A0A674EFW0_SALTR Loading...

Eukaryotic translation initiation factor 5A

Translation factor that promotes translation elongation and termination, particularly upon ribosome stalling at specific amino acid sequence contexts. Binds between the exit (E) and peptidyl (P) site of the ribosome and promotes rescue of stalled ribosome: specifically required for efficient translation of polyproline-containing peptides as well as other motifs that stall the ribosome. Acts as ribosome quality control (RQC) cofactor by joining the RQC complex to facilitate peptidyl transfer during CAT tailing step.

AlphaFold DB , UniProt , Accession A0A674EFW0, Species SALTR (Salmo trutta, Brown trout), Gene LOC115194180, Length 155 aa.

						>A0A674EFW0_SALTR|A0A674EFW0|LOC115194180
MADADVDFQTGDAGASATFPQQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHMVGIDIFNGKKYEDICPSTHNMDVPNIKRLDYQLIGITDGYLSLLQDSGEVREDLKMPEGDMGKEIETKYDAGEEILITVLSAMNEEAAVAIKAMAK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.4	Low	47.3	Very low	251 Å²	251	137.3 Å²	137.3	100%	1.236	80%	0.795	S	S	*	*				0	115.6	0	-74.5	-168.1	164.4	0	0	107.2
2	A	44.3	Very low	47.3	Very low	104 Å²	104	138.8 Å²	138.8	86%	0.86	80%	0.798	S	S	*	*			trans	-145.5	96.3	166.2	0	0	0	0	0	104.6	A4	A2-A4 PolarHBondContact O-N 3.31Å
3	D	45.5	Very low	47.4	Very low	159 Å²	159	135.2 Å²	135.2	85%	0.85	80%	0.795	S	S	*	*			trans	-68.5	116.4	178	-139.9	-93.9	0	0	0	107.5	D5	D3-D5 PolarHBondContact O-N 3.41Å
4	A	49.7	Very low	47.4	Very low	80 Å²	80	130.6 Å²	130.6	66%	0.661	79%	0.791	S	S	*	*			trans	-84.8	96.4	173.9	0	0	0	0	0	107.3	A2 V6	A2-A4 PolarHBondContact O-N 3.31Å; A4-V6 VanDerWaalsContact C-N 3.33Å; A4-V6 PolarHBondContact O-N 2.93Å
5	D	48.4	Very low	48.2	Very low	144 Å²	144	126.7 Å²	126.7	77%	0.77	78%	0.778	S	S	*	*			trans	-61.3	95.7	168.8	-163.8	-103.8	0	0	0	108.2	D3 D7	D3-D5 PolarHBondContact O-N 3.41Å; D5-D7 PolarHBondContact O-N 2.87Å
6	V	51.7	Low	49.9	Very low	106 Å²	106	123.8 Å²	123.8	64%	0.642	76%	0.764	S	S	*	*			trans	-84.7	91.2	172.5	-85.1	0	0	0	0	107.5	A4 F8	A4-V6 VanDerWaalsContact C-N 3.33Å; A4-V6 PolarHBondContact O-N 2.93Å; V6-F8 VanDerWaalsContact C-N 3.27Å; V6-F8 HydrophobicContact CB-CD2 4.11Å; V6-F8 HydrophobicContact CB-CE2 3.94Å; V6-F8 HydrophobicContact CG2-CD2 4.16Å; V6-F8 HydrophobicContact CG2-CE2 3.85Å; V6-F8 WeakPolarHBondContact O-CD2 3.14Å; V6-F8 PolarHBondContact O-N 3.32Å
7	D	45.8	Very low	52	Low	116 Å²	116	118.8 Å²	118.8	62%	0.62	74%	0.738	S	S	*	*			trans	-62.6	88.7	167.4	-166.5	-124.3	0	0	0	108.5	D5 Q9	D5-D7 PolarHBondContact O-N 2.87Å; D7-Q9 PolarHBondContact O-N 2.93Å; D7-Q9 WeakPolarHBondContact OD1-CG 3.49Å; D7-Q9 PolarHBondContact OD1-NE2 2.75Å
8	F	50.1	Low	54.3	Low	177 Å²	177	113.6 Å²	113.6	78%	0.776	71%	0.705	S	S	*	*			trans	-71.6	85.3	168.2	-83.8	-89.7	0	0	0	107.8	V6 T10	V6-F8 VanDerWaalsContact C-N 3.27Å; V6-F8 HydrophobicContact CB-CD2 4.11Å; V6-F8 HydrophobicContact CB-CE2 3.94Å; V6-F8 HydrophobicContact CG2-CD2 4.16Å; V6-F8 HydrophobicContact CG2-CE2 3.85Å; V6-F8 WeakPolarHBondContact O-CD2 3.14Å; V6-F8 PolarHBondContact O-N 3.32Å; F8-T10 VanDerWaalsContact C-N 3.32Å; F8-T10 PolarHBondContact O-N 3.22Å
