A0A673Z494_SALTR Loading...

Caveolin

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. May also regulate voltage-gated potassium channels. Plays a role in the sarcolemma repair mechanism of both skeletal muscle and cardiomyocytes that permits rapid resealing of membranes disrupted by mechanical stress. Mediates the recruitment of CAVIN2 and CAVIN3 proteins to the caveolae.

AlphaFold DB , UniProt , Accession A0A673Z494, Species SALTR (Salmo trutta, Brown trout), Gene LOC115150527, Length 152 aa.

						>A0A673Z494_SALTR|A0A673Z494|LOC115150527
MADQYQYNTNEEKFVKDSHTKEIDLINRDPKLINEDVIKVEFEDVIAEPDGTHSLDGVWKLSYTTFTVSKYWCYRILSAIFGIPVALLWGFLFACISFCHIWAVVPCIKSCLIESQCISRIYSLCIQTFCDPFFEALGKIFSSVKVALRKEV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	58.5	Low	60.2	Low	196 Å²	196	119.9 Å²	119.9	97%	0.966	60%	0.595	S	S	*	*				0	-40.2	0	-165.1	166.6	-112.7	0	0	111.9
2	A	58.6	Low	60.2	Low	77 Å²	77	121.3 Å²	121.3	64%	0.636	60%	0.599	S	S	*	*	H	α-helix	trans	-64.8	-38.5	174.7	0	0	0	0	0	114	Q4 Y5 Q6	A2-Q4 PolarHBondContact O-N 3.36Å; A2-Y5 PolarHBondContact O-N 3.15Å; A2-Q6 PolarHBondContact O-N 3.4Å
3	D	59.3	Low	59.9	Low	125 Å²	125	123.1 Å²	123.1	67%	0.668	60%	0.601	S	S	*	*	H	α-helix	trans	-68.2	-34	-177.2	-54.9	-61.1	0	0	0	113.9	Q6 Y7	D3-Q6 PolarHBondContact O-N 3.09Å; D3-Y7 WeakPolarHBondContact O-CB 3.44Å; D3-Y7 PolarHBondContact O-N 3.05Å
4	Q	56.7	Low	59.6	Low	149 Å²	149	125.7 Å²	125.7	70%	0.696	61%	0.608	S	S	*	*	H	α-helix	trans	-71.2	-35	175.6	-77.8	-138.9	-61.6	0	0	112.7	A2 N8	A2-Q4 PolarHBondContact O-N 3.36Å; Q4-N8 PolarHBondContact O-N 3.36Å; Q4-N8 VanDerWaalsContact O-N 3.07Å
5	Y	59.3	Low	59.4	Low	177 Å²	177	124 Å²	124	69%	0.694	61%	0.608	S	S	*	*	H	α-helix	trans	-67.8	-39.8	174.1	-99.7	-89.7	0	0	0	111.6	A2 T9	A2-Y5 PolarHBondContact O-N 3.15Å; Y5-T9 WeakPolarHBondContact O-CB 3.42Å; Y5-T9 PolarHBondContact O-N 3.13Å; Y5-T9 PolarHBondContact O-OG1 3.36Å
6	Q	60	Low	59	Low	128 Å²	128	126.3 Å²	126.3	60%	0.598	61%	0.614	S	S	*	*	H	α-helix	trans	-69.3	-35.6	177.7	-165	157.4	-95.8	0	0	111.9	A2 D3 N10	A2-Q6 PolarHBondContact O-N 3.4Å; D3-Q6 PolarHBondContact O-N 3.09Å; Q6-N10 WeakPolarHBondContact O-CB 3.5Å; Q6-N10 VanDerWaalsContact O-CG 3.22Å; Q6-N10 PolarHBondContact O-N 3.24Å; Q6-N10 PolarHBondContact O-ND2 3.42Å
7	Y	58	Low	58.7	Low	137 Å²	137	125.2 Å²	125.2	54%	0.537	61%	0.612	S	S	.	*	H	α-helix	trans	-63.1	-51.6	172.9	-174.4	-95.1	0	0	0	111.9	D3 T9 N10 E11	D3-Y7 WeakPolarHBondContact O-CB 3.44Å; D3-Y7 PolarHBondContact O-N 3.05Å; Y7-T9 VanDerWaalsContact C-N 3.32Å; Y7-T9 PolarHBondContact O-N 3.29Å; Y7-N10 PolarHBondContact O-N 3.26Å; Y7-E11 HydrophobicContact CD1-CG 4.28Å; Y7-E11 HydrophobicContact CE1-CG 3.88Å; Y7-E11 WeakPolarHBondContact CE1-OE1 3.48Å; Y7-E11 WeakPolarHBondContact CE1-OE2 3.24Å; Y7-E11 VanDerWaalsContact CZ-CD 3.49Å; Y7-E11 PolarHBondContact O-N 2.91Å; Y7-E11 PolarHBondContact OH-OE1 3.31Å
8	N	62.2	Low	58.6	Low	86 Å²	86	122.4 Å²	122.4	46%	0.46	61%	0.607	S	S	.	*	H	α-helix	trans	-60.6	-40.6	176.6	-77.8	10	0	0	0	112.1	Q4 N10 E11 E12	Q4-N8 PolarHBondContact O-N 3.36Å; Q4-N8 VanDerWaalsContact O-N 3.07Å; N8-N10 VanDerWaalsContact C-N 3.32Å; N8-N10 PolarHBondContact O-N 3.14Å; N8-E11 PolarHBondContact O-N 3.47Å; N8-E12 WeakPolarHBondContact O-CB 3.46Å; N8-E12 VanDerWaalsContact O-CG 3.24Å; N8-E12 WeakPolarHBondContact O-CG 3.37Å; N8-E12 PolarHBondContact O-N 2.97Å
9	T	67.4	Low	58.4	Low	61 Å²	61	125.3 Å²	125.3	37%	0.374	62%	0.618	S	S	.	*	H	α-helix	trans	-65.7	-35.5	178.4	-53.8	0	0	0	0	112.2	Y5 Y7 K13	Y5-T9 WeakPolarHBondContact O-CB 3.42Å; Y5-T9 PolarHBondContact O-N 3.13Å; Y5-T9 PolarHBondContact O-OG1 3.36Å; Y7-T9 VanDerWaalsContact C-N 3.32Å; Y7-T9 PolarHBondContact O-N 3.29Å; T9-K13 WeakPolarHBondContact O-CB 3.37Å; T9-K13 WeakPolarHBondContact O-CG 3.47Å; T9-K13 PolarHBondContact O-N 3.49Å
10	N	62.5	Low	58.2	Low	95 Å²	95	123.8 Å²	123.8	51%	0.508	62%	0.617	S	S	.	*	H	α-helix	trans	-75.5	-37.7	177.1	-73.8	-35.7	0	0	0	112	Q6 Y7 N8 K13 F14	Q6-N10 WeakPolarHBondContact O-CB 3.5Å; Q6-N10 VanDerWaalsContact O-CG 3.22Å; Q6-N10 PolarHBondContact O-N 3.24Å; Q6-N10 PolarHBondContact O-ND2 3.42Å; Y7-N10 PolarHBondContact O-N 3.26Å; N8-N10 VanDerWaalsContact C-N 3.32Å; N8-N10 PolarHBondContact O-N 3.14Å; N10-K13 PolarHBondContact O-N 3.08Å; N10-F14 WeakPolarHBondContact O-CB 3.29Å; N10-F14 PolarHBondContact O-N 3.4Å
11	E	60	Low	58.5	Low	88 Å²	88	125.3 Å²	125.3	41%	0.411	62%	0.619	S	S	.	*	H	α-helix	trans	-64.5	-44.5	171.5	-75.2	-169.3	144.3	0	0	111.4	Y7 N8 K13 F14 V15	Y7-E11 HydrophobicContact CD1-CG 4.28Å; Y7-E11 HydrophobicContact CE1-CG 3.88Å; Y7-E11 WeakPolarHBondContact CE1-OE1 3.48Å; Y7-E11 WeakPolarHBondContact CE1-OE2 3.24Å; Y7-E11 VanDerWaalsContact CZ-CD 3.49Å; Y7-E11 PolarHBondContact O-N 2.91Å; Y7-E11 PolarHBondContact OH-OE1 3.31Å; N8-E11 PolarHBondContact O-N 3.47Å; E11-K13 PolarHBondContact O-N 3.39Å; E11-F14 PolarHBondContact O-N 3.29Å; E11-V15 WeakPolarHBondContact O-CB 3.27Å; E11-V15 WeakPolarHBondContact O-CG2 3.21Å; E11-V15 PolarHBondContact O-N 3.14Å
12	E	59.5	Low	59	Low	137 Å²	137	125.2 Å²	125.2	64%	0.64	62%	0.617	S	S	*	*	H	α-helix	trans	-63.8	-40.1	176	-73.4	-178.7	125.9	0	0	112	N8 K16	N8-E12 WeakPolarHBondContact O-CB 3.46Å; N8-E12 VanDerWaalsContact O-CG 3.24Å; N8-E12 WeakPolarHBondContact O-CG 3.37Å; N8-E12 PolarHBondContact O-N 2.97Å; E12-K16 VanDerWaalsContact O-CB 3.25Å; E12-K16 WeakPolarHBondContact O-CB 3.12Å; E12-K16 PolarHBondContact O-N 2.94Å
13	K	56.5	Low	59.8	Low	144 Å²	144	128.1 Å²	128.1	63%	0.626	62%	0.62	S	S	*	*	H	α-helix	trans	-64.7	-44.1	172	-86	-176.3	176.4	-178.2	0	112	T9 N10 E11 V15 K16 D17	T9-K13 WeakPolarHBondContact O-CB 3.37Å; T9-K13 WeakPolarHBondContact O-CG 3.47Å; T9-K13 PolarHBondContact O-N 3.49Å; N10-K13 PolarHBondContact O-N 3.08Å; E11-K13 PolarHBondContact O-N 3.39Å; K13-V15 PolarHBondContact O-N 3.47Å; K13-K16 PolarHBondContact O-N 3.16Å; K13-D17 WeakPolarHBondContact O-CB 3.14Å; K13-D17 PolarHBondContact O-N 3.38Å
14	F	56	Low	60.6	Low	160 Å²	160	126.4 Å²	126.4	70%	0.702	61%	0.611	S	S	*	*	H	α-helix	trans	-64.7	-40.2	-179.3	-170.1	-94.6	0	0	0	112	N10 E11 S18	N10-F14 WeakPolarHBondContact O-CB 3.29Å; N10-F14 PolarHBondContact O-N 3.4Å; E11-F14 PolarHBondContact O-N 3.29Å; F14-S18 WeakPolarHBondContact O-CB 3.36Å; F14-S18 PolarHBondContact O-N 2.82Å; F14-S18 VanDerWaalsContact O-N 3.11Å
15	V	56.8	Low	61.7	Low	100 Å²	100	125 Å²	125	61%	0.606	61%	0.607	S	S	*	*	H	α-helix	trans	-68.5	-39.9	176.4	173.3	0	0	0	0	111.3	E11 K13	E11-V15 WeakPolarHBondContact O-CB 3.27Å; E11-V15 WeakPolarHBondContact O-CG2 3.21Å; E11-V15 PolarHBondContact O-N 3.14Å; K13-V15 PolarHBondContact O-N 3.47Å
16	K	53.1	Low	62.5	Low	160 Å²	160	124.3 Å²	124.3	70%	0.696	61%	0.614	S	S	*	*	H	α-helix	trans	-73.4	-34.5	179.7	-152.8	175	-172.2	-180	0	112.8	E12 K13 T20	E12-K16 VanDerWaalsContact O-CB 3.25Å; E12-K16 WeakPolarHBondContact O-CB 3.12Å; E12-K16 PolarHBondContact O-N 2.94Å; K13-K16 PolarHBondContact O-N 3.16Å; K16-T20 PolarHBondContact O-N 3.37Å; K16-T20 PolarHBondContact O-OG1 2.78Å
17	D	53.6	Low	63.6	Low	108 Å²	108	121.8 Å²	121.8	58%	0.578	61%	0.605	S	S	*	*	H	α-helix	trans	-73	-33.5	177.7	-161.4	55	0	0	0	111.9	K13 H19 T20 K21	K13-D17 WeakPolarHBondContact O-CB 3.14Å; K13-D17 PolarHBondContact O-N 3.38Å; D17-H19 PolarHBondContact O-N 2.84Å; D17-T20 PolarHBondContact O-N 3.33Å; D17-K21 PolarHBondContact O-N 2.83Å
18	S	56.4	Low	64.7	Low	76 Å²	76	124.9 Å²	124.9	53%	0.531	62%	0.615	S	S	.	*	H	α-helix	trans	-63.1	-29.3	175.9	-171.8	0	0	0	0	113.5	F14	F14-S18 WeakPolarHBondContact O-CB 3.36Å; F14-S18 PolarHBondContact O-N 2.82Å; F14-S18 VanDerWaalsContact O-N 3.11Å
19	H	55.2	Low	65.6	Low	177 Å²	177	122.5 Å²	122.5	82%	0.819	60%	0.603	S	S	*	*	H	α-helix	trans	-92	-11.7	179.1	-109.8	-73.7	0	0	0	113.8	D17	D17-H19 PolarHBondContact O-N 2.84Å
20	T	55	Low	66.4	Low	95 Å²	95	124 Å²	124	58%	0.583	61%	0.613	S	S	*	*			trans	-126.2	36.5	-172.6	-30.8	0	0	0	0	111.6	K16 D17 E22	K16-T20 PolarHBondContact O-N 3.37Å; K16-T20 PolarHBondContact O-OG1 2.78Å; D17-T20 PolarHBondContact O-N 3.33Å; T20-E22 PolarHBondContact O-N 2.8Å; T20-E22 VanDerWaalsContact O-N 3.09Å
21	K	64.1	Low	67.4	Low	155 Å²	155	127.6 Å²	127.6	67%	0.674	63%	0.625	S	S	*	*			trans	-63.9	115.4	169.6	-68.3	-173.1	178.9	176.9	0	108.2	D17 I23	D17-K21 PolarHBondContact O-N 2.83Å; K21-I23 PolarHBondContact O-N 3.01Å; K21-I23 VanDerWaalsContact O-N 3.13Å
22	E	69.4	Low	68.4	Low	195 Å²	195	127.7 Å²	127.7	91%	0.911	63%	0.627	S	S	*	*			trans	-58.9	117.5	174.6	-64.1	-169	109.4	0	0	108.6	T20	T20-E22 PolarHBondContact O-N 2.8Å; T20-E22 VanDerWaalsContact O-N 3.09Å
23	I	75.3	Confident	69.6	Low	137 Å²	137	126.8 Å²	126.8	70%	0.703	63%	0.626	S	S	*	*			trans	-77.8	124.2	177.4	50.1	168	0	0	0	109	K21 L25	K21-I23 PolarHBondContact O-N 3.01Å; K21-I23 VanDerWaalsContact O-N 3.13Å; I23-L25 HydrophobicContact CD1-CD2 3.91Å; I23-L25 HydrophobicContact CG1-CD2 4.25Å; I23-L25 PolarHBondContact O-N 3.35Å
24	D	76.2	Confident	70.9	Confident	90 Å²	90	123.7 Å²	123.7	48%	0.481	62%	0.616	S	S	.	*			trans	-72.3	112.5	172.5	-171	-15.5	0	0	0	109.2	I26 N27	D24-I26 VanDerWaalsContact C-N 3.34Å; D24-I26 WeakPolarHBondContact OD1-CA 3.1Å; D24-I26 WeakPolarHBondContact OD1-CB 3.46Å; D24-I26 PolarHBondContact OD1-N 2.98Å; D24-N27 PolarHBondContact OD1-N 3.31Å; D24-N27 WeakPolarHBondContact OD2-CB 3.13Å
