; K27-L43 HydrophobicContact CG-CG 4.4Å; I30-L43 HydrophobicContact CD1-CD1 3.99Å; I30-L43 HydrophobicContact CD1-CD2 3.66Å; I30-L43 HydrophobicContact CD1-CG 4.35Å; L43-L50 HydrophobicContact CB-CB 4.36Å; L43-L50 HydrophobicContact CB-CD1 4.15Å; L43-L50 HydrophobicContact CB-CG 4.39Å; L43-L50 PolarHBondContact O-N 3.03Å; L43-L67 HydrophobicContact CB-CD2 4.3Å; L43-H68 WeakPolarHBondContact CA-O 3.33Å; L43-L69 HydrophobicContact CD2-CB 4.2Å; L43-L69 HydrophobicContact CD2-CD1 3.83Å
44	I	95.4	Very high	92.6	Very high	51 Å²	51	62.5 Å²	62.5	26%	0.262	37%	0.366	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.3	130.6	-179.2	-56.3	174.5	0	0	0	108.4	K48 H68 V70	I44-K48 WeakPolarHBondContact CA-O 3.49Å; I44-H68 HydrophobicContact CB-CB 4.3Å; I44-H68 PolarHBondContact N-O 2.92Å; I44-H68 PolarHBondContact O-N 2.79Å; I44-V70 HydrophobicContact CD1-CB 4.45Å; I44-V70 HydrophobicContact CD1-CG2 3.69Å
45	F	95.9	Very high	92.9	Very high	47 Å²	47	61.1 Å²	61.1	21%	0.206	36%	0.361	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136	135	174	-178.1	-111.5	0	0	0	109.3	G47 K48 L50 I61 T66 L67	F45-G47 PolarHBondContact O-N 3.43Å; F45-G47 VanDerWaalsContact O-N 3.11Å; F45-K48 PolarHBondContact N-O 3.34Å; F45-K48 PolarHBondContact O-N 3.49Å; F45-L50 HydrophobicContact CB-CD1 4.26Å; F45-L50 HydrophobicContact CB-CD2 4.12Å; F45-L50 HydrophobicContact CB-CG 4.45Å; F45-I61 HydrophobicContact CD1-CD1 4.3Å; F45-I61 HydrophobicContact CD1-CG1 3.79Å; F45-I61 HydrophobicContact CE1-CG1 3.85Å; F45-I61 HydrophobicContact CG-CD1 4.41Å; F45-I61 HydrophobicContact CG-CG1 4.22Å; F45-I61 HydrophobicContact CZ-CG1 4.34Å; F45-T66 WeakPolarHBondContact CD2-O 3.34Å; F45-L67 HydrophobicContact CB-CD2 4.38Å; F45-L67 HydrophobicContact CB-CG 4.49Å; F45-L67 HydrophobicContact CD2-CG 4.5Å
46	A	93.4	Very high	93.1	Very high	89 Å²	89	58.3 Å²	58.3	74%	0.736	33%	0.332	S	S	*	.	T	Hydrogen-bonded Turn	trans	48.3	38.5	-176.4	0	0	0	0	0	114	K48	A46-K48 PolarHBondContact O-N 2.78Å
47	G	91.9	Very high	93.3	Very high	74 Å²	74	59.3 Å²	59.3	76%	0.763	34%	0.342	S	S	*	.	T	Hydrogen-bonded Turn	trans	74.4	0.2	-178.5	0	0	0	0	0	115.5	F45	F45-G47 PolarHBondContact O-N 3.43Å; F45-G47 VanDerWaalsContact O-N 3.11Å
48	K	93.1	Very high	93.3	Very high	148 Å²	148	62.2 Å²	62.2	64%	0.643	36%	0.355	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-104.4	135.6	177.9	-65.1	-177.6	-178.2	177.7	0	110.8	I44 F45 A46	I44-K48 WeakPolarHBondContact CA-O 3.49Å; F45-K48 PolarHBondContact N-O 3.34Å; F45-K48 PolarHBondContact O-N 3.49Å; A46-K48 PolarHBondContact O-N 2.78Å
49	Q	93.7	Very high	93.5	Very high	94 Å²	94	62.2 Å²	62.2	44%	0.439	35%	0.351	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.1	133.8	170.4	-175	-177	-34	0	0	109.3
50	L	94.6	Very high	93.7	Very high	3 Å²	3	64.6 Å²	64.6	2%	0.016	36%	0.363	C	S	.	.	P	Polyproline II helix	trans	-83.5	141.5	178.1	-54.1	-172.6	0	0	0	111.3	I23 L43 F45 Y59 I61 L67	I23-L50 HydrophobicContact CD1-CB 4.15Å; I23-L50 HydrophobicContact CD1-CD1 3.63Å; I23-L50 HydrophobicContact CD1-CG 4.47Å; I23-L50 HydrophobicContact CG1-CB 4.02Å; I23-L50 HydrophobicContact CG1-CD1 4.42Å; I23-L50 HydrophobicContact CG2-CB 3.89Å; L43-L50 HydrophobicContact CB-CB 4.36Å; L43-L50 HydrophobicContact CB-CD1 4.15Å; L43-L50 HydrophobicContact CB-CG 4.39Å; L43-L50 PolarHBondContact O-N 3.03Å; F45-L50 HydrophobicContact CB-CD1 4.26Å; F45-L50 HydrophobicContact CB-CD2 4.12Å; F45-L50 HydrophobicContact CB-CG 4.45Å; L50-Y59 HydrophobicContact CB-CE2 4.18Å; L50-Y59 HydrophobicContact CD2-CD1 3.63Å; L50-Y59 HydrophobicContact CD2-CD2 3.71Å; L50-Y59 HydrophobicContact CD2-CE1 3.67Å; L50-Y59 HydrophobicContact CD2-CE2 3.71Å; L50-Y59 HydrophobicContact CD2-CG 3.64Å; L50-Y59 HydrophobicContact CG-CE2 4.46Å; L50-I61 HydrophobicContact CD1-CD1 3.92Å; L50-L67 HydrophobicContact CD1-CD2 3.32Å
51	E	94.1	Very high	93.9	Very high	103 Å²	103	62 Å²	62	48%	0.481	35%	0.352	S	S	.	.	P	Polyproline II helix	trans	-97.7	140.8	179	-66.1	175.5	173.8	0	0	110.7	I23 G53 R54 Y59	I23-E51 VanDerWaalsContact CB-O 3.29Å; I23-E51 WeakPolarHBondContact CB-O 3.36Å; I23-E51 WeakPolarHBondContact CG1-O 3.41Å; E51-G53 VanDerWaalsContact C-N 3.28Å; E51-G53 PolarHBondContact O-N 3.28Å; E51-R54 PolarHBondContact O-N 2.92Å; E51-R54 IonicContact OE1-NH2 3.92Å; E51-R54 IonicContact OE2-CZ 3.68Å; E51-R54 VanDerWaalsContact OE2-CZ 3.23Å; E51-R54 IonicContact OE2-NE 3.23Å; E51-R54 PolarHBondContact OE2-NE 2.91Å; E51-R54 IonicContact OE2-NH2 2.73Å; E51-R54 PolarHBondContact OE2-NH2 2.85Å; E51-Y59 PolarHBondContact N-OH 3.18Å
52	D	92.3	Very high	94	Very high	70 Å²	70	68.8 Å²	68.8	37%	0.374	38%	0.383	S	S	.	.	T	Hydrogen-bonded Turn	trans	-63.6	-30.2	-172.6	-67	-32.1	0	0	0	113.8	E24 K27 R54	E24-D52 HydrophobicContact CB-CB 4.29Å; E24-D52 PolarHBondContact N-O 3.27Å; K27-D52 WeakPolarHBondContact CD-OD1 3.44Å; K27-D52 WeakPolarHBondContact CE-OD1 3.29Å; K27-D52 IonicContact NZ-OD1 2.79Å; K27-D52 PolarHBondContact NZ-OD1 2.83Å; K27-D52 IonicContact NZ-OD2 2.84Å; K27-D52 PolarHBondContact NZ-OD2 3.2Å; D52-R54 PolarHBondContact O-N 3.17Å
53	G	91.9	Very high	94	Very high	75 Å²	75	71 Å²	71	77%	0.773	40%	0.395	S	S	*	.	T	Hydrogen-bonded Turn	trans	-85.3	3.8	-178.1	0	0	0	0	0	116.1	E51	E51-G53 VanDerWaalsContact C-N 3.28Å; E51-G53 PolarHBondContact O-N 3.28Å
54	R	94.9	Very high	93.9	Very high	107 Å²	107	76.6 Å²	76.6	40%	0.404	42%	0.421	S	S	.	.	S	Bend	trans	-107.1	159.8	177.2	-65.7	-169.5	-153.5	-163.7	-0	111.1	T22 I23 E51 D52 D58 Y59	T22-R54 WeakPolarHBondContact CA-O 3.39Å; I23-R54 WeakPolarHBondContact CG1-O 3.38Å; I23-R54 PolarHBondContact N-O 3.22Å; E51-R54 PolarHBondContact O-N 2.92Å; E51-R54 IonicContact OE1-NH2 3.92Å; E51-R54 IonicContact OE2-CZ 3.68Å; E51-R54 VanDerWaalsContact OE2-CZ 3.23Å; E51-R54 IonicContact OE2-NE 3.23Å; E51-R54 PolarHBondContact OE2-NE 2.91Å; E51-R54 IonicContact OE2-NH2 2.73Å; E51-R54 PolarHBondContact OE2-NH2 2.85Å; D52-R54 PolarHBondContact O-N 3.17Å; R54-D58 HydrophobicContact CB-CB 4.24Å; R54-Y59 HydrophobicContact CB-CD2 4.3Å; R54-Y59 HydrophobicContact CB-CE2 3.61Å; R54-Y59 HydrophobicContact CG-CE2 4.33Å