9	Q	45.1	Very low	56.3	Low	164 Å²	164	111.8 Å²	111.8	77%	0.766	69%	0.687	S	S	*	*			trans	-64.9	98.4	161.8	-66	-175.9	-20.9	0	0	107.3	D7 G11	D7-Q9 PolarHBondContact O-N 2.93Å; D7-Q9 WeakPolarHBondContact OD1-CG 3.49Å; D7-Q9 PolarHBondContact OD1-NE2 2.75Å; Q9-G11 VanDerWaalsContact C-N 3.25Å; Q9-G11 PolarHBondContact O-N 2.83Å
10	T	47.8	Very low	58.2	Low	142 Å²	142	110.8 Å²	110.8	87%	0.871	68%	0.682	S	S	*	*			trans	-58.2	96	165.4	-14.3	0	0	0	0	106.6	F8 D12	F8-T10 VanDerWaalsContact C-N 3.32Å; F8-T10 PolarHBondContact O-N 3.22Å; T10-D12 PolarHBondContact O-N 2.82Å
11	G	41.4	Very low	59.9	Low	67 Å²	67	108.4 Å²	108.4	69%	0.691	66%	0.663	S	S	*	*			trans	-64.7	101.5	177.5	0	0	0	0	0	108.7	Q9 A13	Q9-G11 VanDerWaalsContact C-N 3.25Å; Q9-G11 PolarHBondContact O-N 2.83Å; G11-A13 PolarHBondContact O-N 2.95Å
12	D	47.2	Very low	62	Low	155 Å²	155	100.3 Å²	100.3	83%	0.829	62%	0.622	S	S	*	*			trans	-60.7	95.1	158	-164.2	-97.4	0	0	0	105.7	T10 G14	T10-D12 PolarHBondContact O-N 2.82Å; D12-G14 VanDerWaalsContact C-N 3.31Å; D12-G14 PolarHBondContact O-N 2.84Å
13	A	48.4	Very low	64.3	Low	92 Å²	92	95.4 Å²	95.4	76%	0.76	58%	0.582	S	S	*	*			trans	-61.8	98.6	-178.5	0	0	0	0	0	107	G11 A15	G11-A13 PolarHBondContact O-N 2.95Å; A13-A15 VanDerWaalsContact C-N 3.26Å; A13-A15 PolarHBondContact O-N 3Å
14	G	48.4	Very low	66.4	Low	72 Å²	72	90.2 Å²	90.2	74%	0.742	56%	0.558	S	S	*	*			trans	-56.2	79	-168.5	0	0	0	0	0	113.8	D12 S16	D12-G14 VanDerWaalsContact C-N 3.31Å; D12-G14 PolarHBondContact O-N 2.84Å; G14-S16 PolarHBondContact O-N 2.92Å; G14-S16 VanDerWaalsContact O-N 3.12Å
15	A	58.2	Low	68.5	Low	72 Å²	72	88.2 Å²	88.2	60%	0.595	54%	0.541	S	S	*	.			trans	-63.9	112.6	162.3	0	0	0	0	0	106.3	A13 A17	A13-A15 VanDerWaalsContact C-N 3.26Å; A13-A15 PolarHBondContact O-N 3Å; A15-A17 PolarHBondContact O-N 3.33Å
16	S	75.6	Confident	70.7	Confident	80 Å²	80	81.6 Å²	81.6	56%	0.559	51%	0.506	S	S	*	.			trans	-47.3	130.8	176	-177.8	0	0	0	0	109.6	G14 T18 N84	G14-S16 PolarHBondContact O-N 2.92Å; G14-S16 VanDerWaalsContact O-N 3.12Å; S16-T18 VanDerWaalsContact CB-O 3.28Å; S16-T18 WeakPolarHBondContact CB-O 3.49Å; S16-T18 PolarHBondContact O-N 3.37Å; S16-T18 PolarHBondContact OG-O 2.82Å; S16-N84 PolarHBondContact O-ND2 2.89Å
17	A	85.9	Confident	72.7	Confident	38 Å²	38	84 Å²	84	31%	0.314	50%	0.503	S	S	.	.	S	Bend	trans	-57.3	-24.7	-178.5	0	0	0	0	0	112.8	A15 N84 M142	A15-A17 PolarHBondContact O-N 3.33Å; A17-N84 PolarHBondContact O-N 2.94Å; A17-M142 HydrophobicContact CB-CG 4.47Å
18	T	92.7	Very high	74.9	Confident	25 Å²	25	85 Å²	85	15%	0.153	50%	0.502	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.2	162.6	178.3	63.2	0	0	0	0	111	S16 V33 D81 V82 M142	S16-T18 VanDerWaalsContact CB-O 3.28Å; S16-T18 WeakPolarHBondContact CB-O 3.49Å; S16-T18 PolarHBondContact O-N 3.37Å; S16-T18 PolarHBondContact OG-O 2.82Å; T18-V33 HydrophobicContact CG2-CG2 3.73Å; T18-D81 HydrophobicContact CG2-CB 4.24Å; T18-D81 PolarHBondContact OG1-OD1 2.9Å; T18-V82 CarbonylContact C-O 3.55Å; T18-V82 WeakPolarHBondContact CA-O 3.49Å; T18-V82 WeakPolarHBondContact CB-O 3.17Å; T18-M142 HydrophobicContact CG2-CE 3.84Å; T18-M142 HydrophobicContact CG2-CG 4.1Å; T18-M142 HydrophobicContact CG2-SD 3.98Å