25	L	79	Confident	71.9	Confident	118 Å²	118	120.2 Å²	120.2	62%	0.618	60%	0.602	S	S	*	*	S	Bend	trans	-81.1	-18.6	-179.6	-62.9	175.4	0	0	0	112.6	I23 R28	I23-L25 HydrophobicContact CD1-CD2 3.91Å; I23-L25 HydrophobicContact CG1-CD2 4.25Å; I23-L25 PolarHBondContact O-N 3.35Å; L25-R28 PolarHBondContact O-NE 3.32Å
26	I	77.4	Confident	72.6	Confident	164 Å²	164	121.8 Å²	121.8	84%	0.841	61%	0.607	S	S	*	*	S	Bend	trans	-92.6	-54.6	-176	-55.8	174.2	0	0	0	109.1	D24	D24-I26 VanDerWaalsContact C-N 3.34Å; D24-I26 WeakPolarHBondContact OD1-CA 3.1Å; D24-I26 WeakPolarHBondContact OD1-CB 3.46Å; D24-I26 PolarHBondContact OD1-N 2.98Å
27	N	81.2	Confident	73.4	Confident	74 Å²	74	119.7 Å²	119.7	40%	0.396	61%	0.607	S	S	.	*			trans	-101.3	96	175.1	-171.2	-2.5	0	0	0	111.4	D24 D29	D24-N27 PolarHBondContact OD1-N 3.31Å; D24-N27 WeakPolarHBondContact OD2-CB 3.13Å; N27-D29 PolarHBondContact OD1-N 3.47Å; N27-D29 VanDerWaalsContact OD1-N 3.16Å; N27-D29 PolarHBondContact OD1-O 2.88Å
28	R	81.1	Confident	74.2	Confident	202 Å²	202	119.6 Å²	119.6	76%	0.762	61%	0.606	S	S	*	*	S	Bend	trans	-85.7	-9.2	-179.6	-61.1	-177.7	-177.5	-165.4	-3	114.1	L25 P30	L25-R28 PolarHBondContact O-NE 3.32Å; R28-P30 VanDerWaalsContact C-CD 3.46Å
29	D	82.6	Confident	74.8	Confident	36 Å²	36	121.8 Å²	121.8	19%	0.193	61%	0.606	C	S	.	*			trans	-128.2	65.4	174.8	-173.2	15.4	0	0	0	110.8	N27 K31 L32 I33 N34	N27-D29 PolarHBondContact OD1-N 3.47Å; N27-D29 VanDerWaalsContact OD1-N 3.16Å; N27-D29 PolarHBondContact OD1-O 2.88Å; D29-K31 PolarHBondContact O-N 2.94Å; D29-K31 VanDerWaalsContact O-N 3.09Å; D29-L32 WeakPolarHBondContact O-CD2 3.3Å; D29-L32 PolarHBondContact O-N 3.38Å; D29-L32 VanDerWaalsContact O-N 3.07Å; D29-L32 PolarHBondContact OD1-N 3.34Å; D29-L32 VanDerWaalsContact OD2-C 3.29Å; D29-L32 WeakPolarHBondContact OD2-CA 3.2Å; D29-I33 VanDerWaalsContact CG-N 3.34Å; D29-I33 PolarHBondContact OD1-N 3.26Å; D29-I33 PolarHBondContact OD2-N 3.42Å; D29-N34 PolarHBondContact OD2-N 2.71Å
30	P	82.7	Confident	75.8	Confident	92 Å²	92	117 Å²	117	60%	0.597	59%	0.588	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.3	-14.1	-177.5	28.2	-36.4	0	0	0	113.6	R28	R28-P30 VanDerWaalsContact C-CD 3.46Å
31	K	83.7	Confident	77.1	Confident	172 Å²	172	118 Å²	118	75%	0.748	59%	0.586	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.5	1.5	179	-67.7	-178.3	-178.2	-179.4	0	112.6	D29 I33	D29-K31 PolarHBondContact O-N 2.94Å; D29-K31 VanDerWaalsContact O-N 3.09Å; K31-I33 HydrophobicContact CB-CD1 3.9Å; K31-I33 HydrophobicContact CB-CG1 3.73Å; K31-I33 HydrophobicContact CD-CD1 4.23Å; K31-I33 PolarHBondContact O-N 3.21Å
32	L	82.6	Confident	78	Confident	90 Å²	90	111.1 Å²	111.1	47%	0.471	56%	0.557	S	S	.	*			trans	53.4	34.8	178.6	-48.9	179.3	0	0	0	112.6	D29 N34 E35	D29-L32 WeakPolarHBondContact O-CD2 3.3Å; D29-L32 PolarHBondContact O-N 3.38Å; D29-L32 VanDerWaalsContact O-N 3.07Å; D29-L32 PolarHBondContact OD1-N 3.34Å; D29-L32 VanDerWaalsContact OD2-C 3.29Å; D29-L32 WeakPolarHBondContact OD2-CA 3.2Å; L32-N34 PolarHBondContact O-N 2.86Å; L32-E35 HydrophobicContact CB-CB 4.3Å; L32-E35 HydrophobicContact CB-CG 3.76Å; L32-E35 HydrophobicContact CD2-CG 3.78Å; L32-E35 WeakPolarHBondContact CD2-OE1 3.34Å; L32-E35 HydrophobicContact CG-CG 4.23Å
33	I	84.7	Confident	78.7	Confident	117 Å²	117	106.6 Å²	106.6	60%	0.6	54%	0.536	S	S	*	.	S	Bend	trans	-67.2	-28.9	-176.3	-61.7	169.4	0	0	0	110.4	D29 K31	D29-I33 VanDerWaalsContact CG-N 3.34Å; D29-I33 PolarHBondContact OD1-N 3.26Å; D29-I33 PolarHBondContact OD2-N 3.42Å; K31-I33 HydrophobicContact CB-CD1 3.9Å; K31-I33 HydrophobicContact CB-CG1 3.73Å; K31-I33 HydrophobicContact CD-CD1 4.23Å; K31-I33 PolarHBondContact O-N 3.21Å
34	N	83.1	Confident	79	Confident	80 Å²	80	104.9 Å²	104.9	43%	0.428	53%	0.528	S	S	.	.	S	Bend	trans	-112.4	3.5	-173.4	-70.6	103.9	0	0	0	113.9	D29 L32 D36 V37 I38	D29-N34 PolarHBondContact OD2-N 2.71Å; L32-N34 PolarHBondContact O-N 2.86Å; N34-D36 PolarHBondContact O-N 3.4Å; N34-V37 PolarHBondContact O-N 3.48Å; N34-I38 HydrophobicContact CB-CD1 3.76Å; N34-I38 HydrophobicContact CB-CG1 4.29Å; N34-I38 PolarHBondContact O-N 2.74Å
35	E	76.8	Confident	79.3	Confident	86 Å²	86	104.2 Å²	104.2	40%	0.402	53%	0.527	S	S	.	.	T	Hydrogen-bonded Turn	trans	-57.4	-48.2	-176	-86	-159.2	157	0	0	112.6	L32 K39	L32-E35 HydrophobicContact CB-CB 4.3Å; L32-E35 HydrophobicContact CB-CG 3.76Å; L32-E35 HydrophobicContact CD2-CG 3.78Å; L32-E35 WeakPolarHBondContact CD2-OE1 3.34Å; L32-E35 HydrophobicContact CG-CG 4.23Å; E35-K39 WeakPolarHBondContact O-CD 3.38Å; E35-K39 WeakPolarHBondContact O-CE 3.47Å; E35-K39 WeakPolarHBondContact O-CG 3.45Å; E35-K39 PolarHBondContact O-NZ 3.38Å
36	D	70.9	Confident	79.5	Confident	133 Å²	133	102.9 Å²	102.9	71%	0.711	52%	0.52	S	S	*	.	T	Hydrogen-bonded Turn	trans	-90.2	-11.5	-171.3	-60	-37.6	0	0	0	114	N34 K39	N34-D36 PolarHBondContact O-N 3.4Å; D36-K39 IonicContact OD1-NZ 3.95Å; D36-K39 PolarHBondContact OD1-NZ 3.4Å
37	V	69.8	Low	79.7	Confident	116 Å²	116	98.3 Å²	98.3	70%	0.703	51%	0.506	S	S	*	.	T	Hydrogen-bonded Turn	trans	-93.5	-27.7	-175.4	-177.4	0	0	0	0	112.2	N34	N34-V37 PolarHBondContact O-N 3.48Å
38	I	70.3	Confident	79.8	Confident	107 Å²	107	97.6 Å²	97.6	55%	0.549	50%	0.501	S	S	.	.	S	Bend	trans	-107.6	-0.5	-171.4	-50.6	-177.5	0	0	0	112.6	N34 V40	N34-I38 HydrophobicContact CB-CD1 3.76Å; N34-I38 HydrophobicContact CB-CG1 4.29Å; N34-I38 PolarHBondContact O-N 2.74Å; I38-V40 PolarHBondContact O-N 2.88Å
39	K	70.4	Confident	79.8	Confident	122 Å²	122	91.7 Å²	91.7	53%	0.53	49%	0.488	S	S	.	.			trans	-73.8	71.2	171.7	-72.3	165.4	-169.5	159.2	0	110.4	E35 D36	E35-K39 WeakPolarHBondContact O-CD 3.38Å; E35-K39 WeakPolarHBondContact O-CE 3.47Å; E35-K39 WeakPolarHBondContact O-CG 3.45Å; E35-K39 PolarHBondContact O-NZ 3.38Å; D36-K39 IonicContact OD1-NZ 3.95Å; D36-K39 PolarHBondContact OD1-NZ 3.4Å
40	V	75.9	Confident	79.3	Confident	75 Å²	75	97.2 Å²	97.2	46%	0.455	52%	0.518	S	S	.	.			trans	-106	108.2	168.1	179.8	0	0	0	0	107.4	I38 V45	I38-V40 PolarHBondContact O-N 2.88Å; V40-V45 HydrophobicContact CG1-CG2 3.44Å; V40-V45 VanDerWaalsContact CG1-CG2 3.44Å
41	E	81.8	Confident	78.8	Confident	116 Å²	116	96.5 Å²	96.5	54%	0.542	53%	0.527	S	S	.	.			trans	-89.9	162.8	178.6	-59.8	-170.5	108.4	0	0	110.9	E43 D44 V45	E41-E43 PolarHBondContact O-N 3.29Å; E41-D44 WeakPolarHBondContact CB-OD2 3.47Å; E41-D44 PolarHBondContact N-OD2 3.08Å; E41-D44 WeakPolarHBondContact O-CB 3.46Å; E41-D44 PolarHBondContact O-N 2.95Å; E41-D44 VanDerWaalsContact O-N 3.16Å; E41-V45 PolarHBondContact O-N 3.37Å
42	F	83.8	Confident	78.3	Confident	12 Å²	12	93.2 Å²	93.2	5%	0.053	52%	0.522	C	S	.	.	H	α-helix	trans	-59.8	-38.1	178.9	172.9	-102.6	0	0	0	111.6	D44 V45 I46 W59 S62 Y63 F66	F42-D44 VanDerWaalsContact C-N 3.32Å; F42-D44 PolarHBondContact O-N 3.19Å; F42-V45 PolarHBondContact O-N 3.21Å; F42-I46 HydrophobicContact CD2-CG1 4.2Å; F42-I46 HydrophobicContact CE2-CG1 3.69Å; F42-I46 HydrophobicContact CZ-CB 4.4Å; F42-I46 HydrophobicContact CZ-CG1 3.92Å; F42-I46 PolarHBondContact O-N 3.17Å; F42-I46 VanDerWaalsContact O-N 3.12Å; F42-W59 HydrophobicContact CD1-CH2 4.13Å; F42-W59 HydrophobicContact CD1-CZ2 4.06Å; F42-W59 AromaticContact CE1-CD2 3.99Å; F42-W59 HydrophobicContact CE1-CD2 3.99Å; F42-W59 AromaticContact CE1-CE2 3.92Å; F42-W59 AromaticContact CE1-CE3 3.83Å; F42-W59 HydrophobicContact CE1-CE3 3.83Å; F42-W59 AromaticContact CE1-CH2 3.56Å; F42-W59 HydrophobicContact CE1-CH2 3.56Å; F42-W59 AromaticContact CE1-CZ2 3.74Å; F42-W59 HydrophobicContact CE1-CZ2 3.74Å; F42-W59 AromaticContact CE1-CZ3 3.6Å; F42-W59 HydrophobicContact CE1-CZ3 3.6Å; F42-W59 HydrophobicContact CZ-CE3 4.33Å; F42-W59 HydrophobicContact CZ-CH2 4.4Å; F42-W59 HydrophobicContact CZ-CZ3 4.09Å; F42-S62 VanDerWaalsContact CZ-CB 3.5Å; F42-Y63 HydrophobicContact CB-CD2 3.67Å; F42-Y63 HydrophobicContact CB-CE2 4.17Å; F42-Y63 AromaticContact CD1-CD2 3.84Å; F42-Y63 HydrophobicContact CD1-CD2 3.84Å; F42-Y63 HydrophobicContact CD1-CG 4.39Å; F42-Y63 AromaticContact CG-CD2 3.98Å; F42-Y63 HydrophobicContact CG-CD2 3.98Å; F42-F66 HydrophobicContact CB-CD1 3.81Å; F42-F66 HydrophobicContact CB-CE1 4.21Å; F42-F66 HydrophobicContact CD2-CB 3.6Å; F42-F66 AromaticContact CD2-CD1 3.81Å; F42-F66 HydrophobicContact CD2-CD1 3.81Å; F42-F66 HydrophobicContact CD2-CD2 4.28Å; F42-F66 AromaticContact CD2-CG 3.64Å; F42-F66 HydrophobicContact CD2-CG 3.64Å; F42-F66 HydrophobicContact CE2-CB 4.09Å; F42-F66 HydrophobicContact CE2-CG 4.43Å; F42-F66 HydrophobicContact CG-CD1 4.3Å
43	E	82.9	Confident	78.2	Confident	100 Å²	100	94.5 Å²	94.5	47%	0.467	53%	0.525	S	S	.	.	H	α-helix	trans	-65	-33.6	176.9	-72	144.8	137.4	0	0	112.2	E41 V45 A47 W59	E41-E43 PolarHBondContact O-N 3.29Å; E43-V45 VanDerWaalsContact C-N 3.28Å; E43-V45 PolarHBondContact O-N 2.8Å; E43-A47 WeakPolarHBondContact O-CA 3.45Å; E43-A47 WeakPolarHBondContact O-CB 3.26Å; E43-A47 PolarHBondContact O-N 3.5Å; E43-W59 HydrophobicContact CG-CZ2 3.91Å
44	D	81.6	Confident	78	Confident	100 Å²	100	90.6 Å²	90.6	54%	0.535	51%	0.508	S	S	.	.	H	α-helix	trans	-68.9	-25.2	175.7	-61.7	-39.8	0	0	0	113.1	E41 F42	E41-D44 WeakPolarHBondContact CB-OD2 3.47Å; E41-D44 PolarHBondContact N-OD2 3.08Å; E41-D44 WeakPolarHBondContact O-CB 3.46Å; E41-D44 PolarHBondContact O-N 2.95Å; E41-D44 VanDerWaalsContact O-N 3.16Å; F42-D44 VanDerWaalsContact C-N 3.32Å; F42-D44 PolarHBondContact O-N 3.19Å