55	T	95.4	Very high	93.9	Very high	29 Å²	29	75.1 Å²	75.1	18%	0.178	42%	0.415	C	S	.	.	B	Isolated β-bridge	trans	-91.5	165.2	177.3	63.7	0	0	0	0	111.9	D21 T22 S57 D58 Y59	D21-T55 WeakPolarHBondContact O-CA 3.47Å; T22-T55 HydrophobicContact CG2-CG2 4.47Å; T55-S57 VanDerWaalsContact C-N 3.25Å; T55-S57 PolarHBondContact O-N 3.47Å; T55-S57 PolarHBondContact OG1-OG 3.31Å; T55-D58 PolarHBondContact N-OD2 2.88Å; T55-D58 PolarHBondContact O-N 2.96Å; T55-D58 PolarHBondContact OG1-N 2.89Å; T55-D58 PolarHBondContact OG1-OD1 3.24Å; T55-D58 PolarHBondContact OG1-OD2 3.11Å; T55-Y59 WeakPolarHBondContact O-CD2 3.1Å
56	L	94.8	Very high	93.9	Very high	0 Å²	0	75.8 Å²	75.8	0%	0	42%	0.423	C	S	.	.	T	Hydrogen-bonded Turn	trans	-60.9	-36.6	170.5	-70.5	176.8	0	0	0	111.9	I3 V17 P19 D21 I23 V26 D58 Y59 N60 I61	I3-L56 HydrophobicContact CD1-CD1 4.49Å; V17-L56 HydrophobicContact CB-CD1 3.75Å; V17-L56 HydrophobicContact CG1-CD1 4.41Å; V17-L56 HydrophobicContact CG2-CD1 3.45Å; V17-L56 VanDerWaalsContact CG2-CD1 3.45Å; P19-L56 PolarHBondContact O-N 3.08Å; D21-L56 HydrophobicContact CB-CD1 4.34Å; D21-L56 PolarHBondContact O-N 3.03Å; I23-L56 HydrophobicContact CD1-CD2 3.76Å; I23-L56 HydrophobicContact CD1-CG 4.49Å; V26-L56 HydrophobicContact CG2-CD1 3.9Å; V26-L56 HydrophobicContact CG2-CD2 4.12Å; V26-L56 HydrophobicContact CG2-CG 4.1Å; L56-D58 PolarHBondContact O-N 3.45Å; L56-Y59 PolarHBondContact O-N 3.29Å; L56-N60 PolarHBondContact O-N 3.18Å; L56-I61 HydrophobicContact CB-CB 4.28Å; L56-I61 HydrophobicContact CD2-CB 4.23Å; L56-I61 HydrophobicContact CD2-CD1 3.49Å; L56-I61 VanDerWaalsContact CD2-CD1 3.49Å; L56-I61 HydrophobicContact CD2-CG1 4.44Å; L56-I61 HydrophobicContact CD2-CG2 4.19Å; L56-I61 WeakPolarHBondContact O-CB 3.4Å; L56-I61 PolarHBondContact O-N 3.48Å
57	S	93.7	Very high	94	Very high	54 Å²	54	71.5 Å²	71.5	38%	0.378	39%	0.388	S	S	.	.	G	3₁₀ helix	trans	-62.6	-37	174.9	40.7	0	0	0	0	113.4	P19 T55 Y59 N60	P19-S57 PolarHBondContact O-N 3.36Å; P19-S57 PolarHBondContact O-OG 3.46Å; P19-S57 VanDerWaalsContact O-OG 3.1Å; T55-S57 VanDerWaalsContact C-N 3.25Å; T55-S57 PolarHBondContact O-N 3.47Å; T55-S57 PolarHBondContact OG1-OG 3.31Å; S57-Y59 PolarHBondContact O-N 2.95Å; S57-Y59 VanDerWaalsContact O-N 3.17Å; S57-N60 PolarHBondContact O-N 3.17Å
58	D	93.8	Very high	94.2	Very high	97 Å²	97	72.3 Å²	72.3	52%	0.519	37%	0.372	S	S	.	.	G	3₁₀ helix	trans	-62.8	-25.8	179.8	-63	-35.9	0	0	0	112.7	R54 T55 L56	R54-D58 HydrophobicContact CB-CB 4.24Å; T55-D58 PolarHBondContact N-OD2 2.88Å; T55-D58 PolarHBondContact O-N 2.96Å; T55-D58 PolarHBondContact OG1-N 2.89Å; T55-D58 PolarHBondContact OG1-OD1 3.24Å; T55-D58 PolarHBondContact OG1-OD2 3.11Å; L56-D58 PolarHBondContact O-N 3.45Å
59	Y	94.4	Very high	94.3	Very high	38 Å²	38	65.6 Å²	65.6	15%	0.149	34%	0.343	C	S	.	.	G	3₁₀ helix	trans	-97.7	8.1	176.2	-69.9	-72.6	0	0	0	113.4	I23 L50 E51 R54 T55 L56 S57 I61	I23-Y59 HydrophobicContact CD1-CD2 4.44Å; I23-Y59 HydrophobicContact CG1-CD2 4.49Å; I23-Y59 HydrophobicContact CG1-CE2 4.21Å; L50-Y59 HydrophobicContact CB-CE2 4.18Å; L50-Y59 HydrophobicContact CD2-CD1 3.63Å; L50-Y59 HydrophobicContact CD2-CD2 3.71Å; L50-Y59 HydrophobicContact CD2-CE1 3.67Å; L50-Y59 HydrophobicContact CD2-CE2 3.71Å; L50-Y59 HydrophobicContact CD2-CG 3.64Å; L50-Y59 HydrophobicContact CG-CE2 4.46Å; E51-Y59 PolarHBondContact N-OH 3.18Å; R54-Y59 HydrophobicContact CB-CD2 4.3Å; R54-Y59 HydrophobicContact CB-CE2 3.61Å; R54-Y59 HydrophobicContact CG-CE2 4.33Å; T55-Y59 WeakPolarHBondContact O-CD2 3.1Å; L56-Y59 PolarHBondContact O-N 3.29Å; S57-Y59 PolarHBondContact O-N 2.95Å; S57-Y59 VanDerWaalsContact O-N 3.17Å; Y59-I61 PolarHBondContact O-N 3.11Å
60	N	93.8	Very high	94.2	Very high	132 Å²	132	63 Å²	63	71%	0.706	33%	0.334	S	S	*	.	T	Hydrogen-bonded Turn	trans	52.6	38.4	-175	-65.6	-46.8	0	0	0	112.7	L56 S57 Q62	L56-N60 PolarHBondContact O-N 3.18Å; S57-N60 PolarHBondContact O-N 3.17Å; N60-Q62 PolarHBondContact O-N 2.63Å
61	I	94.5	Very high	93.9	Very high	5 Å²	5	66.6 Å²	66.6	3%	0.026	35%	0.352	C	S	.	.	P	Polyproline II helix	trans	-78.3	117.4	177.7	-63.9	168.2	0	0	0	108.3	I3 F45 L50 L56 Y59 L67	I3-I61 HydrophobicContact CG2-CG2 4.14Å; F45-I61 HydrophobicContact CD1-CD1 4.3Å; F45-I61 HydrophobicContact CD1-CG1 3.79Å; F45-I61 HydrophobicContact CE1-CG1 3.85Å; F45-I61 HydrophobicContact CG-CD1 4.41Å; F45-I61 HydrophobicContact CG-CG1 4.22Å; F45-I61 HydrophobicContact CZ-CG1 4.34Å; L50-I61 HydrophobicContact CD1-CD1 3.92Å; L56-I61 HydrophobicContact CB-CB 4.28Å; L56-I61 HydrophobicContact CD2-CB 4.23Å; L56-I61 HydrophobicContact CD2-CD1 3.49Å; L56-I61 VanDerWaalsContact CD2-CD1 3.49Å; L56-I61 HydrophobicContact CD2-CG1 4.44Å; L56-I61 HydrophobicContact CD2-CG2 4.19Å; L56-I61 WeakPolarHBondContact O-CB 3.4Å; L56-I61 PolarHBondContact O-N 3.48Å; Y59-I61 PolarHBondContact O-N 3.11Å; I61-L67 HydrophobicContact CD1-CD2 4.18Å
62	Q	93.3	Very high	93.3	Very high	143 Å²	143	67.9 Å²	67.9	67%	0.668	35%	0.353	S	S	*	.	P	Polyproline II helix	trans	-101.7	173.8	-178.4	-63.7	-174.6	-10	0	0	111.6	N60 E64 S65	N60-Q62 PolarHBondContact O-N 2.63Å; Q62-E64 PolarHBondContact O-N 3.27Å; Q62-S65 PolarHBondContact N-OG 2.96Å; Q62-S65 VanDerWaalsContact N-OG 3.08Å; Q62-S65 VanDerWaalsContact O-CB 3.23Å; Q62-S65 WeakPolarHBondContact O-CB 3.39Å; Q62-S65 PolarHBondContact O-N 3.3Å; Q62-S65 PolarHBondContact O-OG 3.21Å
63	K	93.8	Very high	92.3	Very high	131 Å²	131	72.1 Å²	72.1	57%	0.57	38%	0.375	S	S	*	.	T	Hydrogen-bonded Turn	trans	-52.2	140.7	169.6	-176.4	-179.2	173.4	-163.4	0	109.7	M1 S65	M1-K63 HydrophobicContact CB-CB 4.29Å; K63-S65 PolarHBondContact O-N 3.31Å