45	V	82.4	Confident	78.1	Confident	77 Å²	77	93.5 Å²	93.5	47%	0.467	52%	0.523	S	S	.	.	H	α-helix	trans	-91.1	-43.5	-175.7	179	0	0	0	0	112.1	V40 E41 F42 E43 F66	V40-V45 HydrophobicContact CG1-CG2 3.44Å; V40-V45 VanDerWaalsContact CG1-CG2 3.44Å; E41-V45 PolarHBondContact O-N 3.37Å; F42-V45 PolarHBondContact O-N 3.21Å; E43-V45 VanDerWaalsContact C-N 3.28Å; E43-V45 PolarHBondContact O-N 2.8Å; V45-F66 HydrophobicContact CG2-CZ 4.15Å
46	I	83.5	Confident	78.5	Confident	90 Å²	90	95.2 Å²	95.2	46%	0.462	53%	0.534	S	S	.	.	H	α-helix	trans	-97.4	-33.9	-175	-55.9	-59.9	0	0	0	111.9	F42 E48 W59	F42-I46 HydrophobicContact CD2-CG1 4.2Å; F42-I46 HydrophobicContact CE2-CG1 3.69Å; F42-I46 HydrophobicContact CZ-CB 4.4Å; F42-I46 HydrophobicContact CZ-CG1 3.92Å; F42-I46 PolarHBondContact O-N 3.17Å; F42-I46 VanDerWaalsContact O-N 3.12Å; I46-E48 HydrophobicContact CG2-CG 4.31Å; I46-E48 PolarHBondContact O-N 3.43Å; I46-W59 HydrophobicContact CB-CH2 4.42Å; I46-W59 HydrophobicContact CB-CZ3 4.39Å; I46-W59 HydrophobicContact CG2-CH2 4.37Å; I46-W59 HydrophobicContact CG2-CZ3 3.92Å
47	A	82.5	Confident	79.2	Confident	68 Å²	68	91.4 Å²	91.4	56%	0.562	53%	0.527	S	S	*	.			trans	43.9	58.4	172.3	0	0	0	0	0	114.7	E43 P49	E43-A47 WeakPolarHBondContact O-CA 3.45Å; E43-A47 WeakPolarHBondContact O-CB 3.26Å; E43-A47 PolarHBondContact O-N 3.5Å; A47-P49 WeakPolarHBondContact O-CD 3.36Å
48	E	83.4	Confident	80.1	Confident	59 Å²	59	89.5 Å²	89.5	28%	0.276	52%	0.515	S	S	.	.			trans	-63.6	125.8	174.8	-80.6	-175.4	-168.9	0	0	110.7	I46 S54 W59	I46-E48 HydrophobicContact CG2-CG 4.31Å; I46-E48 PolarHBondContact O-N 3.43Å; E48-S54 VanDerWaalsContact CD-OG 3.24Å; E48-S54 VanDerWaalsContact OE1-CB 3.28Å; E48-S54 WeakPolarHBondContact OE1-CB 3.29Å; E48-S54 PolarHBondContact OE1-OG 2.96Å; E48-S54 WeakPolarHBondContact OE2-CB 3.47Å; E48-S54 PolarHBondContact OE2-N 3.12Å; E48-S54 PolarHBondContact OE2-OG 2.97Å; E48-W59 HydrophobicContact CB-CH2 3.97Å; E48-W59 HydrophobicContact CB-CZ3 3.86Å; E48-W59 HydrophobicContact CG-CE3 4.1Å; E48-W59 HydrophobicContact CG-CH2 4.03Å; E48-W59 HydrophobicContact CG-CZ3 3.43Å; E48-W59 VanDerWaalsContact CG-CZ3 3.43Å; E48-W59 WeakPolarHBondContact OE1-CZ3 3.38Å
49	P	80.6	Confident	80.9	Confident	78 Å²	78	87 Å²	87	51%	0.506	50%	0.499	S	S	.	.			trans	-81.1	151.2	-179.3	31.9	-34.4	0	0	0	112.2	A47 G51 T52	A47-P49 WeakPolarHBondContact O-CD 3.36Å; P49-G51 PolarHBondContact O-N 3.43Å; P49-T52 PolarHBondContact O-N 2.86Å
50	D	72.4	Confident	81.7	Confident	152 Å²	152	88 Å²	88	81%	0.813	50%	0.503	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53.4	-21.6	-175.6	-68	-45.8	0	0	0	115.3	H53	D50-H53 WeakPolarHBondContact CA-NE2 3.28Å; D50-H53 PolarHBondContact O-CD2 3.15Å; D50-H53 IonicContact OD1-NE2 2.9Å
51	G	72	Confident	82.4	Confident	76 Å²	76	89.9 Å²	89.9	78%	0.784	51%	0.51	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86	-14	-179.3	0	0	0	0	0	115.5	P49	P49-G51 PolarHBondContact O-N 3.43Å
52	T	71.9	Confident	82.8	Confident	104 Å²	104	86.7 Å²	86.7	64%	0.638	50%	0.5	S	S	*	.	S	Bend	trans	-148.4	78.9	-174.3	25	0	0	0	0	110.4	P49	P49-T52 PolarHBondContact O-N 2.86Å
53	H	81.7	Confident	83	Confident	117 Å²	117	91 Å²	91	54%	0.542	52%	0.517	S	S	.	.	P	Polyproline II helix	trans	-84.8	136	175.5	-75.7	-102.8	0	0	0	111.8	D50	D50-H53 WeakPolarHBondContact CA-NE2 3.28Å; D50-H53 PolarHBondContact O-CD2 3.15Å; D50-H53 IonicContact OD1-NE2 2.9Å
54	S	80.2	Confident	83.3	Confident	35 Å²	35	89.8 Å²	89.8	25%	0.245	52%	0.517	C	S	.	.	P	Polyproline II helix	trans	-66.2	165.3	162.5	64.1	0	0	0	0	110.9	E48 D56	E48-S54 VanDerWaalsContact CD-OG 3.24Å; E48-S54 VanDerWaalsContact OE1-CB 3.28Å; E48-S54 WeakPolarHBondContact OE1-CB 3.29Å; E48-S54 PolarHBondContact OE1-OG 2.96Å; E48-S54 WeakPolarHBondContact OE2-CB 3.47Å; E48-S54 PolarHBondContact OE2-N 3.12Å; E48-S54 PolarHBondContact OE2-OG 2.97Å; S54-D56 PolarHBondContact O-N 3.17Å
55	L	84.5	Confident	83.8	Confident	140 Å²	140	88.7 Å²	88.7	73%	0.733	51%	0.514	S	S	*	.	P	Polyproline II helix	trans	-58.4	133.6	175.8	-65.3	171.7	0	0	0	110.2	G57 V58 W59	L55-G57 PolarHBondContact O-N 3.3Å; L55-V58 HydrophobicContact CB-CG2 4.15Å; L55-V58 WeakPolarHBondContact O-CA 3.39Å; L55-V58 WeakPolarHBondContact O-CB 3.47Å; L55-V58 PolarHBondContact O-N 2.83Å; L55-W59 PolarHBondContact O-N 3.48Å
56	D	85.4	Confident	84.1	Confident	122 Å²	122	88.2 Å²	88.2	65%	0.652	51%	0.505	S	S	*	.	H	α-helix	trans	-49.8	-35.1	-177.4	-67.8	-45.7	0	0	0	114.1	S54 K60	S54-D56 PolarHBondContact O-N 3.17Å; D56-K60 WeakPolarHBondContact O-CB 3.46Å; D56-K60 WeakPolarHBondContact O-CG 3.43Å; D56-K60 PolarHBondContact O-N 3.13Å
57	G	85.8	Confident	84.3	Confident	53 Å²	53	86.4 Å²	86.4	55%	0.546	50%	0.499	S	S	.	.	H	α-helix	trans	-68.8	-39.2	177.4	0	0	0	0	0	113.2	L55 L61	L55-G57 PolarHBondContact O-N 3.3Å; G57-L61 VanDerWaalsContact O-CB 3.28Å; G57-L61 WeakPolarHBondContact O-CB 3.33Å; G57-L61 PolarHBondContact O-N 2.91Å
58	V	88.3	Confident	84.6	Confident	76 Å²	76	86.5 Å²	86.5	46%	0.461	49%	0.492	S	S	.	.	H	α-helix	trans	-70.3	-41.4	177	178.9	0	0	0	0	109.6	L55 L61 S62	L55-V58 HydrophobicContact CB-CG2 4.15Å; L55-V58 WeakPolarHBondContact O-CA 3.39Å; L55-V58 WeakPolarHBondContact O-CB 3.47Å; L55-V58 PolarHBondContact O-N 2.83Å; V58-L61 PolarHBondContact O-N 3.33Å; V58-S62 VanDerWaalsContact O-CB 3.25Å; V58-S62 WeakPolarHBondContact O-CB 3.28Å; V58-S62 PolarHBondContact O-N 3.43Å; V58-S62 PolarHBondContact O-OG 3.44Å
59	W	87.8	Confident	85	Confident	55 Å²	55	86.9 Å²	86.9	21%	0.208	50%	0.501	C	S	.	.	H	α-helix	trans	-59.6	-51.5	176.4	-172.4	-111.2	0	0	0	111.9	F42 E43 I46 E48 L55 L61 S62 Y63	F42-W59 HydrophobicContact CD1-CH2 4.13Å; F42-W59 HydrophobicContact CD1-CZ2 4.06Å; F42-W59 AromaticContact CE1-CD2 3.99Å; F42-W59 HydrophobicContact CE1-CD2 3.99Å; F42-W59 AromaticContact CE1-CE2 3.92Å; F42-W59 AromaticContact CE1-CE3 3.83Å; F42-W59 HydrophobicContact CE1-CE3 3.83Å; F42-W59 AromaticContact CE1-CH2 3.56Å; F42-W59 HydrophobicContact CE1-CH2 3.56Å; F42-W59 AromaticContact CE1-CZ2 3.74Å; F42-W59 HydrophobicContact CE1-CZ2 3.74Å; F42-W59 AromaticContact CE1-CZ3 3.6Å; F42-W59 HydrophobicContact CE1-CZ3 3.6Å; F42-W59 HydrophobicContact CZ-CE3 4.33Å; F42-W59 HydrophobicContact CZ-CH2 4.4Å; F42-W59 HydrophobicContact CZ-CZ3 4.09Å; E43-W59 HydrophobicContact CG-CZ2 3.91Å; I46-W59 HydrophobicContact CB-CH2 4.42Å; I46-W59 HydrophobicContact CB-CZ3 4.39Å; I46-W59 HydrophobicContact CG2-CH2 4.37Å; I46-W59 HydrophobicContact CG2-CZ3 3.92Å; E48-W59 HydrophobicContact CB-CH2 3.97Å; E48-W59 HydrophobicContact CB-CZ3 3.86Å; E48-W59 HydrophobicContact CG-CE3 4.1Å; E48-W59 HydrophobicContact CG-CH2 4.03Å; E48-W59 HydrophobicContact CG-CZ3 3.43Å; E48-W59 VanDerWaalsContact CG-CZ3 3.43Å; E48-W59 WeakPolarHBondContact OE1-CZ3 3.38Å; L55-W59 PolarHBondContact O-N 3.48Å; W59-L61 PolarHBondContact O-N 3.44Å; W59-S62 PolarHBondContact O-N 3.02Å; W59-Y63 WeakPolarHBondContact O-CB 3.5Å; W59-Y63 PolarHBondContact O-N 3.14Å
60	K	87.6	Confident	85.3	Confident	144 Å²	144	88.4 Å²	88.4	63%	0.626	50%	0.5	S	S	*	.	H	α-helix	trans	-63.5	-39.8	178.5	-73.8	176.3	-177.9	174.6	0	113.3	D56 T64	D56-K60 WeakPolarHBondContact O-CB 3.46Å; D56-K60 WeakPolarHBondContact O-CG 3.43Å; D56-K60 PolarHBondContact O-N 3.13Å; K60-T64 WeakPolarHBondContact O-CB 3.29Å; K60-T64 PolarHBondContact O-N 3.36Å; K60-T64 PolarHBondContact O-OG1 3.35Å
61	L	90.3	Very high	86	Confident	114 Å²	114	87.2 Å²	87.2	60%	0.597	49%	0.485	S	S	*	.	H	α-helix	trans	-66.3	-44.1	177.7	-176.9	61.1	0	0	0	110.6	G57 V58 W59 T64 T65	G57-L61 VanDerWaalsContact O-CB 3.28Å; G57-L61 WeakPolarHBondContact O-CB 3.33Å; G57-L61 PolarHBondContact O-N 2.91Å; V58-L61 PolarHBondContact O-N 3.33Å; W59-L61 PolarHBondContact O-N 3.44Å; L61-T64 PolarHBondContact O-N 3.49Å; L61-T65 WeakPolarHBondContact O-CB 3.37Å; L61-T65 PolarHBondContact O-N 3.27Å; L61-T65 PolarHBondContact O-OG1 2.88Å
62	S	89.5	Confident	86.9	Confident	48 Å²	48	90.3 Å²	90.3	34%	0.336	47%	0.473	S	S	.	.	H	α-helix	trans	-61.9	-45.9	177.8	-57.3	0	0	0	0	111.5	F42 V58 W59 T64 T65 F66	F42-S62 VanDerWaalsContact CZ-CB 3.5Å; V58-S62 VanDerWaalsContact O-CB 3.25Å; V58-S62 WeakPolarHBondContact O-CB 3.28Å; V58-S62 PolarHBondContact O-N 3.43Å; V58-S62 PolarHBondContact O-OG 3.44Å; W59-S62 PolarHBondContact O-N 3.02Å; S62-T64 VanDerWaalsContact C-N 3.33Å; S62-T64 PolarHBondContact O-N 3.43Å; S62-T65 PolarHBondContact O-N 3.37Å; S62-F66 VanDerWaalsContact O-CB 3.23Å; S62-F66 WeakPolarHBondContact O-CB 3.5Å; S62-F66 PolarHBondContact O-N 2.82Å
63	Y	88.8	Confident	87.8	Confident	103 Å²	103	88.6 Å²	88.6	40%	0.404	47%	0.465	S	S	.	.	H	α-helix	trans	-55.4	-47.9	173.7	174.5	-92.7	0	0	0	112	F42 W59 T67	F42-Y63 HydrophobicContact CB-CD2 3.67Å; F42-Y63 HydrophobicContact CB-CE2 4.17Å; F42-Y63 AromaticContact CD1-CD2 3.84Å; F42-Y63 HydrophobicContact CD1-CD2 3.84Å; F42-Y63 HydrophobicContact CD1-CG 4.39Å; F42-Y63 AromaticContact CG-CD2 3.98Å; F42-Y63 HydrophobicContact CG-CD2 3.98Å; W59-Y63 WeakPolarHBondContact O-CB 3.5Å; W59-Y63 PolarHBondContact O-N 3.14Å; Y63-T67 WeakPolarHBondContact O-CB 3.2Å; Y63-T67 PolarHBondContact O-N 3.12Å; Y63-T67 PolarHBondContact O-OG1 3Å
64	T	88.8	Confident	88.2	Confident	75 Å²	75	90.6 Å²	90.6	46%	0.46	47%	0.469	S	S	.	.	H	α-helix	trans	-66.1	-49.5	-178.3	-57.8	0	0	0	0	111.1	K60 L61 S62 F66 T67 V68	K60-T64 WeakPolarHBondContact O-CB 3.29Å; K60-T64 PolarHBondContact O-N 3.36Å; K60-T64 PolarHBondContact O-OG1 3.35Å; L61-T64 PolarHBondContact O-N 3.49Å; S62-T64 VanDerWaalsContact C-N 3.33Å; S62-T64 PolarHBondContact O-N 3.43Å; T64-F66 VanDerWaalsContact C-N 3.33Å; T64-F66 PolarHBondContact O-N 3.19Å; T64-T67 PolarHBondContact O-N 3.19Å; T64-V68 HydrophobicContact CG2-CG2 4.36Å; T64-V68 WeakPolarHBondContact O-CB 3.48Å; T64-V68 VanDerWaalsContact O-CG2 3.27Å; T64-V68 WeakPolarHBondContact O-CG2 3.27Å; T64-V68 PolarHBondContact O-N 3.28Å
65	T	91.2	Very high	88.6	Confident	77 Å²	77	94.8 Å²	94.8	47%	0.472	48%	0.479	S	S	.	.	H	α-helix	trans	-63.2	-38.8	-179.9	-64.4	0	0	0	0	111.8	L61 S62 S69	L61-T65 WeakPolarHBondContact O-CB 3.37Å; L61-T65 PolarHBondContact O-N 3.27Å; L61-T65 PolarHBondContact O-OG1 2.88Å; S62-T65 PolarHBondContact O-N 3.37Å; T65-S69 WeakPolarHBondContact O-CB 3.5Å; T65-S69 PolarHBondContact O-N 3.22Å; T65-S69 PolarHBondContact O-OG 2.99Å
66	F	89.2	Confident	89	Confident	66 Å²	66	92.6 Å²	92.6	29%	0.289	47%	0.467	S	S	.	.	H	α-helix	trans	-63	-50.5	175.2	179.1	-98.9	0	0	0	111.6	F42 V45 S62 T64 V68 S69 K70	F42-F66 HydrophobicContact CB-CD1 3.81Å; F42-F66 HydrophobicContact CB-CE1 4.21Å; F42-F66 HydrophobicContact CD2-CB 3.6Å; F42-F66 AromaticContact CD2-CD1 3.81Å; F42-F66 HydrophobicContact CD2-CD1 3.81Å; F42-F66 HydrophobicContact CD2-CD2 4.28Å; F42-F66 AromaticContact CD2-CG 3.64Å; F42-F66 HydrophobicContact CD2-CG 3.64Å; F42-F66 HydrophobicContact CE2-CB 4.09Å; F42-F66 HydrophobicContact CE2-CG 4.43Å; F42-F66 HydrophobicContact CG-CD1 4.3Å; V45-F66 HydrophobicContact CG2-CZ 4.15Å; S62-F66 VanDerWaalsContact O-CB 3.23Å; S62-F66 WeakPolarHBondContact O-CB 3.5Å; S62-F66 PolarHBondContact O-N 2.82Å; T64-F66 VanDerWaalsContact C-N 3.33Å; T64-F66 PolarHBondContact O-N 3.19Å; F66-V68 PolarHBondContact O-N 2.81Å; F66-S69 PolarHBondContact O-N 2.94Å; F66-K70 HydrophobicContact CE1-CD 4.41Å; F66-K70 WeakPolarHBondContact O-CB 3.36Å; F66-K70 PolarHBondContact O-N 2.89Å
67	T	87.7	Confident	89.2	Confident	53 Å²	53	91 Å²	91	33%	0.325	46%	0.458	S	S	.	.	H	α-helix	trans	-61.8	-46.4	-177.9	-59.2	0	0	0	0	111.8	Y63 T64 Y71	Y63-T67 WeakPolarHBondContact O-CB 3.2Å; Y63-T67 PolarHBondContact O-N 3.12Å; Y63-T67 PolarHBondContact O-OG1 3Å; T64-T67 PolarHBondContact O-N 3.19Å; T67-Y71 WeakPolarHBondContact O-CB 3.32Å; T67-Y71 PolarHBondContact O-N 3.46Å
68	V	90.4	Very high	89.5	Confident	70 Å²	70	90.6 Å²	90.6	42%	0.424	45%	0.447	S	S	.	.	H	α-helix	trans	-65	-48.5	178.9	173.7	0	0	0	0	110.4	T64 F66 K70 Y71 W72	T64-V68 HydrophobicContact CG2-CG2 4.36Å; T64-V68 WeakPolarHBondContact O-CB 3.48Å; T64-V68 VanDerWaalsContact O-CG2 3.27Å; T64-V68 WeakPolarHBondContact O-CG2 3.27Å; T64-V68 PolarHBondContact O-N 3.28Å; F66-V68 PolarHBondContact O-N 2.81Å; V68-K70 PolarHBondContact O-N 2.9Å; V68-Y71 PolarHBondContact O-N 2.91Å; V68-W72 VanDerWaalsContact O-CD1 3.24Å; V68-W72 PolarHBondContact O-N 3.3Å
69	S	89.9	Confident	89.6	Confident	67 Å²	67	90.6 Å²	90.6	47%	0.469	46%	0.455	S	S	.	.	H	α-helix	trans	-58.7	-45.8	179.4	-63	0	0	0	0	112.1	T65 F66 Y71 W72 C73	T65-S69 WeakPolarHBondContact O-CB 3.5Å; T65-S69 PolarHBondContact O-N 3.22Å; T65-S69 PolarHBondContact O-OG 2.99Å; F66-S69 PolarHBondContact O-N 2.94Å; S69-Y71 PolarHBondContact O-N 3.28Å; S69-W72 PolarHBondContact O-N 2.89Å; S69-C73 WeakPolarHBondContact O-CB 3.38Å; S69-C73 PolarHBondContact O-N 3.37Å
70	K	87.9	Confident	89.9	Confident	109 Å²	109	92.7 Å²	92.7	47%	0.474	47%	0.469	S	S	.	.	H	α-helix	trans	-58.7	-47.4	176.6	-176.7	178.4	73.8	90.5	0	111.6	F66 V68 Y74	F66-K70 HydrophobicContact CE1-CD 4.41Å; F66-K70 WeakPolarHBondContact O-CB 3.36Å; F66-K70 PolarHBondContact O-N 2.89Å; V68-K70 PolarHBondContact O-N 2.9Å; K70-Y74 WeakPolarHBondContact O-CB 3.45Å; K70-Y74 PolarHBondContact O-N 2.9Å
71	Y	87.4	Confident	90.2	Very high	127 Å²	127	91.4 Å²	91.4	50%	0.498	46%	0.464	S	S	.	.	H	α-helix	trans	-63.4	-47.7	-178.7	178.2	-102.4	0	0	0	112.5	T67 V68 S69 Y74 R75	T67-Y71 WeakPolarHBondContact O-CB 3.32Å; T67-Y71 PolarHBondContact O-N 3.46Å; V68-Y71 PolarHBondContact O-N 2.91Å; S69-Y71 PolarHBondContact O-N 3.28Å; Y71-Y74 PolarHBondContact O-N 3.44Å; Y71-R75 VanDerWaalsContact CE1-CD 3.43Å; Y71-R75 HydrophobicContact CE1-CG 4.44Å; Y71-R75 WeakPolarHBondContact O-CG 3.41Å; Y71-R75 PolarHBondContact O-N 3.27Å; Y71-R75 VanDerWaalsContact O-N 3.1Å; Y71-R75 PolarHBondContact OH-NH1 3Å
72	W	90.1	Very high	90.3	Very high	141 Å²	141	87.6 Å²	87.6	53%	0.534	45%	0.452	S	S	.	.	H	α-helix	trans	-68.2	-41.5	179.7	-80.2	97.4	0	0	0	112.6	V68 S69 Y74 R75 I76	V68-W72 VanDerWaalsContact O-CD1 3.24Å; V68-W72 PolarHBondContact O-N 3.3Å; S69-W72 PolarHBondContact O-N 2.89Å; W72-Y74 VanDerWaalsContact C-N 3.34Å; W72-Y74 PolarHBondContact O-N 2.89Å; W72-R75 PolarHBondContact O-N 2.96Å; W72-I76 WeakPolarHBondContact O-CG1 3.27Å; W72-I76 PolarHBondContact O-N 3.41Å
73	C	90.1	Very high	90.4	Very high	69 Å²	69	91.2 Å²	91.2	47%	0.466	47%	0.467	S	S	.	.	H	α-helix	trans	-57.9	-48.1	175.2	-175.6	0	0	0	0	111	S69 R75 I76 L77	S69-C73 WeakPolarHBondContact O-CB 3.38Å; S69-C73 PolarHBondContact O-N 3.37Å; C73-R75 VanDerWaalsContact C-N 3.33Å; C73-R75 PolarHBondContact O-N 3.39Å; C73-I76 PolarHBondContact O-N 2.83Å; C73-L77 WeakPolarHBondContact O-CB 3.31Å; C73-L77 WeakPolarHBondContact O-CG 3.41Å; C73-L77 PolarHBondContact O-N 3.34Å
74	Y	90.8	Very high	90.6	Very high	158 Å²	158	89.3 Å²	89.3	62%	0.62	47%	0.467	S	S	*	.	H	α-helix	trans	-58.1	-43.1	176.7	176.7	-103.1	0	0	0	112.5	K70 Y71 W72 S78	K70-Y74 WeakPolarHBondContact O-CB 3.45Å; K70-Y74 PolarHBondContact O-N 2.9Å; Y71-Y74 PolarHBondContact O-N 3.44Å; W72-Y74 VanDerWaalsContact C-N 3.34Å; W72-Y74 PolarHBondContact O-N 2.89Å; Y74-S78 WeakPolarHBondContact O-CB 3.27Å; Y74-S78 PolarHBondContact O-N 3.46Å; Y74-S78 PolarHBondContact O-OG 2.92Å
75	R	89.8	Confident	90.9	Very high	123 Å²	123	88.9 Å²	88.9	46%	0.464	46%	0.464	S	S	.	.	H	α-helix	trans	-63.5	-43.6	178.4	-75.9	-177.6	66.2	169.1	-2.2	112.7	Y71 W72 C73 A79	Y71-R75 VanDerWaalsContact CE1-CD 3.43Å; Y71-R75 HydrophobicContact CE1-CG 4.44Å; Y71-R75 WeakPolarHBondContact O-CG 3.41Å; Y71-R75 PolarHBondContact O-N 3.27Å; Y71-R75 VanDerWaalsContact O-N 3.1Å; Y71-R75 PolarHBondContact OH-NH1 3Å; W72-R75 PolarHBondContact O-N 2.96Å; C73-R75 VanDerWaalsContact C-N 3.33Å; C73-R75 PolarHBondContact O-N 3.39Å; R75-A79 VanDerWaalsContact O-CB 3.31Å; R75-A79 WeakPolarHBondContact O-CB 3.38Å; R75-A79 PolarHBondContact O-N 3.26Å
76	I	92.5	Very high	91	Very high	95 Å²	95	88.2 Å²	88.2	49%	0.487	47%	0.466	S	S	.	.	H	α-helix	trans	-66.6	-47.7	179.7	-67.1	169.8	0	0	0	109.9	W72 C73 S78 A79 I80	W72-I76 WeakPolarHBondContact O-CG1 3.27Å; W72-I76 PolarHBondContact O-N 3.41Å; C73-I76 PolarHBondContact O-N 2.83Å; I76-S78 VanDerWaalsContact C-N 3.33Å; I76-S78 PolarHBondContact O-N 3.32Å; I76-A79 PolarHBondContact O-N 2.95Å; I76-I80 HydrophobicContact CG2-CD1 3.73Å; I76-I80 WeakPolarHBondContact O-CG1 3.41Å; I76-I80 PolarHBondContact O-N 3.42Å
77	L	89.7	Confident	91.2	Very high	87 Å²	87	91 Å²	91	46%	0.455	48%	0.484	S	S	.	.	H	α-helix	trans	-59.7	-44.3	176.9	-72.4	172.4	0	0	0	111.6	C73 A79 I80 F81	C73-L77 WeakPolarHBondContact O-CB 3.31Å; C73-L77 WeakPolarHBondContact O-CG 3.41Å; C73-L77 PolarHBondContact O-N 3.34Å; L77-A79 VanDerWaalsContact C-N 3.33Å; L77-A79 PolarHBondContact O-N 2.94Å; L77-I80 PolarHBondContact O-N 3.37Å; L77-F81 HydrophobicContact CD2-CD2 4.08Å; L77-F81 HydrophobicContact CD2-CE2 3.96Å; L77-F81 WeakPolarHBondContact O-CB 3.45Å; L77-F81 PolarHBondContact O-N 3.34Å
78	S	91.8	Very high	91.5	Very high	45 Å²	45	93.8 Å²	93.8	32%	0.315	50%	0.496	S	S	.	.	H	α-helix	trans	-65.1	-35.7	177.2	-60.3	0	0	0	0	112.4	Y74 I76 G82	Y74-S78 WeakPolarHBondContact O-CB 3.27Å; Y74-S78 PolarHBondContact O-N 3.46Å; Y74-S78 PolarHBondContact O-OG 2.92Å; I76-S78 VanDerWaalsContact C-N 3.33Å; I76-S78 PolarHBondContact O-N 3.32Å; S78-G82 WeakPolarHBondContact O-CA 3.49Å; S78-G82 PolarHBondContact O-N 3.17Å
79	A	91.1	Very high	91.7	Very high	76 Å²	76	98.1 Å²	98.1	63%	0.628	51%	0.505	S	S	*	.	H	α-helix	trans	-68.3	-38.5	176.9	0	0	0	0	0	112.1	R75 I76 L77	R75-A79 VanDerWaalsContact O-CB 3.31Å; R75-A79 WeakPolarHBondContact O-CB 3.38Å; R75-A79 PolarHBondContact O-N 3.26Å; I76-A79 PolarHBondContact O-N 2.95Å; L77-A79 VanDerWaalsContact C-N 3.33Å; L77-A79 PolarHBondContact O-N 2.94Å
80	I	92.7	Very high	91.9	Very high	100 Å²	100	97 Å²	97	51%	0.513	50%	0.504	S	S	.	.	H	α-helix	trans	-78.5	-48.4	-178.4	-64.5	168.9	0	0	0	111.1	I76 L77 P84	I76-I80 HydrophobicContact CG2-CD1 3.73Å; I76-I80 WeakPolarHBondContact O-CG1 3.41Å; I76-I80 PolarHBondContact O-N 3.42Å; L77-I80 PolarHBondContact O-N 3.37Å; I80-P84 WeakPolarHBondContact O-CD 3.3Å
81	F	93.9	Very high	92.2	Very high	116 Å²	116	98.4 Å²	98.4	51%	0.509	51%	0.51	S	S	.	.	H	α-helix	trans	-102.1	-14.7	-170.4	-63.9	-73.2	0	0	0	114.2	L77 I83 P84 V85	L77-F81 HydrophobicContact CD2-CD2 4.08Å; L77-F81 HydrophobicContact CD2-CE2 3.96Å; L77-F81 WeakPolarHBondContact O-CB 3.45Å; L77-F81 PolarHBondContact O-N 3.34Å; F81-I83 PolarHBondContact O-N 3.4Å; F81-P84 WeakPolarHBondContact O-CD 3.29Å; F81-V85 HydrophobicContact CB-CG2 4.38Å; F81-V85 VanDerWaalsContact O-CB 3.26Å; F81-V85 WeakPolarHBondContact O-CB 3.44Å; F81-V85 WeakPolarHBondContact O-CG2 3.17Å; F81-V85 PolarHBondContact O-N 3.03Å