64	E	93.4	Very high	91.1	Very high	118 Å²	118	77.1 Å²	77.1	55%	0.551	37%	0.37	S	S	*	.	T	Hydrogen-bonded Turn	trans	66.2	10.2	-179.7	-67.6	156.5	-149	0	0	115.6	Q2 F4 Q62	Q2-E64 PolarHBondContact O-N 3.48Å; F4-E64 HydrophobicContact CE2-CB 3.99Å; F4-E64 HydrophobicContact CE2-CG 3.97Å; Q62-E64 PolarHBondContact O-N 3.27Å
65	S	95.6	Very high	89.5	Confident	20 Å²	20	75.4 Å²	75.4	14%	0.14	39%	0.386	C	S	.	.	P	Polyproline II helix	trans	-64.8	142.9	172.6	-62.4	0	0	0	0	112.1	F4 Q62 K63	F4-S65 PolarHBondContact N-O 2.78Å; Q62-S65 PolarHBondContact N-OG 2.96Å; Q62-S65 VanDerWaalsContact N-OG 3.08Å; Q62-S65 VanDerWaalsContact O-CB 3.23Å; Q62-S65 WeakPolarHBondContact O-CB 3.39Å; Q62-S65 PolarHBondContact O-N 3.3Å; Q62-S65 PolarHBondContact O-OG 3.21Å; K63-S65 PolarHBondContact O-N 3.31Å
66	T	95.6	Very high	88.1	Confident	61 Å²	61	77.7 Å²	77.7	37%	0.374	42%	0.415	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104	117.8	177	63.2	0	0	0	0	111.4	F4 F45	F4-T66 HydrophobicContact CB-CG2 4.05Å; F4-T66 HydrophobicContact CD2-CG2 4.37Å; F4-T66 CarbonylContact O-C 3.58Å; F4-T66 WeakPolarHBondContact O-CA 3.41Å; F45-T66 WeakPolarHBondContact CD2-O 3.34Å
67	L	96.1	Very high	87	Confident	0 Å²	0	82 Å²	82	0%	0	45%	0.45	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95	150.7	168.2	-62.7	101.8	0	0	0	111.1	I3 F4 V5 K6 L43 F45 L50 I61	I3-L67 HydrophobicContact CB-CD1 4.35Å; I3-L67 HydrophobicContact CD1-CD1 3.69Å; I3-L67 HydrophobicContact CG1-CD1 4.45Å; F4-L67 PolarHBondContact O-N 3.48Å; V5-L67 CarbonylContact C-O 3.6Å; V5-L67 WeakPolarHBondContact CA-O 3.29Å; V5-L67 HydrophobicContact CG2-CB 4.47Å; K6-L67 PolarHBondContact N-O 2.7Å; L43-L67 HydrophobicContact CB-CD2 4.3Å; F45-L67 HydrophobicContact CB-CD2 4.38Å; F45-L67 HydrophobicContact CB-CG 4.49Å; F45-L67 HydrophobicContact CD2-CG 4.5Å; L50-L67 HydrophobicContact CD1-CD2 3.32Å; I61-L67 HydrophobicContact CD1-CD2 4.18Å
68	H	96	Very high	85.9	Confident	90 Å²	90	89.5 Å²	89.5	42%	0.417	48%	0.476	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103	124	171.9	-65.7	-79.1	0	0	0	110.3	K6 L43 I44	K6-H68 CarbonylContact O-C 3.54Å; K6-H68 WeakPolarHBondContact O-CA 3.31Å; L43-H68 WeakPolarHBondContact CA-O 3.33Å; I44-H68 HydrophobicContact CB-CB 4.3Å; I44-H68 PolarHBondContact N-O 2.92Å; I44-H68 PolarHBondContact O-N 2.79Å
69	L	94.3	Very high	85	Confident	7 Å²	7	94.4 Å²	94.4	4%	0.037	49%	0.493	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.3	118.4	173.4	177.9	66.1	0	0	0	110.1	V5 K6 T7 I30 I36 Q41 L43	V5-L69 HydrophobicContact CG1-CB 3.64Å; K6-L69 PolarHBondContact O-N 2.77Å; T7-L69 HydrophobicContact CG2-CD2 4.22Å; I30-L69 HydrophobicContact CG2-CD2 3.8Å; I36-L69 HydrophobicContact CD1-CD2 4.18Å; Q41-L69 HydrophobicContact CB-CD1 3.75Å; Q41-L69 HydrophobicContact CG-CD1 3.95Å; L43-L69 HydrophobicContact CD2-CB 4.2Å; L43-L69 HydrophobicContact CD2-CD1 3.83Å
70	V	91.7	Very high	84.2	Confident	41 Å²	41	104 Å²	104	25%	0.248	53%	0.529	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.6	138.8	174.3	-176	0	0	0	0	108.8	L8 R42 I44	L8-V70 HydrophobicContact CD1-CG1 4.2Å; L8-V70 HydrophobicContact CD2-CG1 4.41Å; L8-V70 HydrophobicContact CD2-CG2 4.05Å; R42-V70 WeakPolarHBondContact CA-O 3.42Å; R42-V70 HydrophobicContact CB-CB 4.35Å; R42-V70 WeakPolarHBondContact CB-O 3.43Å; R42-V70 PolarHBondContact N-O 3.05Å; R42-V70 PolarHBondContact O-N 3.32Å; I44-V70 HydrophobicContact CD1-CB 4.45Å; I44-V70 HydrophobicContact CD1-CG2 3.69Å
71	L	88.5	Confident	83.7	Confident	78 Å²	78	107.3 Å²	107.3	41%	0.408	54%	0.537	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.7	132.5	175.7	-69.6	174.7	0	0	0	111	I36 Q40 L73	I36-L71 HydrophobicContact CD1-CD2 4.09Å; I36-L71 HydrophobicContact CG1-CD2 4.49Å; I36-L71 HydrophobicContact CG2-CD2 3.49Å; I36-L71 VanDerWaalsContact CG2-CD2 3.49Å; Q40-L71 CarbonylContact O-C 3.51Å; Q40-L71 WeakPolarHBondContact O-CA 3.47Å; L71-L73 PolarHBondContact O-N 2.84Å
72	R	81	Confident	83.3	Confident	130 Å²	130	117 Å²	117	49%	0.491	58%	0.579	S	S	.	*			trans	-70.8	99	167.8	-166.2	171.6	-170.2	128.1	-3	107.2	D39 Q40 R42 R74	D39-R72 WeakPolarHBondContact O-CD 3.41Å; Q40-R72 PolarHBondContact O-N 3.04Å; R42-R72 HydrophobicContact CG-CB 4.26Å; R72-R74 PolarHBondContact O-N 2.73Å
73	L	71.7	Confident	83	Confident	159 Å²	159	117.8 Å²	117.8	83%	0.832	58%	0.58	S	S	*	*			trans	-56.9	106.9	175.4	-60.1	176.6	0	0	0	108.6	L71 G75	L71-L73 PolarHBondContact O-N 2.84Å; L73-G75 PolarHBondContact O-N 3.11Å; L73-G75 VanDerWaalsContact O-N 3.11Å
74	R	66.3	Low	82.8	Confident	180 Å²	180	116.8 Å²	116.8	68%	0.679	59%	0.589	S	S	*	*			trans	-64.3	113.2	166.7	-86.5	-176.5	178.8	178.4	1	106.3	D39 R72 G76	D39-R74 IonicContact OD2-CZ 2.63Å; D39-R74 IonicContact OD2-NE 2.92Å; D39-R74 IonicContact OD2-NH2 3.3Å; D39-R74 PolarHBondContact OD2-NH2 3.46Å; R72-R74 PolarHBondContact O-N 2.73Å; R74-G76 PolarHBondContact O-N 2.89Å
75	G	62.9	Low	82.6	Confident	71 Å²	71	120 Å²	120	73%	0.732	60%	0.598	S	S	*	*			trans	-47.5	139.1	173.9	0	0	0	0	0	110.7	L73 A77	L73-G75 PolarHBondContact O-N 3.11Å; L73-G75 VanDerWaalsContact O-N 3.11Å; G75-A77 PolarHBondContact O-N 3.4Å
76	G	65.9	Low	82.4	Confident	76 Å²	76	125.3 Å²	125.3	78%	0.784	63%	0.63	S	S	*	*			trans	-46.5	133.1	-169.5	0	0	0	0	0	113	R74 K78	R74-G76 PolarHBondContact O-N 2.89Å; G76-K78 PolarHBondContact O-N 2.87Å
77	A	70.6	Confident	82.2	Confident	91 Å²	91	127.4 Å²	127.4	75%	0.752	64%	0.643	S	S	*	*			trans	-42.7	136	-179.9	0	0	0	0	0	111.6	G75 K79	G75-A77 PolarHBondContact O-N 3.4Å; A77-K79 PolarHBondContact O-N 3.42Å
78	K	70	Confident	82	Confident	212 Å²	212	133 Å²	133	92%	0.922	68%	0.679	S	S	*	*			trans	-48.8	107.4	-179.6	-77.4	-179	179	171.9	0	109.8	G76 R80	G76-K78 PolarHBondContact O-N 2.87Å; K78-R80 PolarHBondContact O-N 3.23Å