82	G	92.8	Very high	92.6	Very high	34 Å²	34	96.7 Å²	96.7	35%	0.351	51%	0.509	S	S	.	.	H	α-helix	trans	-59.8	-50.5	-175.5	0	0	0	0	0	113	S78 A86	S78-G82 WeakPolarHBondContact O-CA 3.49Å; S78-G82 PolarHBondContact O-N 3.17Å; G82-A86 VanDerWaalsContact O-CB 3.29Å; G82-A86 WeakPolarHBondContact O-CB 3.37Å; G82-A86 PolarHBondContact O-N 3.3Å
83	I	91.4	Very high	92.7	Very high	125 Å²	125	96.3 Å²	96.3	64%	0.641	51%	0.512	S	S	*	.	H	α-helix	trans	-66.2	-49.9	-179.7	-58.9	169.8	0	0	0	111.4	F81 V85 A86 L87	F81-I83 PolarHBondContact O-N 3.4Å; I83-V85 VanDerWaalsContact C-N 3.35Å; I83-V85 PolarHBondContact O-N 2.72Å; I83-A86 PolarHBondContact O-N 2.96Å; I83-L87 HydrophobicContact CG2-CD1 4.21Å; I83-L87 WeakPolarHBondContact O-CG 3.26Å; I83-L87 PolarHBondContact O-N 3.32Å
84	P	93.9	Very high	92.9	Very high	63 Å²	63	95.9 Å²	95.9	41%	0.409	51%	0.513	S	S	.	.	H	α-helix	trans	-56.1	-44.9	176.1	-27.2	34.2	0	0	0	113.8	I80 F81 L87 L88	I80-P84 WeakPolarHBondContact O-CD 3.3Å; F81-P84 WeakPolarHBondContact O-CD 3.29Å; P84-L87 PolarHBondContact O-N 3.45Å; P84-L88 WeakPolarHBondContact O-CG 3.46Å; P84-L88 PolarHBondContact O-N 2.95Å
85	V	94.4	Very high	93.1	Very high	65 Å²	65	90.7 Å²	90.7	39%	0.394	50%	0.499	S	S	.	.	H	α-helix	trans	-67.3	-40.3	-179.4	171.9	0	0	0	0	111	F81 I83 L87 L88 W89	F81-V85 HydrophobicContact CB-CG2 4.38Å; F81-V85 VanDerWaalsContact O-CB 3.26Å; F81-V85 WeakPolarHBondContact O-CB 3.44Å; F81-V85 WeakPolarHBondContact O-CG2 3.17Å; F81-V85 PolarHBondContact O-N 3.03Å; I83-V85 VanDerWaalsContact C-N 3.35Å; I83-V85 PolarHBondContact O-N 2.72Å; V85-L87 VanDerWaalsContact C-N 3.33Å; V85-L87 PolarHBondContact O-N 2.96Å; V85-L88 PolarHBondContact O-N 3.45Å; V85-W89 VanDerWaalsContact O-CD1 3.3Å; V85-W89 PolarHBondContact O-N 3.48Å
86	A	93.1	Very high	93.3	Very high	64 Å²	64	90 Å²	90	53%	0.529	50%	0.503	S	S	.	.	H	α-helix	trans	-60.9	-41.8	175.3	0	0	0	0	0	112.1	G82 I83 W89 G90	G82-A86 VanDerWaalsContact O-CB 3.29Å; G82-A86 WeakPolarHBondContact O-CB 3.37Å; G82-A86 PolarHBondContact O-N 3.3Å; I83-A86 PolarHBondContact O-N 2.96Å; A86-W89 PolarHBondContact O-N 3.38Å; A86-G90 PolarHBondContact O-N 3.34Å
87	L	92.9	Very high	93.4	Very high	124 Å²	124	87.8 Å²	87.8	65%	0.649	50%	0.497	S	S	*	.	H	α-helix	trans	-64	-44.3	176.1	-70.9	173.9	0	0	0	112.1	I83 P84 V85 G90 F91	I83-L87 HydrophobicContact CG2-CD1 4.21Å; I83-L87 WeakPolarHBondContact O-CG 3.26Å; I83-L87 PolarHBondContact O-N 3.32Å; P84-L87 PolarHBondContact O-N 3.45Å; V85-L87 VanDerWaalsContact C-N 3.33Å; V85-L87 PolarHBondContact O-N 2.96Å; L87-G90 PolarHBondContact O-N 3.03Å; L87-F91 PolarHBondContact O-N 2.99Å
88	L	95.1	Very high	93.6	Very high	112 Å²	112	89.5 Å²	89.5	59%	0.586	50%	0.501	S	S	*	.	H	α-helix	trans	-60.4	-46.4	176.6	-72	172.1	0	0	0	111.5	P84 V85 F91 L92	P84-L88 WeakPolarHBondContact O-CG 3.46Å; P84-L88 PolarHBondContact O-N 2.95Å; V85-L88 PolarHBondContact O-N 3.45Å; L88-F91 PolarHBondContact O-N 3.35Å; L88-L92 VanDerWaalsContact O-CG 3.3Å; L88-L92 WeakPolarHBondContact O-CG 3.17Å; L88-L92 PolarHBondContact O-N 2.98Å
89	W	94.4	Very high	93.7	Very high	160 Å²	160	90.7 Å²	90.7	61%	0.606	51%	0.508	S	S	*	.	H	α-helix	trans	-62.7	-42.4	177.1	-87.5	106.8	0	0	0	112.6	V85 A86 F91 L92 F93	V85-W89 VanDerWaalsContact O-CD1 3.3Å; V85-W89 PolarHBondContact O-N 3.48Å; A86-W89 PolarHBondContact O-N 3.38Å; W89-F91 VanDerWaalsContact C-N 3.35Å; W89-F91 PolarHBondContact O-N 3.03Å; W89-L92 PolarHBondContact O-N 2.88Å; W89-F93 WeakPolarHBondContact O-CB 3.48Å; W89-F93 PolarHBondContact O-N 3.35Å
90	G	94.2	Very high	93.7	Very high	44 Å²	44	91.8 Å²	91.8	45%	0.454	50%	0.5	S	S	.	.	H	α-helix	trans	-59.7	-44.9	175.7	0	0	0	0	0	112.4	A86 L87 F93 A94	A86-G90 PolarHBondContact O-N 3.34Å; L87-G90 PolarHBondContact O-N 3.03Å; G90-F93 PolarHBondContact O-N 3.39Å; G90-A94 PolarHBondContact O-N 3.23Å
91	F	94.7	Very high	93.8	Very high	139 Å²	139	91.9 Å²	91.9	61%	0.61	50%	0.5	S	S	*	.	H	α-helix	trans	-63.5	-46.3	176.7	-179.7	-102.4	0	0	0	112.3	L87 L88 W89 F93 A94 C95	L87-F91 PolarHBondContact O-N 2.99Å; L88-F91 PolarHBondContact O-N 3.35Å; W89-F91 VanDerWaalsContact C-N 3.35Å; W89-F91 PolarHBondContact O-N 3.03Å; F91-F93 VanDerWaalsContact C-N 3.33Å; F91-F93 PolarHBondContact O-N 2.94Å; F91-A94 WeakPolarHBondContact O-CB 3.48Å; F91-A94 PolarHBondContact O-N 3.41Å; F91-A94 VanDerWaalsContact O-N 3.17Å; F91-C95 VanDerWaalsContact CZ-SG 3.55Å; F91-C95 PolarHBondContact O-N 3.16Å; F91-C95 PolarHBondContact O-SG 2.9Å
92	L	94.5	Very high	93.7	Very high	90 Å²	90	95 Å²	95	47%	0.471	51%	0.509	S	S	.	.	H	α-helix	trans	-58.1	-45.5	176.7	-72.9	171.9	0	0	0	111.6	L88 W89 A94 C95 I96	L88-L92 VanDerWaalsContact O-CG 3.3Å; L88-L92 WeakPolarHBondContact O-CG 3.17Å; L88-L92 PolarHBondContact O-N 2.98Å; W89-L92 PolarHBondContact O-N 2.88Å; L92-A94 VanDerWaalsContact C-N 3.29Å; L92-A94 PolarHBondContact O-N 3.49Å; L92-C95 PolarHBondContact O-N 3.35Å; L92-I96 VanDerWaalsContact O-CG1 3.27Å; L92-I96 WeakPolarHBondContact O-CG1 3.06Å; L92-I96 PolarHBondContact O-N 3.4Å
93	F	93.3	Very high	93.6	Very high	134 Å²	134	95.8 Å²	95.8	59%	0.588	51%	0.512	S	S	*	.	H	α-helix	trans	-62.9	-37.6	178.2	-124.8	-86.7	0	0	0	112.2	W89 G90 F91 S97	W89-F93 WeakPolarHBondContact O-CB 3.48Å; W89-F93 PolarHBondContact O-N 3.35Å; G90-F93 PolarHBondContact O-N 3.39Å; F91-F93 VanDerWaalsContact C-N 3.33Å; F91-F93 PolarHBondContact O-N 2.94Å; F93-S97 VanDerWaalsContact O-CB 3.29Å; F93-S97 WeakPolarHBondContact O-CB 3.49Å; F93-S97 PolarHBondContact O-N 3.44Å; F93-S97 PolarHBondContact O-OG 3.12Å
94	A	94.7	Very high	93.6	Very high	59 Å²	59	92.7 Å²	92.7	49%	0.488	50%	0.499	S	S	.	.	H	α-helix	trans	-64.2	-46.2	174.9	0	0	0	0	0	111.7	G90 F91 L92 S97 F98	G90-A94 PolarHBondContact O-N 3.23Å; F91-A94 WeakPolarHBondContact O-CB 3.48Å; F91-A94 PolarHBondContact O-N 3.41Å; F91-A94 VanDerWaalsContact O-N 3.17Å; L92-A94 VanDerWaalsContact C-N 3.29Å; L92-A94 PolarHBondContact O-N 3.49Å; A94-S97 PolarHBondContact O-N 3.33Å; A94-F98 WeakPolarHBondContact O-CB 2.96Å; A94-F98 PolarHBondContact O-N 3.4Å
95	C	94.4	Very high	93.5	Very high	50 Å²	50	92.4 Å²	92.4	34%	0.338	50%	0.496	S	S	.	.	H	α-helix	trans	-61.6	-45.3	175.9	-69	0	0	0	0	112.3	F91 L92 S97 F98 C99	F91-C95 VanDerWaalsContact CZ-SG 3.55Å; F91-C95 PolarHBondContact O-N 3.16Å; F91-C95 PolarHBondContact O-SG 2.9Å; L92-C95 PolarHBondContact O-N 3.35Å; C95-S97 VanDerWaalsContact C-N 3.32Å; C95-S97 PolarHBondContact O-N 2.9Å; C95-F98 PolarHBondContact O-N 2.85Å; C95-C99 PolarHBondContact O-N 3.5Å; C95-C99 PolarHBondContact O-SG 3.07Å; C95-C99 VanDerWaalsContact O-SG 3.37Å
96	I	93.8	Very high	93.4	Very high	107 Å²	107	92.2 Å²	92.2	55%	0.549	50%	0.496	S	S	.	.	H	α-helix	trans	-60.1	-45.7	176.8	-69	166.1	0	0	0	110.1	L92 F98 C99 H100	L92-I96 VanDerWaalsContact O-CG1 3.27Å; L92-I96 WeakPolarHBondContact O-CG1 3.06Å; L92-I96 PolarHBondContact O-N 3.4Å; I96-F98 VanDerWaalsContact C-N 3.32Å; I96-F98 PolarHBondContact O-N 2.85Å; I96-C99 PolarHBondContact O-N 2.93Å; I96-H100 VanDerWaalsContact O-CB 3.31Å; I96-H100 WeakPolarHBondContact O-CB 3.15Å; I96-H100 PolarHBondContact O-N 3.07Å
97	S	94.8	Very high	93.1	Very high	50 Å²	50	92.9 Å²	92.9	35%	0.35	50%	0.496	S	S	.	.	H	α-helix	trans	-61.9	-41.9	178.8	-59.3	0	0	0	0	111.5	F93 A94 C95 H100 I101	F93-S97 VanDerWaalsContact O-CB 3.29Å; F93-S97 WeakPolarHBondContact O-CB 3.49Å; F93-S97 PolarHBondContact O-N 3.44Å; F93-S97 PolarHBondContact O-OG 3.12Å; A94-S97 PolarHBondContact O-N 3.33Å; C95-S97 VanDerWaalsContact C-N 3.32Å; C95-S97 PolarHBondContact O-N 2.9Å; S97-H100 PolarHBondContact O-N 3.42Å; S97-I101 WeakPolarHBondContact O-CD1 3.35Å; S97-I101 VanDerWaalsContact O-CG1 3.27Å; S97-I101 WeakPolarHBondContact O-CG1 3.14Å; S97-I101 PolarHBondContact O-N 2.84Å
98	F	94.3	Very high	93	Very high	123 Å²	123	91.2 Å²	91.2	54%	0.539	49%	0.487	S	S	.	.	H	α-helix	trans	-61.1	-52.9	174.8	179.4	-96.1	0	0	0	111.4	A94 C95 I96 H100 I101 W102	A94-F98 WeakPolarHBondContact O-CB 2.96Å; A94-F98 PolarHBondContact O-N 3.4Å; C95-F98 PolarHBondContact O-N 2.85Å; I96-F98 VanDerWaalsContact C-N 3.32Å; I96-F98 PolarHBondContact O-N 2.85Å; F98-H100 VanDerWaalsContact C-N 3.27Å; F98-H100 PolarHBondContact O-N 3.45Å; F98-I101 PolarHBondContact O-N 3.32Å; F98-W102 AromaticContact CD2-CD1 3.21Å; F98-W102 HydrophobicContact CD2-CG 4.1Å; F98-W102 AromaticContact CD2-NE1 3.5Å; F98-W102 HydrophobicContact CE2-CB 4.47Å; F98-W102 AromaticContact CE2-CD1 3.27Å; F98-W102 HydrophobicContact CE2-CD2 4.25Å; F98-W102 AromaticContact CE2-CG 3.77Å; F98-W102 HydrophobicContact CE2-CG 3.77Å; F98-W102 AromaticContact CE2-NE1 3.46Å; F98-W102 AromaticContact CG-CD1 3.84Å; F98-W102 HydrophobicContact CZ-CB 4.33Å; F98-W102 AromaticContact CZ-CD1 3.95Å; F98-W102 HydrophobicContact CZ-CG 4.06Å; F98-W102 WeakPolarHBondContact O-CB 3.46Å; F98-W102 PolarHBondContact O-N 3Å
99	C	92.7	Very high	92.6	Very high	70 Å²	70	92.2 Å²	92.2	47%	0.473	49%	0.486	S	S	.	.	H	α-helix	trans	-58.5	-40	177.5	-69.4	0	0	0	0	112	C95 I96 A103 V104	C95-C99 PolarHBondContact O-N 3.5Å; C95-C99 PolarHBondContact O-SG 3.07Å; C95-C99 VanDerWaalsContact O-SG 3.37Å; I96-C99 PolarHBondContact O-N 2.93Å; C99-A103 WeakPolarHBondContact O-CA 3.29Å; C99-A103 VanDerWaalsContact O-CB 3.27Å; C99-A103 WeakPolarHBondContact O-CB 3.4Å; C99-A103 PolarHBondContact O-N 3.17Å; C99-V104 PolarHBondContact O-N 2.86Å
100	H	92.4	Very high	92.3	Very high	99 Å²	99	87.9 Å²	87.9	46%	0.458	48%	0.481	S	S	.	.	I	π-helix	trans	-62.2	-49.6	178.3	-178.9	-94.1	0	0	0	111.7	I96 S97 F98 V104 V105	I96-H100 VanDerWaalsContact O-CB 3.31Å; I96-H100 WeakPolarHBondContact O-CB 3.15Å; I96-H100 PolarHBondContact O-N 3.07Å; S97-H100 PolarHBondContact O-N 3.42Å; F98-H100 VanDerWaalsContact C-N 3.27Å; F98-H100 PolarHBondContact O-N 3.45Å; H100-V104 WeakPolarHBondContact O-CB 3.17Å; H100-V104 PolarHBondContact O-N 3.47Å; H100-V105 WeakPolarHBondContact O-CG2 3.41Å; H100-V105 PolarHBondContact O-N 2.97Å
101	I	93.9	Very high	91.9	Very high	101 Å²	101	90 Å²	90	52%	0.518	49%	0.488	S	S	.	.	I	π-helix	trans	-71	-42.6	-176.7	-64.2	162.1	0	0	0	111.4	S97 F98 P106	S97-I101 WeakPolarHBondContact O-CD1 3.35Å; S97-I101 VanDerWaalsContact O-CG1 3.27Å; S97-I101 WeakPolarHBondContact O-CG1 3.14Å; S97-I101 PolarHBondContact O-N 2.84Å; F98-I101 PolarHBondContact O-N 3.32Å; I101-P106 VanDerWaalsContact O-CD 3.32Å; I101-P106 WeakPolarHBondContact O-CD 3.37Å
102	W	92.6	Very high	91.5	Very high	181 Å²	181	88.3 Å²	88.3	69%	0.686	49%	0.485	S	S	*	.	I	π-helix	trans	-94.9	-25	-169.1	-67.3	95	0	0	0	114.4	F98 P106	F98-W102 AromaticContact CD2-CD1 3.21Å; F98-W102 HydrophobicContact CD2-CG 4.1Å; F98-W102 AromaticContact CD2-NE1 3.5Å; F98-W102 HydrophobicContact CE2-CB 4.47Å; F98-W102 AromaticContact CE2-CD1 3.27Å; F98-W102 HydrophobicContact CE2-CD2 4.25Å; F98-W102 AromaticContact CE2-CG 3.77Å; F98-W102 HydrophobicContact CE2-CG 3.77Å; F98-W102 AromaticContact CE2-NE1 3.46Å; F98-W102 AromaticContact CG-CD1 3.84Å; F98-W102 HydrophobicContact CZ-CB 4.33Å; F98-W102 AromaticContact CZ-CD1 3.95Å; F98-W102 HydrophobicContact CZ-CG 4.06Å; F98-W102 WeakPolarHBondContact O-CB 3.46Å; F98-W102 PolarHBondContact O-N 3Å; W102-P106 WeakPolarHBondContact O-CG 3.35Å
103	A	89.6	Confident	91.3	Very high	51 Å²	51	88.9 Å²	88.9	42%	0.421	49%	0.487	S	S	.	.	I	π-helix	trans	-110.9	-53.8	177	0	0	0	0	0	111.3	C99 P106 C107	C99-A103 WeakPolarHBondContact O-CA 3.29Å; C99-A103 VanDerWaalsContact O-CB 3.27Å; C99-A103 WeakPolarHBondContact O-CB 3.4Å; C99-A103 PolarHBondContact O-N 3.17Å; A103-P106 WeakPolarHBondContact O-CD 3.28Å; A103-C107 VanDerWaalsContact O-CB 3.28Å; A103-C107 WeakPolarHBondContact O-CB 3.42Å; A103-C107 PolarHBondContact O-N 2.88Å; A103-C107 PolarHBondContact O-SG 3.4Å
104	V	92.3	Very high	90.8	Very high	60 Å²	60	88.4 Å²	88.4	36%	0.364	49%	0.486	S	S	.	.	I	π-helix	trans	-68.3	-47.9	-171.5	-179.6	0	0	0	0	112	C99 H100 C107 I108	C99-V104 PolarHBondContact O-N 2.86Å; H100-V104 WeakPolarHBondContact O-CB 3.17Å; H100-V104 PolarHBondContact O-N 3.47Å; V104-C107 PolarHBondContact O-N 2.78Å; V104-I108 HydrophobicContact CG1-CD1 3.6Å; V104-I108 HydrophobicContact CG1-CG1 4.12Å; V104-I108 WeakPolarHBondContact O-CB 3.12Å; V104-I108 VanDerWaalsContact O-CG1 3.29Å; V104-I108 WeakPolarHBondContact O-CG1 3.44Å; V104-I108 PolarHBondContact O-N 3.43Å
105	V	92.3	Very high	90.1	Very high	58 Å²	58	88.7 Å²	88.7	35%	0.352	49%	0.485	S	S	.	.	H	α-helix	trans	-61.1	-47.7	-179.1	171.5	0	0	0	0	111.7	H100 C107 I108 K109	H100-V105 WeakPolarHBondContact O-CG2 3.41Å; H100-V105 PolarHBondContact O-N 2.97Å; V105-C107 PolarHBondContact O-N 2.9Å; V105-I108 PolarHBondContact O-N 2.89Å; V105-K109 HydrophobicContact CG1-CG 4.42Å; V105-K109 WeakPolarHBondContact O-CB 3.09Å; V105-K109 WeakPolarHBondContact O-CG 3.47Å; V105-K109 PolarHBondContact O-N 2.64Å
106	P	90.9	Very high	89.6	Confident	60 Å²	60	91.8 Å²	91.8	39%	0.39	50%	0.495	S	S	.	.	H	α-helix	trans	-59.7	-43.5	172.5	-28.2	37.7	0	0	0	113.1	I101 W102 A103 I108 K109 S110	I101-P106 VanDerWaalsContact O-CD 3.32Å; I101-P106 WeakPolarHBondContact O-CD 3.37Å; W102-P106 WeakPolarHBondContact O-CG 3.35Å; A103-P106 WeakPolarHBondContact O-CD 3.28Å; P106-I108 PolarHBondContact O-N 3.4Å; P106-K109 PolarHBondContact O-N 3.38Å; P106-S110 WeakPolarHBondContact O-CB 3.23Å; P106-S110 PolarHBondContact O-N 3.43Å; P106-S110 PolarHBondContact O-OG 2.71Å
107	C	86.8	Confident	88.8	Confident	79 Å²	79	89.4 Å²	89.4	53%	0.534	49%	0.487	S	S	.	.	H	α-helix	trans	-60.8	-43.3	177.3	-73.6	0	0	0	0	112.4	A103 V104 V105 S110 C111	A103-C107 VanDerWaalsContact O-CB 3.28Å; A103-C107 WeakPolarHBondContact O-CB 3.42Å; A103-C107 PolarHBondContact O-N 2.88Å; A103-C107 PolarHBondContact O-SG 3.4Å; V104-C107 PolarHBondContact O-N 2.78Å; V105-C107 PolarHBondContact O-N 2.9Å; C107-S110 PolarHBondContact O-N 2.69Å; C107-C111 WeakPolarHBondContact O-CB 3.15Å; C107-C111 PolarHBondContact O-N 2.96Å
108	I	90.6	Very high	88.3	Confident	88 Å²	88	92.2 Å²	92.2	45%	0.451	50%	0.497	S	S	.	.	H	α-helix	trans	-61.7	-46.7	175.1	-69.3	171	0	0	0	109.6	V104 V105 P106 S110 C111 L112	V104-I108 HydrophobicContact CG1-CD1 3.6Å; V104-I108 HydrophobicContact CG1-CG1 4.12Å; V104-I108 WeakPolarHBondContact O-CB 3.12Å; V104-I108 VanDerWaalsContact O-CG1 3.29Å; V104-I108 WeakPolarHBondContact O-CG1 3.44Å; V104-I108 PolarHBondContact O-N 3.43Å; V105-I108 PolarHBondContact O-N 2.89Å; P106-I108 PolarHBondContact O-N 3.4Å; I108-S110 VanDerWaalsContact C-N 3.33Å; I108-S110 PolarHBondContact O-N 3.09Å; I108-C111 PolarHBondContact O-N 2.93Å; I108-L112 HydrophobicContact CG2-CD1 4.11Å; I108-L112 HydrophobicContact CG2-CG 4.43Å; I108-L112 WeakPolarHBondContact O-CG 3.33Å; I108-L112 PolarHBondContact O-N 3.41Å
109	K	88.1	Confident	87.8	Confident	133 Å²	133	89.3 Å²	89.3	58%	0.578	49%	0.492	S	S	*	.	H	α-helix	trans	-60.5	-41.9	178.2	-68.9	-75.3	-174.1	170.1	0	111.7	V105 P106 L112 I113	V105-K109 HydrophobicContact CG1-CG 4.42Å; V105-K109 WeakPolarHBondContact O-CB 3.09Å; V105-K109 WeakPolarHBondContact O-CG 3.47Å; V105-K109 PolarHBondContact O-N 2.64Å; P106-K109 PolarHBondContact O-N 3.38Å; K109-L112 PolarHBondContact O-N 3.39Å; K109-I113 WeakPolarHBondContact O-CG1 3.25Å; K109-I113 PolarHBondContact O-N 3.46Å; K109-I113 VanDerWaalsContact O-N 3.14Å
110	S	86.5	Confident	87.4	Confident	69 Å²	69	93.7 Å²	93.7	48%	0.483	50%	0.498	S	S	.	.	H	α-helix	trans	-63.3	-46.8	174.3	-66.5	0	0	0	0	112	P106 C107 I108 L112 I113 E114	P106-S110 WeakPolarHBondContact O-CB 3.23Å; P106-S110 PolarHBondContact O-N 3.43Å; P106-S110 PolarHBondContact O-OG 2.71Å; C107-S110 PolarHBondContact O-N 2.69Å; I108-S110 VanDerWaalsContact C-N 3.33Å; I108-S110 PolarHBondContact O-N 3.09Å; S110-L112 VanDerWaalsContact C-N 3.27Å; S110-L112 PolarHBondContact O-N 3.34Å; S110-I113 PolarHBondContact O-N 3.05Å; S110-I113 VanDerWaalsContact O-N 3.13Å; S110-E114 WeakPolarHBondContact O-CG 3.17Å; S110-E114 PolarHBondContact O-N 3.23Å
111	C	87.3	Confident	87.1	Confident	90 Å²	90	94 Å²	94	61%	0.608	50%	0.502	S	S	*	.	H	α-helix	trans	-59.3	-36.9	175.1	-88.3	0	0	0	0	112.7	C107 I108 E114 S115	C107-C111 WeakPolarHBondContact O-CB 3.15Å; C107-C111 PolarHBondContact O-N 2.96Å; I108-C111 PolarHBondContact O-N 2.93Å; C111-E114 PolarHBondContact O-N 3.47Å; C111-S115 VanDerWaalsContact O-CB 3.29Å; C111-S115 WeakPolarHBondContact O-CB 3.36Å; C111-S115 PolarHBondContact O-N 2.93Å
112	L	86.7	Confident	86.8	Confident	103 Å²	103	96.4 Å²	96.4	54%	0.539	51%	0.506	S	S	.	.	H	α-helix	trans	-66.2	-38.5	176.3	-72.1	173.3	0	0	0	112	I108 K109 S110 S115 Q116	I108-L112 HydrophobicContact CG2-CD1 4.11Å; I108-L112 HydrophobicContact CG2-CG 4.43Å; I108-L112 WeakPolarHBondContact O-CG 3.33Å; I108-L112 PolarHBondContact O-N 3.41Å; K109-L112 PolarHBondContact O-N 3.39Å; S110-L112 VanDerWaalsContact C-N 3.27Å; S110-L112 PolarHBondContact O-N 3.34Å; L112-S115 PolarHBondContact O-N 3.49Å; L112-Q116 WeakPolarHBondContact O-CB 3.43Å; L112-Q116 PolarHBondContact O-N 3.46Å
113	I	88.6	Confident	86.5	Confident	102 Å²	102	90.7 Å²	90.7	52%	0.523	49%	0.494	S	S	.	.	H	α-helix	trans	-64.3	-46.5	175.2	-65.1	163.9	0	0	0	110.2	K109 S110 S115 Q116 C117	K109-I113 WeakPolarHBondContact O-CG1 3.25Å; K109-I113 PolarHBondContact O-N 3.46Å; K109-I113 VanDerWaalsContact O-N 3.14Å; S110-I113 PolarHBondContact O-N 3.05Å; S110-I113 VanDerWaalsContact O-N 3.13Å; I113-S115 PolarHBondContact O-N 3.47Å; I113-Q116 WeakPolarHBondContact O-CB 3.45Å; I113-Q116 PolarHBondContact O-N 3.27Å; I113-Q116 VanDerWaalsContact O-N 3.17Å; I113-C117 PolarHBondContact O-N 3.36Å; I113-C117 VanDerWaalsContact O-N 3.15Å
114	E	83.6	Confident	86.4	Confident	123 Å²	123	93.3 Å²	93.3	58%	0.575	50%	0.5	S	S	*	.	H	α-helix	trans	-60.1	-45.1	175.4	-67.9	-61	149.3	0	0	111.6	S110 C111 Q116 C117 I118	S110-E114 WeakPolarHBondContact O-CG 3.17Å; S110-E114 PolarHBondContact O-N 3.23Å; C111-E114 PolarHBondContact O-N 3.47Å; E114-Q116 VanDerWaalsContact C-N 3.25Å; E114-Q116 PolarHBondContact O-N 2.93Å; E114-C117 WeakPolarHBondContact O-CB 3.22Å; E114-C117 PolarHBondContact O-N 2.97Å; E114-C117 VanDerWaalsContact O-N 3.12Å; E114-I118 WeakPolarHBondContact O-CG1 3.37Å; E114-I118 PolarHBondContact O-N 2.76Å