79	K	75.6	Confident	81.9	Confident	199 Å²	199	137.5 Å²	137.5	87%	0.865	70%	0.697	S	S	*	*	P	Polyproline II helix	trans	-63.2	136.8	179	-67.2	-175.7	178.9	178	0	109.1	A77 K81	A77-K79 PolarHBondContact O-N 3.42Å; K79-K81 PolarHBondContact O-N 3.5Å
80	R	77.9	Confident	81.9	Confident	239 Å²	239	146 Å²	146	90%	0.902	73%	0.734	S	S	*	*	P	Polyproline II helix	trans	-56.2	127.5	173.6	-75.4	178.7	88	173.8	9.4	108.8	K78	K78-R80 PolarHBondContact O-N 3.23Å
81	K	83.4	Confident	81.9	Confident	202 Å²	202	152 Å²	152	88%	0.878	77%	0.765	S	S	*	*	P	Polyproline II helix	trans	-60.8	138.9	174.4	-68	-176.4	178	-177.6	0	109.4	K79	K79-K81 PolarHBondContact O-N 3.5Å
82	K	86.1	Confident	82.2	Confident	208 Å²	208	156.8 Å²	156.8	90%	0.904	78%	0.782	S	S	*	*	P	Polyproline II helix	trans	-62.7	138.4	173	-71	-176.6	179.7	178.6	0	109.2	S84	K82-S84 PolarHBondContact O-N 3.46Å
83	K	87.3	Confident	82.8	Confident	161 Å²	161	158.5 Å²	158.5	70%	0.7	80%	0.795	S	S	*	*	P	Polyproline II helix	trans	-68.7	128.3	172.6	-66.5	-179.3	179.4	179.7	0	108.7	Y85	K83-Y85 HydrophobicContact CB-CE2 4.15Å
84	S	89.8	Confident	83.8	Confident	109 Å²	109	159.2 Å²	159.2	76%	0.762	79%	0.792	S	S	*	*	P	Polyproline II helix	trans	-101.6	118.4	169.5	-174.7	0	0	0	0	108.5	K82	K82-S84 PolarHBondContact O-N 3.46Å
85	Y	88	Confident	85	Confident	186 Å²	186	161.6 Å²	161.6	73%	0.729	80%	0.801	S	S	*	*			trans	-94.8	114.3	177.5	-61	-78.3	0	0	0	108.8	K83	K83-Y85 HydrophobicContact CB-CE2 4.15Å
86	T	91.4	Very high	86.4	Confident	132 Å²	132	167.4 Å²	167.4	81%	0.81	81%	0.806	S	S	*	*			trans	-85.6	-18.2	-179.3	53	0	0	0	0	113.3
87	T	91.9	Very high	87.5	Confident	105 Å²	105	173.6 Å²	173.6	64%	0.644	81%	0.811	S	S	*	*	S	Bend	trans	-125	142.8	-177	52.4	0	0	0	0	111.1
88	P	92.7	Very high	88.4	Confident	116 Å²	116	173.9 Å²	173.9	75%	0.753	80%	0.803	S	S	*	*	P	Polyproline II helix	trans	-66.3	148.5	177.1	28	-34.1	0	0	0	110.6	K90	P88-K90 PolarHBondContact O-N 3.47Å
89	K	92.8	Very high	89.5	Confident	186 Å²	186	173 Å²	173	81%	0.809	80%	0.799	S	S	*	*	P	Polyproline II helix	trans	-68.8	122.8	178.4	-172.8	65	177.1	-177.3	0	110.1
90	K	94.1	Very high	90.1	Very high	186 Å²	186	169.9 Å²	169.9	81%	0.809	79%	0.791	S	S	*	*	P	Polyproline II helix	trans	-70.3	134.2	176.2	-63.1	-176.3	-179.6	-178.2	0	111.5	P88 K92	P88-K90 PolarHBondContact O-N 3.47Å; K90-K92 PolarHBondContact O-N 3.29Å
91	N	92.6	Very high	90.5	Very high	167 Å²	167	159.9 Å²	159.9	89%	0.893	76%	0.76	S	S	*	*	P	Polyproline II helix	trans	-67.3	127	170.3	-75.1	-29.6	0	0	0	110
92	K	94.1	Very high	90.6	Very high	178 Å²	178	154.3 Å²	154.3	77%	0.774	74%	0.743	S	S	*	*	P	Polyproline II helix	trans	-77.8	138.4	177.9	-65.4	-173.3	178.3	-175	0	110.3	K90 K94	K90-K92 PolarHBondContact O-N 3.29Å; K92-K94 PolarHBondContact O-N 3.48Å
93	H	94.2	Very high	90.7	Very high	166 Å²	166	149.5 Å²	149.5	77%	0.769	73%	0.726	S	S	*	*	P	Polyproline II helix	trans	-61.5	128.7	171.9	175.6	-97.8	0	0	0	110.3
94	K	92.8	Very high	90.7	Very high	173 Å²	173	149 Å²	149	75%	0.752	72%	0.724	S	S	*	*			trans	-120.2	126.7	173.3	-67.3	-175.4	177.9	-177.8	0	108.3	K92 K96	K92-K94 PolarHBondContact O-N 3.48Å; K94-K96 PolarHBondContact O-N 3.3Å
95	R	90.9	Very high	90.6	Very high	231 Å²	231	146.3 Å²	146.3	87%	0.872	70%	0.698	S	S	*	*	P	Polyproline II helix	trans	-66.2	121.3	176.1	-70.9	-176.7	177.1	175.7	-0.6	109.4
96	K	91.6	Very high	90.8	Very high	193 Å²	193	141.2 Å²	141.2	84%	0.839	68%	0.678	S	S	*	*	P	Polyproline II helix	trans	-100.4	123	171	-66.1	-177.2	-179.7	-179.4	0	108.7	K94	K94-K96 PolarHBondContact O-N 3.3Å
97	K	89.3	Confident	90.8	Very high	206 Å²	206	140.5 Å²	140.5	90%	0.896	66%	0.663	S	S	*	*	P	Polyproline II helix	trans	-83.6	122.2	175.6	-67.6	-173.6	179.7	-177.9	0	109.3
98	V	90.6	Very high	90.8	Very high	97 Å²	97	140.1 Å²	140.1	59%	0.588	66%	0.661	S	S	*	*	P	Polyproline II helix	trans	-88.8	119	171.1	-179.9	0	0	0	0	107.7	A101	V98-A101 HydrophobicContact CB-CB 4.15Å; V98-A101 HydrophobicContact CG1-CB 4.28Å; V98-A101 WeakPolarHBondContact O-CB 3.48Å; V98-A101 PolarHBondContact O-N 3.37Å
99	K	92.5	Very high	90.8	Very high	192 Å²	192	137.9 Å²	137.9	84%	0.835	64%	0.642	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.1	139.6	178.6	-65.1	-176.5	-179.9	-179.2	0	109.6	A101	K99-A101 PolarHBondContact O-N 3.45Å; K99-A101 VanDerWaalsContact O-N 3.11Å
100	L	88.1	Confident	90.8	Very high	134 Å²	134	138.5 Å²	138.5	70%	0.702	65%	0.648	S	S	*	*	T	Hydrogen-bonded Turn	trans	55.9	24.8	177.5	-57	174	0	0	0	115.2	V102 L103	L100-V102 PolarHBondContact O-N 3.21Å; L100-V102 VanDerWaalsContact O-N 3.11Å; L100-L103 HydrophobicContact CB-CD1 4.17Å; L100-L103 HydrophobicContact CD1-CD1 4.38Å; L100-L103 HydrophobicContact CD2-CD1 4.02Å; L100-L103 HydrophobicContact CG-CD1 4.42Å; L100-L103 PolarHBondContact O-N 3.05Å; L100-L103 VanDerWaalsContact O-N 3.15Å
101	A	87.3	Confident	90.7	Very high	29 Å²	29	136.5 Å²	136.5	24%	0.24	65%	0.646	C	S	.	*	G	3₁₀ helix	trans	-58.4	-28.1	-179.2	0	0	0	0	0	114	V98 K99 K104	V98-A101 HydrophobicContact CB-CB 4.15Å; V98-A101 HydrophobicContact CG1-CB 4.28Å; V98-A101 WeakPolarHBondContact O-CB 3.48Å; V98-A101 PolarHBondContact O-N 3.37Å; K99-A101 PolarHBondContact O-N 3.45Å; K99-A101 VanDerWaalsContact O-N 3.11Å; A101-K104 WeakPolarHBondContact O-CB 3.42Å; A101-K104 PolarHBondContact O-N 3.11Å
102	V	85.2	Confident	90.6	Very high	85 Å²	85	131 Å²	131	52%	0.515	63%	0.63	S	S	.	*	G	3₁₀ helix	trans	-70.4	-32.1	-179.3	-179.8	0	0	0	0	112.3	L100 K104 Y105 Y106	L100-V102 PolarHBondContact O-N 3.21Å; L100-V102 VanDerWaalsContact O-N 3.11Å; V102-K104 PolarHBondContact O-N 3.11Å; V102-Y105 HydrophobicContact CG1-CD2 4.28Å; V102-Y105 WeakPolarHBondContact O-CB 3.45Å; V102-Y105 WeakPolarHBondContact O-CD2 3.44Å; V102-Y105 PolarHBondContact O-N 3.15Å; V102-Y106 HydrophobicContact CG1-CE2 4.22Å