115	S	80.6	Confident	86.1	Confident	66 Å²	66	93.3 Å²	93.3	46%	0.462	50%	0.502	S	S	.	.	H	α-helix	trans	-61.9	-33.1	176.5	-174.7	0	0	0	0	112.4	C111 L112 I113 C117 I118 S119	C111-S115 VanDerWaalsContact O-CB 3.29Å; C111-S115 WeakPolarHBondContact O-CB 3.36Å; C111-S115 PolarHBondContact O-N 2.93Å; L112-S115 PolarHBondContact O-N 3.49Å; I113-S115 PolarHBondContact O-N 3.47Å; S115-C117 VanDerWaalsContact C-N 3.34Å; S115-I118 PolarHBondContact O-N 3.23Å; S115-S119 VanDerWaalsContact O-CB 3.28Å; S115-S119 WeakPolarHBondContact O-CB 3.4Å; S115-S119 PolarHBondContact O-N 3.02Å
116	Q	82.8	Confident	85.9	Confident	115 Å²	115	93.4 Å²	93.4	54%	0.537	50%	0.5	S	S	.	.	H	α-helix	trans	-70.5	-33.8	177.2	-159.7	169.1	4.4	0	0	111.4	L112 I113 E114 R120	L112-Q116 WeakPolarHBondContact O-CB 3.43Å; L112-Q116 PolarHBondContact O-N 3.46Å; I113-Q116 WeakPolarHBondContact O-CB 3.45Å; I113-Q116 PolarHBondContact O-N 3.27Å; I113-Q116 VanDerWaalsContact O-N 3.17Å; E114-Q116 VanDerWaalsContact C-N 3.25Å; E114-Q116 PolarHBondContact O-N 2.93Å; Q116-R120 WeakPolarHBondContact O-CG 3.38Å; Q116-R120 PolarHBondContact O-N 2.86Å
117	C	76.7	Confident	85.7	Confident	56 Å²	56	96.4 Å²	96.4	38%	0.378	51%	0.508	S	S	.	.	H	α-helix	trans	-65.9	-47.2	170.2	-67.5	0	0	0	0	111.7	I113 E114 S115 S119 R120 I121	I113-C117 PolarHBondContact O-N 3.36Å; I113-C117 VanDerWaalsContact O-N 3.15Å; E114-C117 WeakPolarHBondContact O-CB 3.22Å; E114-C117 PolarHBondContact O-N 2.97Å; E114-C117 VanDerWaalsContact O-N 3.12Å; S115-C117 VanDerWaalsContact C-N 3.34Å; C117-S119 VanDerWaalsContact C-N 3.33Å; C117-S119 PolarHBondContact O-N 3.1Å; C117-R120 PolarHBondContact O-N 3.02Å; C117-I121 WeakPolarHBondContact O-CG1 3.48Å; C117-I121 PolarHBondContact O-N 2.92Å; C117-I121 VanDerWaalsContact O-N 3.08Å
118	I	84.8	Confident	85.7	Confident	109 Å²	109	96.9 Å²	96.9	56%	0.559	51%	0.509	S	S	*	.	H	α-helix	trans	-60.7	-43.3	176.8	-65.5	168	0	0	0	110.8	E114 S115 R120 I121 Y122	E114-I118 WeakPolarHBondContact O-CG1 3.37Å; E114-I118 PolarHBondContact O-N 2.76Å; S115-I118 PolarHBondContact O-N 3.23Å; I118-R120 VanDerWaalsContact C-N 3.3Å; I118-R120 PolarHBondContact O-N 3.19Å; I118-I121 PolarHBondContact O-N 3.01Å; I118-Y122 VanDerWaalsContact O-CB 3.26Å; I118-Y122 WeakPolarHBondContact O-CB 3.22Å; I118-Y122 PolarHBondContact O-N 3.4Å
119	S	84.1	Confident	85.4	Confident	63 Å²	63	99.6 Å²	99.6	44%	0.441	52%	0.518	S	S	.	.	H	α-helix	trans	-59.6	-39.1	177.4	174.4	0	0	0	0	112.4	S115 C117 S123	S115-S119 VanDerWaalsContact O-CB 3.28Å; S115-S119 WeakPolarHBondContact O-CB 3.4Å; S115-S119 PolarHBondContact O-N 3.02Å; C117-S119 VanDerWaalsContact C-N 3.33Å; C117-S119 PolarHBondContact O-N 3.1Å; S119-S123 WeakPolarHBondContact O-CB 3.34Å; S119-S123 PolarHBondContact O-N 3.33Å; S119-S123 PolarHBondContact O-OG 2.88Å
120	R	84.3	Confident	85	Confident	161 Å²	161	95.5 Å²	95.5	61%	0.608	51%	0.505	S	S	*	.	H	α-helix	trans	-64.8	-46.5	174	-73	174.8	-177.5	166.4	2.2	111.9	Q116 C117 I118 Y122 S123 L124	Q116-R120 WeakPolarHBondContact O-CG 3.38Å; Q116-R120 PolarHBondContact O-N 2.86Å; C117-R120 PolarHBondContact O-N 3.02Å; I118-R120 VanDerWaalsContact C-N 3.3Å; I118-R120 PolarHBondContact O-N 3.19Å; R120-Y122 VanDerWaalsContact C-N 3.34Å; R120-Y122 PolarHBondContact O-N 3.22Å; R120-S123 PolarHBondContact O-N 3.04Å; R120-L124 WeakPolarHBondContact O-CG 3.21Å; R120-L124 PolarHBondContact O-N 3.25Å
121	I	86.4	Confident	84.8	Confident	105 Å²	105	96 Å²	96	54%	0.538	50%	0.502	S	S	.	.	H	α-helix	trans	-61.6	-46.1	177.8	-64.4	165.5	0	0	0	110.2	C117 I118 S123 L124 C125	C117-I121 WeakPolarHBondContact O-CG1 3.48Å; C117-I121 PolarHBondContact O-N 2.92Å; C117-I121 VanDerWaalsContact O-N 3.08Å; I118-I121 PolarHBondContact O-N 3.01Å; I121-S123 VanDerWaalsContact C-N 3.34Å; I121-S123 PolarHBondContact O-N 3.27Å; I121-L124 WeakPolarHBondContact O-CB 3.31Å; I121-L124 PolarHBondContact O-N 3.11Å; I121-C125 PolarHBondContact O-N 2.84Å; I121-C125 PolarHBondContact O-SG 3.37Å; I121-C125 VanDerWaalsContact O-SG 3.34Å
122	Y	86.6	Confident	84.7	Confident	153 Å²	153	95 Å²	95	60%	0.6	50%	0.495	S	S	*	.	H	α-helix	trans	-58.6	-44.2	176.5	-179.8	-103	0	0	0	112.2	I118 R120 C125 I126	I118-Y122 VanDerWaalsContact O-CB 3.26Å; I118-Y122 WeakPolarHBondContact O-CB 3.22Å; I118-Y122 PolarHBondContact O-N 3.4Å; R120-Y122 VanDerWaalsContact C-N 3.34Å; R120-Y122 PolarHBondContact O-N 3.22Å; Y122-C125 PolarHBondContact O-N 2.84Å; Y122-I126 HydrophobicContact CD1-CD1 3.99Å; Y122-I126 HydrophobicContact CE1-CD1 3.34Å; Y122-I126 HydrophobicContact CE1-CG1 4.3Å; Y122-I126 HydrophobicContact CE2-CD1 4.27Å; Y122-I126 PolarHBondContact O-N 2.89Å
123	S	87.1	Confident	84.6	Confident	61 Å²	61	96.4 Å²	96.4	43%	0.427	50%	0.497	S	S	.	.	H	α-helix	trans	-63.2	-43	176.4	-56.4	0	0	0	0	111.6	S119 R120 I121 C125 I126 Q127	S119-S123 WeakPolarHBondContact O-CB 3.34Å; S119-S123 PolarHBondContact O-N 3.33Å; S119-S123 PolarHBondContact O-OG 2.88Å; R120-S123 PolarHBondContact O-N 3.04Å; I121-S123 VanDerWaalsContact C-N 3.34Å; I121-S123 PolarHBondContact O-N 3.27Å; S123-C125 VanDerWaalsContact C-N 3.34Å; S123-C125 PolarHBondContact O-N 3.49Å; S123-I126 PolarHBondContact O-N 3.42Å; S123-Q127 WeakPolarHBondContact O-CB 3.25Å; S123-Q127 PolarHBondContact O-N 3.07Å
124	L	87.2	Confident	84.4	Confident	105 Å²	105	97.9 Å²	97.9	55%	0.55	50%	0.5	S	S	.	.	H	α-helix	trans	-62	-40.9	174.8	-71.8	169.1	0	0	0	111.9	R120 I121 Q127 T128	R120-L124 WeakPolarHBondContact O-CG 3.21Å; R120-L124 PolarHBondContact O-N 3.25Å; I121-L124 WeakPolarHBondContact O-CB 3.31Å; I121-L124 PolarHBondContact O-N 3.11Å; L124-Q127 PolarHBondContact O-N 3.17Å; L124-T128 VanDerWaalsContact O-CB 3.29Å; L124-T128 WeakPolarHBondContact O-CB 3.42Å; L124-T128 PolarHBondContact O-N 3.37Å; L124-T128 PolarHBondContact O-OG1 3.48Å
125	C	86	Confident	84.5	Confident	60 Å²	60	97.7 Å²	97.7	41%	0.405	50%	0.499	S	S	.	.	H	α-helix	trans	-62.5	-46.3	175.9	-72.3	0	0	0	0	111.7	I121 Y122 S123 Q127 T128 F129	I121-C125 PolarHBondContact O-N 2.84Å; I121-C125 PolarHBondContact O-SG 3.37Å; I121-C125 VanDerWaalsContact O-SG 3.34Å; Y122-C125 PolarHBondContact O-N 2.84Å; S123-C125 VanDerWaalsContact C-N 3.34Å; S123-C125 PolarHBondContact O-N 3.49Å; C125-Q127 VanDerWaalsContact C-N 3.34Å; C125-Q127 PolarHBondContact O-N 3.48Å; C125-T128 PolarHBondContact O-N 3.48Å; C125-F129 WeakPolarHBondContact O-CB 3.33Å; C125-F129 WeakPolarHBondContact O-CD2 3.24Å; C125-F129 PolarHBondContact O-N 3.45Å
126	I	88.2	Confident	84.7	Confident	60 Å²	60	96.9 Å²	96.9	31%	0.308	50%	0.496	S	S	.	.	I	π-helix	trans	-59.2	-48	175.5	-70.8	-177.3	0	0	0	110.3	Y122 S123 T128 F129 C130 D131	Y122-I126 HydrophobicContact CD1-CD1 3.99Å; Y122-I126 HydrophobicContact CE1-CD1 3.34Å; Y122-I126 HydrophobicContact CE1-CG1 4.3Å; Y122-I126 HydrophobicContact CE2-CD1 4.27Å; Y122-I126 PolarHBondContact O-N 2.89Å; S123-I126 PolarHBondContact O-N 3.42Å; I126-T128 VanDerWaalsContact C-N 3.28Å; I126-T128 PolarHBondContact O-N 2.97Å; I126-F129 PolarHBondContact O-N 3.37Å; I126-C130 HydrophobicContact CB-CB 4.48Å; I126-C130 HydrophobicContact CG2-CB 3.95Å; I126-C130 CarbonylContact O-C 3.59Å; I126-C130 VanDerWaalsContact O-CA 3.3Å; I126-C130 WeakPolarHBondContact O-CA 3.39Å; I126-C130 WeakPolarHBondContact O-CB 3.46Å; I126-C130 PolarHBondContact O-N 3.04Å; I126-D131 PolarHBondContact O-N 3.03Å
127	Q	87.5	Confident	84.8	Confident	123 Å²	123	94 Å²	94	58%	0.575	49%	0.485	S	S	*	.	I	π-helix	trans	-66.7	-29.4	-178.3	-169.4	161.3	19.2	0	0	113.2	S123 L124 C125 D131	S123-Q127 WeakPolarHBondContact O-CB 3.25Å; S123-Q127 PolarHBondContact O-N 3.07Å; L124-Q127 PolarHBondContact O-N 3.17Å; C125-Q127 VanDerWaalsContact C-N 3.34Å; C125-Q127 PolarHBondContact O-N 3.48Å; Q127-D131 WeakPolarHBondContact CG-OD2 3.45Å; Q127-D131 WeakPolarHBondContact O-CB 3.33Å
128	T	86.5	Confident	85.2	Confident	89 Å²	89	93.3 Å²	93.3	55%	0.546	49%	0.486	S	S	.	.	I	π-helix	trans	-84.4	-34.7	-179.4	-53.1	0	0	0	0	112.5	L124 C125 I126 P132	L124-T128 VanDerWaalsContact O-CB 3.29Å; L124-T128 WeakPolarHBondContact O-CB 3.42Å; L124-T128 PolarHBondContact O-N 3.37Å; L124-T128 PolarHBondContact O-OG1 3.48Å; C125-T128 PolarHBondContact O-N 3.48Å; I126-T128 VanDerWaalsContact C-N 3.28Å; I126-T128 PolarHBondContact O-N 2.97Å; T128-P132 WeakPolarHBondContact O-CG 3.46Å
129	F	83.3	Confident	85.1	Confident	146 Å²	146	94 Å²	94	64%	0.64	49%	0.485	S	S	*	.	I	π-helix	trans	-109.7	-48	-173.4	-68.5	-76.6	0	0	0	113.1	C125 I126 F133	C125-F129 WeakPolarHBondContact O-CB 3.33Å; C125-F129 WeakPolarHBondContact O-CD2 3.24Å; C125-F129 PolarHBondContact O-N 3.45Å; I126-F129 PolarHBondContact O-N 3.37Å; F129-F133 VanDerWaalsContact O-CB 3.24Å; F129-F133 WeakPolarHBondContact O-CB 3.44Å; F129-F133 PolarHBondContact O-N 2.83Å
130	C	80.6	Confident	85	Confident	46 Å²	46	96.3 Å²	96.3	31%	0.311	49%	0.492	S	S	.	.	I	π-helix	trans	-76.4	-44.2	-175.2	-63.8	0	0	0	0	111.3	I126 F133 F134	I126-C130 HydrophobicContact CB-CB 4.48Å; I126-C130 HydrophobicContact CG2-CB 3.95Å; I126-C130 CarbonylContact O-C 3.59Å; I126-C130 VanDerWaalsContact O-CA 3.3Å; I126-C130 WeakPolarHBondContact O-CA 3.39Å; I126-C130 WeakPolarHBondContact O-CB 3.46Å; I126-C130 PolarHBondContact O-N 3.04Å; C130-F133 WeakPolarHBondContact O-CB 3.28Å; C130-F133 PolarHBondContact O-N 2.97Å; C130-F133 VanDerWaalsContact O-N 3.14Å; C130-F134 HydrophobicContact CB-CD2 3.89Å; C130-F134 HydrophobicContact CB-CE2 3.86Å; C130-F134 WeakPolarHBondContact O-CB 3.42Å; C130-F134 WeakPolarHBondContact O-CD2 3.41Å; C130-F134 PolarHBondContact O-N 3.3Å
131	D	82.4	Confident	84.7	Confident	79 Å²	79	95.4 Å²	95.4	42%	0.422	49%	0.493	S	S	.	.	H	α-helix	trans	-56.4	-52.9	179.5	-76.2	2.5	0	0	0	113	I126 Q127 F133 F134 E135	I126-D131 PolarHBondContact O-N 3.03Å; Q127-D131 WeakPolarHBondContact CG-OD2 3.45Å; Q127-D131 WeakPolarHBondContact O-CB 3.33Å; D131-F133 PolarHBondContact O-N 2.91Å; D131-F134 PolarHBondContact O-N 3.43Å; D131-E135 WeakPolarHBondContact O-CB 3.42Å; D131-E135 PolarHBondContact O-N 3.43Å
132	P	85.5	Confident	84.2	Confident	71 Å²	71	94.6 Å²	94.6	46%	0.461	50%	0.496	S	S	.	.	H	α-helix	trans	-65.2	-29.7	177.8	23.8	-32.3	0	0	0	112.7	T128 A136	T128-P132 WeakPolarHBondContact O-CG 3.46Å; P132-A136 VanDerWaalsContact O-CB 3.27Å; P132-A136 WeakPolarHBondContact O-CB 3.27Å; P132-A136 PolarHBondContact O-N 2.89Å
133	F	84.3	Confident	83.5	Confident	132 Å²	132	92 Å²	92	58%	0.579	50%	0.501	S	S	*	.	H	α-helix	trans	-70.2	-46.8	177	-170.9	-100.5	0	0	0	111.9	F129 C130 D131 A136 L137	F129-F133 VanDerWaalsContact O-CB 3.24Å; F129-F133 WeakPolarHBondContact O-CB 3.44Å; F129-F133 PolarHBondContact O-N 2.83Å; C130-F133 WeakPolarHBondContact O-CB 3.28Å; C130-F133 PolarHBondContact O-N 2.97Å; C130-F133 VanDerWaalsContact O-N 3.14Å; D131-F133 PolarHBondContact O-N 2.91Å; F133-A136 PolarHBondContact O-N 3.26Å; F133-L137 HydrophobicContact CD1-CD1 3.74Å; F133-L137 HydrophobicContact CD1-CG 4.38Å; F133-L137 HydrophobicContact CE1-CD1 3.47Å; F133-L137 VanDerWaalsContact CE1-CD1 3.47Å; F133-L137 HydrophobicContact CE1-CG 4.2Å; F133-L137 HydrophobicContact CZ-CD1 4.24Å; F133-L137 WeakPolarHBondContact O-CG 3.42Å; F133-L137 PolarHBondContact O-N 3.15Å
134	F	84.3	Confident	82.8	Confident	133 Å²	133	93.9 Å²	93.9	58%	0.583	51%	0.509	S	S	*	.	H	α-helix	trans	-69.6	-35.6	176.6	-75.4	-65.6	0	0	0	112.1	C130 D131 L137 G138	C130-F134 HydrophobicContact CB-CD2 3.89Å; C130-F134 HydrophobicContact CB-CE2 3.86Å; C130-F134 WeakPolarHBondContact O-CB 3.42Å; C130-F134 WeakPolarHBondContact O-CD2 3.41Å; C130-F134 PolarHBondContact O-N 3.3Å; D131-F134 PolarHBondContact O-N 3.43Å; F134-L137 HydrophobicContact CD1-CD1 4.25Å; F134-L137 PolarHBondContact O-N 2.85Å; F134-G138 PolarHBondContact O-N 2.82Å
135	E	85.1	Confident	81.9	Confident	118 Å²	118	98.3 Å²	98.3	55%	0.551	52%	0.524	S	S	*	.	H	α-helix	trans	-59.4	-45.5	170	179.1	88.1	-150.4	0	0	110.9	D131 G138 K139	D131-E135 WeakPolarHBondContact O-CB 3.42Å; D131-E135 PolarHBondContact O-N 3.43Å; E135-G138 PolarHBondContact O-N 3.05Å; E135-K139 WeakPolarHBondContact O-CG 3.4Å; E135-K139 PolarHBondContact O-N 2.88Å; E135-K139 VanDerWaalsContact O-N 3.08Å; E135-K139 IonicContact OE1-NZ 3.49Å; E135-K139 PolarHBondContact OE1-NZ 2.95Å
136	A	85.2	Confident	81.1	Confident	49 Å²	49	101.1 Å²	101.1	41%	0.405	54%	0.539	S	S	.	.	H	α-helix	trans	-65	-45.1	177	0	0	0	0	0	112.1	P132 F133 G138 K139 I140	P132-A136 VanDerWaalsContact O-CB 3.27Å; P132-A136 WeakPolarHBondContact O-CB 3.27Å; P132-A136 PolarHBondContact O-N 2.89Å; F133-A136 PolarHBondContact O-N 3.26Å; A136-G138 VanDerWaalsContact C-N 3.34Å; A136-G138 PolarHBondContact O-N 3.04Å; A136-K139 PolarHBondContact O-N 3.03Å; A136-I140 WeakPolarHBondContact O-CG1 3.45Å; A136-I140 PolarHBondContact O-N 2.81Å; A136-I140 VanDerWaalsContact O-N 3.13Å
137	L	85.1	Confident	80.2	Confident	56 Å²	56	102.9 Å²	102.9	29%	0.293	56%	0.562	S	S	.	*	H	α-helix	trans	-59.9	-43.3	174	-73.4	174.9	0	0	0	111.8	F133 F134 K139 I140 F141	F133-L137 HydrophobicContact CD1-CD1 3.74Å; F133-L137 HydrophobicContact CD1-CG 4.38Å; F133-L137 HydrophobicContact CE1-CD1 3.47Å; F133-L137 VanDerWaalsContact CE1-CD1 3.47Å; F133-L137 HydrophobicContact CE1-CG 4.2Å; F133-L137 HydrophobicContact CZ-CD1 4.24Å; F133-L137 WeakPolarHBondContact O-CG 3.42Å; F133-L137 PolarHBondContact O-N 3.15Å; F134-L137 HydrophobicContact CD1-CD1 4.25Å; F134-L137 PolarHBondContact O-N 2.85Å; L137-K139 VanDerWaalsContact C-N 3.29Å; L137-K139 PolarHBondContact O-N 3.16Å; L137-I140 WeakPolarHBondContact O-CB 3.38Å; L137-I140 PolarHBondContact O-N 3.3Å; L137-I140 VanDerWaalsContact O-N 3.14Å; L137-F141 WeakPolarHBondContact O-CD2 3.43Å; L137-F141 PolarHBondContact O-N 3.45Å
138	G	85.4	Confident	79.3	Confident	40 Å²	40	104.7 Å²	104.7	41%	0.412	58%	0.575	S	S	.	*	H	α-helix	trans	-58.3	-39.4	176.1	0	0	0	0	0	112.7	F134 E135 A136 F141 S142	F134-G138 PolarHBondContact O-N 2.82Å; E135-G138 PolarHBondContact O-N 3.05Å; A136-G138 VanDerWaalsContact C-N 3.34Å; A136-G138 PolarHBondContact O-N 3.04Å; G138-F141 PolarHBondContact O-N 3.21Å; G138-S142 WeakPolarHBondContact O-CB 3.18Å; G138-S142 PolarHBondContact O-N 3.13Å
139	K	82.4	Confident	78.3	Confident	123 Å²	123	109.9 Å²	109.9	54%	0.535	59%	0.585	S	S	.	*	H	α-helix	trans	-68	-35.4	175	-74.6	175.2	-176.9	158.9	0	113.4	E135 A136 L137 F141 S142 S143	E135-K139 WeakPolarHBondContact O-CG 3.4Å; E135-K139 PolarHBondContact O-N 2.88Å; E135-K139 VanDerWaalsContact O-N 3.08Å; E135-K139 IonicContact OE1-NZ 3.49Å; E135-K139 PolarHBondContact OE1-NZ 2.95Å; A136-K139 PolarHBondContact O-N 3.03Å; L137-K139 VanDerWaalsContact C-N 3.29Å; L137-K139 PolarHBondContact O-N 3.16Å; K139-F141 VanDerWaalsContact C-N 3.35Å; K139-S142 PolarHBondContact O-OG 2.98Å; K139-S143 PolarHBondContact O-OG 2.84Å
140	I	82.5	Confident	77.2	Confident	112 Å²	112	112.3 Å²	112.3	57%	0.574	60%	0.595	S	S	*	*	H	α-helix	trans	-63.3	-45.4	174.5	-66.1	166.7	0	0	0	109.7	A136 L137	A136-I140 WeakPolarHBondContact O-CG1 3.45Å; A136-I140 PolarHBondContact O-N 2.81Å; A136-I140 VanDerWaalsContact O-N 3.13Å; L137-I140 WeakPolarHBondContact O-CB 3.38Å; L137-I140 PolarHBondContact O-N 3.3Å; L137-I140 VanDerWaalsContact O-N 3.14Å
141	F	77.9	Confident	76.2	Confident	143 Å²	143	117.4 Å²	117.4	63%	0.627	61%	0.614	S	S	*	*	H	α-helix	trans	-75.6	-30.3	179.6	-68.9	-63.1	0	0	0	113.9	L137 G138 K139 S143 V144	L137-F141 WeakPolarHBondContact O-CD2 3.43Å; L137-F141 PolarHBondContact O-N 3.45Å; G138-F141 PolarHBondContact O-N 3.21Å; K139-F141 VanDerWaalsContact C-N 3.35Å; F141-S143 PolarHBondContact O-N 3.09Å; F141-V144 WeakPolarHBondContact O-CB 3.43Å; F141-V144 PolarHBondContact O-N 3.43Å; F141-V144 VanDerWaalsContact O-N 3.09Å
142	S	76	Confident	74.7	Confident	88 Å²	88	123.8 Å²	123.8	62%	0.615	66%	0.655	S	S	*	*	H	α-helix	trans	-67.9	-21.3	179	85.7	0	0	0	0	113.5	G138 K139 V144	G138-S142 WeakPolarHBondContact O-CB 3.18Å; G138-S142 PolarHBondContact O-N 3.13Å; K139-S142 PolarHBondContact O-OG 2.98Å; S142-V144 PolarHBondContact O-N 2.87Å
143	S	70.6	Confident	74.2	Confident	99 Å²	99	126.4 Å²	126.4	69%	0.692	67%	0.665	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.1	-13.1	174.4	-64.1	0	0	0	0	112.9	K139 F141 K145	K139-S143 PolarHBondContact O-OG 2.84Å; F141-S143 PolarHBondContact O-N 3.09Å; S143-K145 PolarHBondContact O-N 2.98Å; S143-K145 VanDerWaalsContact O-N 3.15Å
144	V	72.7	Confident	73.6	Confident	100 Å²	100	126.1 Å²	126.1	61%	0.606	67%	0.67	S	S	*	*			trans	-83.6	88.4	175.9	-174.1	0	0	0	0	109.4	F141 S142 V146	F141-V144 WeakPolarHBondContact O-CB 3.43Å; F141-V144 PolarHBondContact O-N 3.43Å; F141-V144 VanDerWaalsContact O-N 3.09Å; S142-V144 PolarHBondContact O-N 2.87Å; V144-V146 HydrophobicContact CG1-CG2 4.25Å; V144-V146 PolarHBondContact O-N 2.96Å
145	K	67.6	Low	73	Confident	198 Å²	198	125.7 Å²	125.7	86%	0.861	67%	0.674	S	S	*	*			trans	-79.1	105.2	170.1	-78.8	-176	177.4	175.1	0	110.2	S143 A147	S143-K145 PolarHBondContact O-N 2.98Å; S143-K145 VanDerWaalsContact O-N 3.15Å; K145-A147 PolarHBondContact O-N 3.02Å
146	V	70.8	Confident	72.3	Confident	118 Å²	118	126.2 Å²	126.2	72%	0.715	68%	0.682	S	S	*	*			trans	-81.1	108.5	171.3	-176.5	0	0	0	0	108.7	V144 L148	V144-V146 HydrophobicContact CG1-CG2 4.25Å; V144-V146 PolarHBondContact O-N 2.96Å; V146-L148 PolarHBondContact O-N 2.95Å
147	A	69.6	Low	71.5	Confident	97 Å²	97	131 Å²	131	80%	0.802	70%	0.699	S	S	*	*			trans	-83.1	103.3	169.3	0	0	0	0	0	108.8	K145 R149	K145-A147 PolarHBondContact O-N 3.02Å; A147-R149 PolarHBondContact O-N 2.7Å; A147-R149 VanDerWaalsContact O-N 3.16Å
148	L	68.1	Low	70.6	Confident	161 Å²	161	136 Å²	136	84%	0.843	73%	0.726	S	S	*	*			trans	-71.7	106.3	171.8	-80.9	168.5	0	0	0	109.1	V146 K150	V146-L148 PolarHBondContact O-N 2.95Å; L148-K150 PolarHBondContact O-N 3.06Å
149	R	64.5	Low	69.6	Low	199 Å²	199	142.9 Å²	142.9	75%	0.751	75%	0.748	S	S	*	*			trans	-74.7	114.1	164.6	-177.6	179.2	-66.7	-82.5	0.3	107.2	A147 E151	A147-R149 PolarHBondContact O-N 2.7Å; A147-R149 VanDerWaalsContact O-N 3.16Å; R149-E151 WeakPolarHBondContact CD-OE1 3.34Å; R149-E151 WeakPolarHBondContact CG-OE1 3.37Å; R149-E151 PolarHBondContact O-N 3.32Å
150	K	61.1	Low	68.6	Low	196 Å²	196	144.4 Å²	144.4	85%	0.852	77%	0.765	S	S	*	*			trans	-83.2	103.5	171.8	-164	176.9	-177.1	178.7	0	107.3	L148	L148-K150 PolarHBondContact O-N 3.06Å
151	E	58.6	Low	67.4	Low	154 Å²	154	147.1 Å²	147.1	72%	0.72	78%	0.781	S	S	*	*			trans	-70.6	130.8	169.5	-37.7	-77.7	147.9	0	0	107.7	R149	R149-E151 WeakPolarHBondContact CD-OE1 3.34Å; R149-E151 WeakPolarHBondContact CG-OE1 3.37Å; R149-E151 PolarHBondContact O-N 3.32Å
152	V	51.7	Low	66.5	Low	212 Å²	212	147.5 Å²	147.5	100%	1.285	80%	0.795	S	S	*	*			trans	-86.1	0	178.1	172.7	0	0	0	0	110.1

Retrieved 152 of 152 residues in 49.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).