103	L	87.4	Confident	90.6	Very high	108 Å²	108	129.5 Å²	129.5	57%	0.565	62%	0.623	S	S	*	*	G	3₁₀ helix	trans	-64.7	-24.4	179.3	-67.6	-178.3	0	0	0	112.3	L100 Y105 Y106	L100-L103 HydrophobicContact CB-CD1 4.17Å; L100-L103 HydrophobicContact CD1-CD1 4.38Å; L100-L103 HydrophobicContact CD2-CD1 4.02Å; L100-L103 HydrophobicContact CG-CD1 4.42Å; L100-L103 PolarHBondContact O-N 3.05Å; L100-L103 VanDerWaalsContact O-N 3.15Å; L103-Y105 PolarHBondContact O-N 2.83Å; L103-Y106 PolarHBondContact O-N 3.31Å; L103-Y106 VanDerWaalsContact O-N 3.14Å
104	K	86.8	Confident	90.3	Very high	151 Å²	151	127.1 Å²	127.1	66%	0.657	62%	0.615	S	S	*	*	G	3₁₀ helix	trans	-63.1	-11.5	174.5	-60.6	-173	176.3	-170.7	0	113.6	A101 V102	A101-K104 WeakPolarHBondContact O-CB 3.42Å; A101-K104 PolarHBondContact O-N 3.11Å; V102-K104 PolarHBondContact O-N 3.11Å
105	Y	89.4	Confident	90.2	Very high	51 Å²	51	121 Å²	121	20%	0.2	59%	0.593	C	S	.	*	G	3₁₀ helix	trans	-93.3	-2.6	-179.5	-48.3	-26.4	0	0	0	112.6	V102 L103 L117 R118 F131	V102-Y105 HydrophobicContact CG1-CD2 4.28Å; V102-Y105 WeakPolarHBondContact O-CB 3.45Å; V102-Y105 WeakPolarHBondContact O-CD2 3.44Å; V102-Y105 PolarHBondContact O-N 3.15Å; L103-Y105 PolarHBondContact O-N 2.83Å; Y105-L117 PolarHBondContact O-N 3.13Å; Y105-R118 HydrophobicContact CD1-CG 4.23Å; Y105-R118 HydrophobicContact CG-CG 4.4Å; Y105-R118 PolarHBondContact OH-NH1 3.4Å; Y105-R118 VanDerWaalsContact OH-NH1 3.16Å; Y105-F131 HydrophobicContact CD2-CB 4.3Å; Y105-F131 AromaticContact CD2-CD2 3.78Å; Y105-F131 HydrophobicContact CD2-CD2 3.78Å; Y105-F131 HydrophobicContact CD2-CE2 4.44Å; Y105-F131 HydrophobicContact CD2-CG 4.15Å
106	Y	90.4	Very high	90.1	Very high	79 Å²	79	116.6 Å²	116.6	31%	0.31	58%	0.577	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-118.6	142.9	178.5	-60.8	-87	0	0	0	109.6	V102 L103 I114 S115 R116 F131	V102-Y106 HydrophobicContact CG1-CE2 4.22Å; L103-Y106 PolarHBondContact O-N 3.31Å; L103-Y106 VanDerWaalsContact O-N 3.14Å; Y106-I114 HydrophobicContact CD1-CG2 3.71Å; Y106-I114 HydrophobicContact CG-CG2 4.38Å; Y106-S115 CarbonylContact C-O 3.59Å; Y106-S115 WeakPolarHBondContact CA-O 3.42Å; Y106-R116 HydrophobicContact CD1-CG 4.04Å; Y106-R116 HydrophobicContact CE1-CG 3.9Å; Y106-F131 HydrophobicContact CE1-CZ 4Å; Y106-F131 HydrophobicContact CE2-CE2 4.04Å; Y106-F131 HydrophobicContact CE2-CZ 4.19Å; Y106-F131 AromaticContact CZ-CE2 3.75Å; Y106-F131 AromaticContact CZ-CZ 3.56Å; Y106-F131 VanDerWaalsContact OH-CE2 3.3Å; Y106-F131 WeakPolarHBondContact OH-CE2 3.4Å; Y106-F131 VanDerWaalsContact OH-CZ 3.26Å; Y106-F131 WeakPolarHBondContact OH-CZ 3.4Å
107	K	91.7	Very high	90	Very high	117 Å²	117	112.6 Å²	112.6	51%	0.509	56%	0.564	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-120.1	131.8	169.2	-179.4	-176.9	178.2	-169.3	0	107.6	I114 S115 L117	K107-I114 WeakPolarHBondContact O-CA 3.34Å; K107-S115 PolarHBondContact N-O 3.28Å; K107-S115 PolarHBondContact O-N 3.04Å; K107-S115 PolarHBondContact O-OG 3.42Å; K107-L117 HydrophobicContact CB-CD1 4.29Å; K107-L117 HydrophobicContact CB-CD2 4.16Å; K107-L117 HydrophobicContact CB-CG 4.24Å
108	V	92.5	Very high	90	Very high	98 Å²	98	106.4 Å²	106.4	59%	0.594	54%	0.535	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-104.7	125	176.5	-171.7	0	0	0	0	107.1	K113 I114	V108-K113 WeakPolarHBondContact CA-O 3.42Å; V108-I114 HydrophobicContact CG2-CG1 4.36Å
109	D	92.9	Very high	89.9	Confident	68 Å²	68	108 Å²	108	36%	0.364	53%	0.53	S	S	.	.			trans	-83.1	164.8	175	-61.1	-35.9	0	0	0	110.4	N111 G112 K113	D109-N111 PolarHBondContact O-N 2.8Å; D109-N111 VanDerWaalsContact O-N 3.11Å; D109-G112 PolarHBondContact O-N 3.39Å; D109-K113 PolarHBondContact N-O 2.99Å
110	E	92.4	Very high	89.8	Confident	200 Å²	200	101.5 Å²	101.5	94%	0.935	50%	0.503	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.7	-29.1	-178	-65.9	174.5	-179	0	0	113.2	G112	E110-G112 PolarHBondContact O-N 3.43Å
111	N	92.6	Very high	89.9	Confident	143 Å²	143	95.6 Å²	95.6	77%	0.765	47%	0.473	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.5	8	176.5	-62.9	-38.6	0	0	0	113.6	D109 K113	D109-N111 PolarHBondContact O-N 2.8Å; D109-N111 VanDerWaalsContact O-N 3.11Å; N111-K113 VanDerWaalsContact C-N 3.26Å; N111-K113 PolarHBondContact O-N 3.3Å
112	G	90.4	Very high	90	Very high	53 Å²	53	97.3 Å²	97.3	55%	0.546	48%	0.482	S	S	.	.	S	Bend	trans	75.4	7.5	-178.6	0	0	0	0	0	115	D109 E110	D109-G112 PolarHBondContact O-N 3.39Å; E110-G112 PolarHBondContact O-N 3.43Å
113	K	92.9	Very high	90.2	Very high	146 Å²	146	94.8 Å²	94.8	64%	0.635	47%	0.467	S	S	*	.			trans	-74.1	138.4	173.9	-66.3	-176.7	-178.1	177.9	0	110	V108 D109 N111	V108-K113 WeakPolarHBondContact CA-O 3.42Å; D109-K113 PolarHBondContact N-O 2.99Å; N111-K113 VanDerWaalsContact C-N 3.26Å; N111-K113 PolarHBondContact O-N 3.3Å
114	I	89.7	Confident	90	Very high	116 Å²	116	97.6 Å²	97.6	60%	0.595	48%	0.483	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-105.4	123.1	-178.9	-58.3	172.5	0	0	0	109.3	Y106 K107 V108	Y106-I114 HydrophobicContact CD1-CG2 3.71Å; Y106-I114 HydrophobicContact CG-CG2 4.38Å; K107-I114 WeakPolarHBondContact O-CA 3.34Å; V108-I114 HydrophobicContact CG2-CG1 4.36Å
115	S	89.4	Confident	90	Very high	43 Å²	43	97.5 Å²	97.5	30%	0.301	49%	0.485	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.7	143.1	171.1	55.2	0	0	0	0	110.9	Y106 K107	Y106-S115 CarbonylContact C-O 3.59Å; Y106-S115 WeakPolarHBondContact CA-O 3.42Å; K107-S115 PolarHBondContact N-O 3.28Å; K107-S115 PolarHBondContact O-N 3.04Å; K107-S115 PolarHBondContact O-OG 3.42Å
116	R	89.3	Confident	89.7	Confident	140 Å²	140	95.3 Å²	95.3	53%	0.528	48%	0.477	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95	130.1	178.2	-63.5	170.3	-175.4	172.6	-7.9	109.3	Y106 E120 F131	Y106-R116 HydrophobicContact CD1-CG 4.04Å; Y106-R116 HydrophobicContact CE1-CG 3.9Å; R116-E120 IonicContact CZ-OE1 3.75Å; R116-E120 IonicContact CZ-OE2 2.84Å; R116-E120 IonicContact NE-OE1 3.72Å; R116-E120 IonicContact NH1-OE1 3.14Å; R116-E120 PolarHBondContact NH1-OE1 2.87Å; R116-E120 IonicContact NH1-OE2 3.78Å; R116-E120 PolarHBondContact NH1-OE2 3.47Å; R116-E120 IonicContact NH2-OE1 2.89Å; R116-F131 HydrophobicContact CB-CE1 4.39Å; R116-F131 HydrophobicContact CG-CE1 4.34Å
117	L	88.3	Confident	89.2	Confident	108 Å²	108	93.8 Å²	93.8	57%	0.565	49%	0.485	S	S	*	.	S	Bend	trans	-91.3	-9	-179.7	-61.3	177.1	0	0	0	113.2	Y105 K107	Y105-L117 PolarHBondContact O-N 3.13Å; K107-L117 HydrophobicContact CB-CD1 4.29Å; K107-L117 HydrophobicContact CB-CD2 4.16Å; K107-L117 HydrophobicContact CB-CG 4.24Å
118	R	89.6	Confident	88.8	Confident	76 Å²	76	92.7 Å²	92.7	29%	0.287	50%	0.498	S	S	.	.	S	Bend	trans	-126.5	149.6	178.4	-72.5	-169.6	174.2	-179.3	-1.8	111.7	Y105 F131	Y105-R118 HydrophobicContact CD1-CG 4.23Å; Y105-R118 HydrophobicContact CG-CG 4.4Å; Y105-R118 PolarHBondContact OH-NH1 3.4Å; Y105-R118 VanDerWaalsContact OH-NH1 3.16Å; R118-F131 HydrophobicContact CB-CB 4.05Å; R118-F131 HydrophobicContact CB-CD1 3.83Å; R118-F131 HydrophobicContact CB-CG 4.21Å; R118-F131 WeakPolarHBondContact O-CD1 3.44Å
119	R	88.4	Confident	88.4	Confident	131 Å²	131	89.8 Å²	89.8	49%	0.494	49%	0.488	S	S	.	.	P	Polyproline II helix	trans	-70.3	135.2	174.7	-170.6	178.1	-177.6	176.7	2	110.8	F131 M132	R119-F131 WeakPolarHBondContact O-CA 3.49Å; R119-M132 PolarHBondContact O-N 3.43Å
120	E	90.3	Very high	88.2	Confident	56 Å²	56	88.2 Å²	88.2	26%	0.262	48%	0.481	S	S	.	.	B	Isolated β-bridge	trans	-77.4	146.4	170	-68.3	-175.2	149.7	0	0	110.7	R116 G129 V130 F131	R116-E120 IonicContact CZ-OE1 3.75Å; R116-E120 IonicContact CZ-OE2 2.84Å; R116-E120 IonicContact NE-OE1 3.72Å; R116-E120 IonicContact NH1-OE1 3.14Å; R116-E120 PolarHBondContact NH1-OE1 2.87Å; R116-E120 IonicContact NH1-OE2 3.78Å; R116-E120 PolarHBondContact NH1-OE2 3.47Å; R116-E120 IonicContact NH2-OE1 2.89Å; E120-G129 PolarHBondContact OE1-N 2.79Å; E120-V130 WeakPolarHBondContact CA-O 3.44Å; E120-F131 HydrophobicContact CG-CD1 4.01Å; E120-F131 HydrophobicContact CG-CE1 3.76Å
121	C	90.9	Very high	88.2	Confident	9 Å²	9	80 Å²	80	6%	0.061	44%	0.442	C	S	.	.	P	Polyproline II helix	trans	-69.7	128.2	176.7	-172.7	0	0	0	0	109.8	S123 C126 V130 M132 C141 C144	C121-S123 VanDerWaalsContact C-N 3.28Å; C121-S123 PolarHBondContact O-N 3.25Å; C121-C126 HydrophobicContact CB-CB 3.72Å; C121-V130 HydrophobicContact CB-CG1 4.12Å; C121-V130 PolarHBondContact N-O 2.92Å; C121-M132 HydrophobicContact CB-CG 4.01Å; C121-C141 HydrophobicContact CB-CB 4.27Å; C121-C144 PolarHBondContact SG-SG 2.83Å
122	P	89.8	Confident	88.2	Confident	66 Å²	66	73.1 Å²	73.1	43%	0.429	41%	0.406	S	S	.	.			trans	-83.9	0.1	-178.7	33.7	-35.9	0	0	0	113.9	L146 Y148	P122-L146 HydrophobicContact CG-CD2 3.99Å; P122-Y148 HydrophobicContact CG-CE2 3.86Å; P122-Y148 WeakPolarHBondContact CG-OH 3.13Å
123	S	88.3	Confident	88.3	Confident	31 Å²	31	72 Å²	72	22%	0.217	39%	0.391	C	S	.	.			trans	-70.9	134.3	179.7	172.2	0	0	0	0	110	C121 E125 C126	C121-S123 VanDerWaalsContact C-N 3.28Å; C121-S123 PolarHBondContact O-N 3.25Å; S123-E125 PolarHBondContact O-N 2.78Å; S123-E125 VanDerWaalsContact O-N 3.13Å; S123-C126 CarbonylContact O-C 3.42Å; S123-C126 WeakPolarHBondContact O-CA 3.41Å; S123-C126 WeakPolarHBondContact O-CB 3.33Å; S123-C126 PolarHBondContact O-N 3.16Å; S123-C126 VanDerWaalsContact O-O 3.1Å
124	D	84.7	Confident	88.1	Confident	167 Å²	167	67.9 Å²	67.9	89%	0.893	38%	0.381	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.3	-25.5	-180	-60.1	-39.8	0	0	0	112.9	C126	D124-C126 PolarHBondContact O-N 3.14Å
125	E	85.1	Confident	88.2	Confident	149 Å²	149	66.5 Å²	66.5	70%	0.696	37%	0.371	S	S	*	.	T	Hydrogen-bonded Turn	trans	-72.1	-18.7	173.7	-58.4	-175.8	169.9	0	0	112.9	S123 K143	S123-E125 PolarHBondContact O-N 2.78Å; S123-E125 VanDerWaalsContact O-N 3.13Å; E125-K143 PolarHBondContact O-NZ 3.06Å
126	C	84.7	Confident	88.2	Confident	6 Å²	6	74.1 Å²	74.1	4%	0.041	40%	0.4	C	S	.	.	S	Bend	trans	-107.7	88.7	180	-66.4	0	0	0	0	110.1	C121 S123 D124 V130 C144	C121-C126 HydrophobicContact CB-CB 3.72Å; S123-C126 CarbonylContact O-C 3.42Å; S123-C126 WeakPolarHBondContact O-CA 3.41Å; S123-C126 WeakPolarHBondContact O-CB 3.33Å; S123-C126 PolarHBondContact O-N 3.16Å; S123-C126 VanDerWaalsContact O-O 3.1Å; D124-C126 PolarHBondContact O-N 3.14Å; C126-V130 HydrophobicContact CB-CB 4.1Å; C126-V130 HydrophobicContact CB-CG1 4.05Å; C126-V130 HydrophobicContact CB-CG2 4.31Å; C126-C144 VanDerWaalsContact SG-CB 3.5Å; C126-C144 PolarHBondContact SG-SG 2.82Å
127	G	79.9	Confident	88.2	Confident	46 Å²	46	71 Å²	71	47%	0.474	39%	0.393	S	S	.	.			trans	-61.8	176.4	174.2	0	0	0	0	0	114.8	V130	G127-V130 WeakPolarHBondContact O-CG2 3.48Å; G127-V130 PolarHBondContact O-N 3.45Å
128	A	82.8	Confident	88.4	Confident	95 Å²	95	70.7 Å²	70.7	79%	0.785	39%	0.385	S	S	*	.	T	Hydrogen-bonded Turn	trans	-51.3	140.2	-179.6	0	0	0	0	0	112.7
129	G	83	Confident	88.5	Confident	37 Å²	37	68.1 Å²	68.1	38%	0.381	38%	0.376	S	S	.	.	T	Hydrogen-bonded Turn	trans	87.1	-1.4	-177	0	0	0	0	0	115.8	E120 F131	E120-G129 PolarHBondContact OE1-N 2.79Å; G129-F131 WeakPolarHBondContact O-CD2 3.26Å; G129-F131 WeakPolarHBondContact O-CE2 3.3Å; G129-F131 PolarHBondContact O-N 3.33Å
130	V	90.3	Very high	88.8	Confident	35 Å²	35	65.3 Å²	65.3	21%	0.212	37%	0.366	C	S	.	.			trans	-85.3	102.8	168.2	-179.3	0	0	0	0	109.8	E120 C121 C126 G127 K143	E120-V130 WeakPolarHBondContact CA-O 3.44Å; C121-V130 HydrophobicContact CB-CG1 4.12Å; C121-V130 PolarHBondContact N-O 2.92Å; C126-V130 HydrophobicContact CB-CB 4.1Å; C126-V130 HydrophobicContact CB-CG1 4.05Å; C126-V130 HydrophobicContact CB-CG2 4.31Å; G127-V130 WeakPolarHBondContact O-CG2 3.48Å; G127-V130 PolarHBondContact O-N 3.45Å; V130-K143 HydrophobicContact CG1-CB 4.13Å; V130-K143 HydrophobicContact CG1-CD 4.48Å; V130-K143 HydrophobicContact CG2-CD 3.98Å
131	F	91.9	Very high	88.9	Confident	26 Å²	26	62.7 Å²	62.7	11%	0.114	35%	0.353	C	S	.	.	B	Isolated β-bridge	trans	-88.3	135.6	178.7	-62.3	-76.1	0	0	0	112.3	Y105 Y106 R116 R118 R119 E120 G129	Y105-F131 HydrophobicContact CD2-CB 4.3Å; Y105-F131 AromaticContact CD2-CD2 3.78Å; Y105-F131 HydrophobicContact CD2-CD2 3.78Å; Y105-F131 HydrophobicContact CD2-CE2 4.44Å; Y105-F131 HydrophobicContact CD2-CG 4.15Å; Y106-F131 HydrophobicContact CE1-CZ 4Å; Y106-F131 HydrophobicContact CE2-CE2 4.04Å; Y106-F131 HydrophobicContact CE2-CZ 4.19Å; Y106-F131 AromaticContact CZ-CE2 3.75Å; Y106-F131 AromaticContact CZ-CZ 3.56Å; Y106-F131 VanDerWaalsContact OH-CE2 3.3Å; Y106-F131 WeakPolarHBondContact OH-CE2 3.4Å; Y106-F131 VanDerWaalsContact OH-CZ 3.26Å; Y106-F131 WeakPolarHBondContact OH-CZ 3.4Å; R116-F131 HydrophobicContact CB-CE1 4.39Å; R116-F131 HydrophobicContact CG-CE1 4.34Å; R118-F131 HydrophobicContact CB-CB 4.05Å; R118-F131 HydrophobicContact CB-CD1 3.83Å; R118-F131 HydrophobicContact CB-CG 4.21Å; R118-F131 WeakPolarHBondContact O-CD1 3.44Å; R119-F131 WeakPolarHBondContact O-CA 3.49Å; E120-F131 HydrophobicContact CG-CD1 4.01Å; E120-F131 HydrophobicContact CG-CE1 3.76Å; G129-F131 WeakPolarHBondContact O-CD2 3.26Å; G129-F131 WeakPolarHBondContact O-CE2 3.3Å; G129-F131 PolarHBondContact O-N 3.33Å
132	M	92.5	Very high	88.9	Confident	0 Å²	0	65.2 Å²	65.2	0%	0	38%	0.381	C	S	.	.	P	Polyproline II helix	trans	-71.8	138.5	170.3	-59.3	-170.2	79.8	0	0	110.2	R119 C121 S134 H139 C141 L146 Y148	R119-M132 PolarHBondContact O-N 3.43Å; C121-M132 HydrophobicContact CB-CG 4.01Å; M132-S134 PolarHBondContact O-N 2.82Å; M132-H139 HydrophobicContact CB-CB 4.16Å; M132-H139 HydrophobicContact CE-CB 3.98Å; M132-H139 WeakPolarHBondContact CE-O 3.45Å; M132-H139 HydrophobicContact SD-CB 4.21Å; M132-C141 HydrophobicContact CE-CB 4.17Å; M132-C141 HydrophobicContact CG-CB 4.34Å; M132-L146 HydrophobicContact CE-CG 4.49Å; M132-L146 WeakPolarHBondContact CE-O 3.45Å; M132-Y148 HydrophobicContact CE-CD2 3.62Å; M132-Y148 HydrophobicContact CE-CE2 4.06Å; M132-Y148 HydrophobicContact SD-CD2 3.77Å; M132-Y148 HydrophobicContact SD-CE2 3.97Å
133	A	91.4	Very high	89	Confident	30 Å²	30	68.3 Å²	68.3	25%	0.248	39%	0.388	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.4	122.6	172.4	0	0	0	0	0	109.8	H135 H139 Y140	A133-H135 PolarHBondContact O-N 2.85Å; A133-H139 CarbonylContact O-C 3.42Å; A133-H139 WeakPolarHBondContact O-CA 3.29Å; A133-Y140 WeakPolarHBondContact CB-O 3.46Å; A133-Y140 PolarHBondContact N-O 3.34Å; A133-Y140 PolarHBondContact O-N 2.85Å
134	S	90.7	Very high	89.2	Confident	59 Å²	59	68.4 Å²	68.4	41%	0.413	39%	0.388	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-81	106.8	173.2	-47.5	0	0	0	0	109.5	M132 H139	M132-S134 PolarHBondContact O-N 2.82Å; S134-H139 PolarHBondContact OG-NE2 3.32Å
135	H	90.5	Very high	89.6	Confident	86 Å²	86	64 Å²	64	40%	0.398	37%	0.369	S	S	.	.			trans	-93.4	172.8	165.2	-65.3	-87	0	0	0	109.4	A133 D137 R138	A133-H135 PolarHBondContact O-N 2.85Å; H135-D137 VanDerWaalsContact C-N 3.3Å; H135-D137 PolarHBondContact O-N 2.75Å; H135-R138 CarbonylContact C-O 3.59Å; H135-R138 WeakPolarHBondContact CA-O 3.34Å; H135-R138 HydrophobicContact CB-CG 3.76Å; H135-R138 WeakPolarHBondContact CB-O 3.47Å; H135-R138 PolarHBondContact N-O 2.9Å
136	F	89.9	Confident	89.9	Confident	204 Å²	204	59.5 Å²	59.5	90%	0.895	35%	0.35	S	S	*	.	S	Bend	trans	-58.7	-41.3	-178.4	177.1	-103.9	0	0	0	112.8
137	D	89.9	Confident	90.3	Very high	74 Å²	74	62 Å²	62	40%	0.396	37%	0.365	S	S	.	.	S	Bend	trans	-110.3	-12.5	-171.9	60.6	-34.5	0	0	0	113.6	H135 F150	H135-D137 VanDerWaalsContact C-N 3.3Å; H135-D137 PolarHBondContact O-N 2.75Å; D137-F150 PolarHBondContact O-N 3.38Å
138	R	91.3	Very high	90.8	Very high	101 Å²	101	64 Å²	64	38%	0.381	36%	0.359	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-152.7	158.2	-169.9	67	-169.9	-176.2	-170	-0.5	114.5	H135 T147 Y148	H135-R138 CarbonylContact C-O 3.59Å; H135-R138 WeakPolarHBondContact CA-O 3.34Å; H135-R138 HydrophobicContact CB-CG 3.76Å; H135-R138 WeakPolarHBondContact CB-O 3.47Å; H135-R138 PolarHBondContact N-O 2.9Å; R138-T147 HydrophobicContact CB-CG2 4Å; R138-T147 HydrophobicContact CG-CG2 4.3Å; R138-Y148 CarbonylContact C-O 3.58Å; R138-Y148 WeakPolarHBondContact CA-O 3.38Å; R138-Y148 WeakPolarHBondContact CB-O 3.14Å
139	H	92.8	Very high	91	Very high	23 Å²	23	63.3 Å²	63.3	11%	0.106	35%	0.348	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.8	128.8	160.5	-79.8	58.5	0	0	0	109.8	M132 A133 S134 T147 Y148 F150	M132-H139 HydrophobicContact CB-CB 4.16Å; M132-H139 HydrophobicContact CE-CB 3.98Å; M132-H139 WeakPolarHBondContact CE-O 3.45Å; M132-H139 HydrophobicContact SD-CB 4.21Å; A133-H139 CarbonylContact O-C 3.42Å; A133-H139 WeakPolarHBondContact O-CA 3.29Å; S134-H139 PolarHBondContact OG-NE2 3.32Å; H139-T147 CarbonylContact O-C 3.56Å; H139-T147 VanDerWaalsContact O-CA 3.29Å; H139-T147 WeakPolarHBondContact O-CA 3.47Å; H139-Y148 PolarHBondContact N-O 3.38Å; H139-Y148 PolarHBondContact O-N 3.5Å; H139-F150 AromaticContact CE1-CE2 3.16Å; H139-F150 WeakPolarHBondContact CE1-CE2 3.38Å; H139-F150 AromaticContact CE1-CZ 3.04Å; H139-F150 WeakPolarHBondContact CE1-CZ 3.16Å; H139-F150 AromaticContact CG-CZ 3.93Å; H139-F150 AromaticContact ND1-CE1 3.95Å; H139-F150 AromaticContact ND1-CE2 2.9Å; H139-F150 WeakPolarHBondContact ND1-CE2 3.33Å; H139-F150 AromaticContact ND1-CZ 2.83Å; H139-F150 WeakPolarHBondContact ND1-CZ 3.2Å
140	Y	93.9	Very high	90.9	Very high	72 Å²	72	67.3 Å²	67.3	28%	0.282	36%	0.355	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124	126	-178.2	174.1	-108.1	0	0	0	111.4	A133 C145 L146 T147	A133-Y140 WeakPolarHBondContact CB-O 3.46Å; A133-Y140 PolarHBondContact N-O 3.34Å; A133-Y140 PolarHBondContact O-N 2.85Å; Y140-C145 HydrophobicContact CE2-CB 4.06Å; Y140-C145 PolarHBondContact OH-SG 2.91Å; Y140-L146 CarbonylContact C-O 3.59Å; Y140-L146 WeakPolarHBondContact CA-O 3.04Å; Y140-T147 WeakPolarHBondContact CD2-OG1 2.83Å
141	C	93.3	Very high	89.9	Confident	0 Å²	0	71.5 Å²	71.5	0%	0	38%	0.376	C	S	.	.			trans	-84.1	118.2	171.1	-175.6	0	0	0	0	110.2	C121 M132 K143 C145 L146	C121-C141 HydrophobicContact CB-CB 4.27Å; M132-C141 HydrophobicContact CE-CB 4.17Å; M132-C141 HydrophobicContact CG-CB 4.34Å; C141-K143 PolarHBondContact O-N 2.87Å; C141-K143 PolarHBondContact SG-N 2.88Å; C141-C145 WeakPolarHBondContact O-CA 2.9Å; C141-C145 PolarHBondContact O-N 3.11Å; C141-L146 HydrophobicContact CB-CB 4.17Å; C141-L146 PolarHBondContact N-O 2.75Å
142	G	90.3	Very high	88.5	Confident	62 Å²	62	79.2 Å²	79.2	64%	0.639	41%	0.41	S	S	*	.	T	Hydrogen-bonded Turn	trans	-72.2	-6.7	176.6	0	0	0	0	0	115.3
143	K	91.3	Very high	87.1	Confident	132 Å²	132	84.5 Å²	84.5	57%	0.574	44%	0.444	S	S	*	.	T	Hydrogen-bonded Turn	trans	-98	-58.6	-179.1	-170.8	-176.4	180	-157.8	0	112.1	E125 V130 C141	E125-K143 PolarHBondContact O-NZ 3.06Å; V130-K143 HydrophobicContact CG1-CB 4.13Å; V130-K143 HydrophobicContact CG1-CD 4.48Å; V130-K143 HydrophobicContact CG2-CD 3.98Å; C141-K143 PolarHBondContact O-N 2.87Å; C141-K143 PolarHBondContact SG-N 2.88Å
144	C	93.4	Very high	85.9	Confident	32 Å²	32	91.9 Å²	91.9	22%	0.216	47%	0.473	C	S	.	.	T	Hydrogen-bonded Turn	trans	-98.3	4.6	179.3	65.2	0	0	0	0	114	C121 C126 L146	C121-C144 PolarHBondContact SG-SG 2.83Å; C126-C144 VanDerWaalsContact SG-CB 3.5Å; C126-C144 PolarHBondContact SG-SG 2.82Å; C144-L146 PolarHBondContact O-N 3.31Å; C144-L146 VanDerWaalsContact SG-CB 3.54Å
145	C	93.1	Very high	84.6	Confident	75 Å²	75	97 Å²	97	51%	0.507	50%	0.496	S	S	.	.			trans	61.9	9.9	-178.8	-59.4	0	0	0	0	115.8	Y140 C141 T147	Y140-C145 HydrophobicContact CE2-CB 4.06Å; Y140-C145 PolarHBondContact OH-SG 2.91Å; C141-C145 WeakPolarHBondContact O-CA 2.9Å; C141-C145 PolarHBondContact O-N 3.11Å; C145-T147 PolarHBondContact O-N 2.81Å; C145-T147 PolarHBondContact O-OG1 2.99Å
146	L	91.6	Very high	82.7	Confident	55 Å²	55	106 Å²	106	29%	0.288	53%	0.534	S	S	.	.			trans	-60.1	133.3	177.2	-174.1	69.1	0	0	0	111.2	P122 M132 Y140 C141 C144 Y148	P122-L146 HydrophobicContact CG-CD2 3.99Å; M132-L146 HydrophobicContact CE-CG 4.49Å; M132-L146 WeakPolarHBondContact CE-O 3.45Å; Y140-L146 CarbonylContact C-O 3.59Å; Y140-L146 WeakPolarHBondContact CA-O 3.04Å; C141-L146 HydrophobicContact CB-CB 4.17Å; C141-L146 PolarHBondContact N-O 2.75Å; C144-L146 PolarHBondContact O-N 3.31Å; C144-L146 VanDerWaalsContact SG-CB 3.54Å; L146-Y148 HydrophobicContact CD2-CE2 3.72Å; L146-Y148 HydrophobicContact CG-CE2 4.3Å
147	T	92.3	Very high	82.3	Confident	59 Å²	59	101.1 Å²	101.1	36%	0.362	52%	0.516	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.7	128	-178.5	-52.9	0	0	0	0	110.8	R138 H139 Y140 C145	R138-T147 HydrophobicContact CB-CG2 4Å; R138-T147 HydrophobicContact CG-CG2 4.3Å; H139-T147 CarbonylContact O-C 3.56Å; H139-T147 VanDerWaalsContact O-CA 3.29Å; H139-T147 WeakPolarHBondContact O-CA 3.47Å; Y140-T147 WeakPolarHBondContact CD2-OG1 2.83Å; C145-T147 PolarHBondContact O-N 2.81Å; C145-T147 PolarHBondContact O-OG1 2.99Å
148	Y	89.9	Confident	81.9	Confident	86 Å²	86	102.5 Å²	102.5	34%	0.337	52%	0.522	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.7	117.8	168.3	-69.1	-61.9	0	0	0	109.3	P122 M132 R138 H139 L146	P122-Y148 HydrophobicContact CG-CE2 3.86Å; P122-Y148 WeakPolarHBondContact CG-OH 3.13Å; M132-Y148 HydrophobicContact CE-CD2 3.62Å; M132-Y148 HydrophobicContact CE-CE2 4.06Å; M132-Y148 HydrophobicContact SD-CD2 3.77Å; M132-Y148 HydrophobicContact SD-CE2 3.97Å; R138-Y148 CarbonylContact C-O 3.58Å; R138-Y148 WeakPolarHBondContact CA-O 3.38Å; R138-Y148 WeakPolarHBondContact CB-O 3.14Å; H139-Y148 PolarHBondContact N-O 3.38Å; H139-Y148 PolarHBondContact O-N 3.5Å; L146-Y148 HydrophobicContact CD2-CE2 3.72Å; L146-Y148 HydrophobicContact CG-CE2 4.3Å
149	C	88.2	Confident	81.4	Confident	82 Å²	82	102.6 Å²	102.6	55%	0.554	53%	0.53	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-93.2	139.3	174.8	-59.3	0	0	0	0	110.2
150	F	80.9	Confident	80.7	Confident	120 Å²	120	107.3 Å²	107.3	53%	0.526	56%	0.555	S	S	.	*	S	Bend	trans	-91.3	-41.4	-178.3	-64.4	-58.9	0	0	0	113.7	D137 H139	D137-F150 PolarHBondContact O-N 3.38Å; H139-F150 AromaticContact CE1-CE2 3.16Å; H139-F150 WeakPolarHBondContact CE1-CE2 3.38Å; H139-F150 AromaticContact CE1-CZ 3.04Å; H139-F150 WeakPolarHBondContact CE1-CZ 3.16Å; H139-F150 AromaticContact CG-CZ 3.93Å; H139-F150 AromaticContact ND1-CE1 3.95Å; H139-F150 AromaticContact ND1-CE2 2.9Å; H139-F150 WeakPolarHBondContact ND1-CE2 3.33Å; H139-F150 AromaticContact ND1-CZ 2.83Å; H139-F150 WeakPolarHBondContact ND1-CZ 3.2Å
151	N	68.1	Low	79.9	Confident	124 Å²	124	109.5 Å²	109.5	66%	0.663	57%	0.572	S	S	*	*	S	Bend	trans	-105.2	109.2	175.4	-66.1	-13.9	0	0	0	106.4
152	K	62.6	Low	79	Confident	188 Å²	188	116.8 Å²	116.8	82%	0.817	61%	0.61	S	S	*	*	P	Polyproline II helix	trans	-64.1	130.4	158.2	-71.8	-178.4	179.8	178.8	0	105.8	E154	K152-E154 PolarHBondContact O-N 3.19Å
153	P	64	Low	78.2	Confident	110 Å²	110	120.7 Å²	120.7	71%	0.714	61%	0.608	S	S	*	*	P	Polyproline II helix	trans	-55.2	128	163.6	25.1	-29.9	0	0	0	106.3	D155	P153-D155 PolarHBondContact O-N 2.97Å; P153-D155 VanDerWaalsContact O-N 3.1Å
154	E	65.6	Low	77.2	Confident	186 Å²	186	119.8 Å²	119.8	87%	0.869	61%	0.611	S	S	*	*	P	Polyproline II helix	trans	-54.1	120.1	166.6	-69.9	177.2	166.9	0	0	106.3	K152 K156	K152-E154 PolarHBondContact O-N 3.19Å; E154-K156 PolarHBondContact O-N 3.1Å
155	D	63.3	Low	75.8	Confident	165 Å²	165	127.2 Å²	127.2	88%	0.882	64%	0.643	S	S	*	*			trans	-56.6	110.7	176.6	-67.6	-50.5	0	0	0	107.1	P153	P153-D155 PolarHBondContact O-N 2.97Å; P153-D155 VanDerWaalsContact O-N 3.1Å
156	K	50.6	Low	74.3	Confident	276 Å²	276	131.9 Å²	131.9	100%	1.2	66%	0.656	S	S	*	*			trans	-88.4	0	171.4	-85	-171.6	177.1	-177.3	0	110.3	E154	E154-K156 PolarHBondContact O-N 3.1Å

Retrieved 156 of 156 residues in 75.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).