19	F	92.8	Very high	77	Confident	80 Å²	80	81.2 Å²	81.2	35%	0.351	49%	0.49	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.1	145.9	166.1	62.3	-86.4	0	0	0	110.4	Q21 V82 N84	F19-Q21 HydrophobicContact CE2-CB 4.33Å; F19-V82 HydrophobicContact CD1-CB 4.26Å; F19-V82 HydrophobicContact CD1-CG1 4.43Å; F19-V82 WeakPolarHBondContact CD1-O 3.36Å; F19-V82 HydrophobicContact CD2-CB 4.14Å; F19-V82 HydrophobicContact CE1-CB 3.85Å; F19-V82 HydrophobicContact CE1-CG1 3.57Å; F19-V82 HydrophobicContact CE2-CB 3.72Å; F19-V82 HydrophobicContact CE2-CG1 3.9Å; F19-V82 HydrophobicContact CE2-CG2 4.24Å; F19-V82 HydrophobicContact CG-CB 4.41Å; F19-V82 HydrophobicContact CZ-CB 3.57Å; F19-V82 HydrophobicContact CZ-CG1 3.27Å; F19-V82 HydrophobicContact CZ-CG2 4.43Å; F19-V82 PolarHBondContact N-O 2.85Å; F19-V82 PolarHBondContact O-N 2.73Å; F19-N84 VanDerWaalsContact CD1-OD1 3.3Å; F19-N84 WeakPolarHBondContact CD1-OD1 3.38Å; F19-N84 WeakPolarHBondContact CE1-OD1 3.49Å
20	P	94.8	Very high	79.3	Confident	91 Å²	91	74.5 Å²	74.5	59%	0.591	47%	0.465	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-74.9	135.9	178	29.7	-33.8	0	0	0	110.9	N79	P20-N79 HydrophobicContact CB-CB 4.31Å
21	Q	94.4	Very high	81.6	Confident	61 Å²	61	70.2 Å²	70.2	29%	0.285	43%	0.434	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.4	140.2	171.9	-173.7	169.8	-5.4	0	0	110.7	F19 C23 A25 L26 N79 M80 V82	F19-Q21 HydrophobicContact CE2-CB 4.33Å; Q21-C23 PolarHBondContact O-N 2.87Å; Q21-A25 HydrophobicContact CG-CB 4Å; Q21-A25 PolarHBondContact NE2-O 3.44Å; Q21-L26 HydrophobicContact CG-CD2 4.43Å; Q21-N79 WeakPolarHBondContact O-CA 3.12Å; Q21-M80 PolarHBondContact N-O 2.94Å; Q21-M80 PolarHBondContact O-N 3.34Å; Q21-V82 HydrophobicContact CB-CG2 3.62Å
22	Q	94.4	Very high	84.3	Confident	82 Å²	82	67 Å²	67	38%	0.383	40%	0.401	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-61.8	134.4	178.7	-167.6	176.5	41.3	0	0	111.3	S24 A25 L26 S76 N79	Q22-S24 VanDerWaalsContact CD-OG 3.28Å; Q22-S24 WeakPolarHBondContact CG-OG 3.49Å; Q22-S24 PolarHBondContact O-N 2.86Å; Q22-S24 VanDerWaalsContact O-N 3.14Å; Q22-S24 PolarHBondContact OE1-OG 3.06Å; Q22-S24 VanDerWaalsContact OE1-OG 3.13Å; Q22-A25 HydrophobicContact CB-CB 4.42Å; Q22-A25 WeakPolarHBondContact O-CA 3.41Å; Q22-A25 WeakPolarHBondContact O-CB 3.49Å; Q22-A25 PolarHBondContact O-N 2.78Å; Q22-L26 PolarHBondContact O-N 2.81Å; Q22-S76 WeakPolarHBondContact CG-O 3.21Å; Q22-N79 PolarHBondContact N-OD1 3.24Å
23	C	91.4	Very high	86.6	Confident	0 Å²	0	60.5 Å²	60.5	0%	0	37%	0.367	C	S	.	.	G	3₁₀ helix	trans	-53.2	-36.2	-178.3	175.6	0	0	0	0	111.8	Q21 A25 L26 M44 V57 C74 H78 M80	Q21-C23 PolarHBondContact O-N 2.87Å; C23-A25 VanDerWaalsContact C-N 3.33Å; C23-A25 PolarHBondContact O-N 3.39Å; C23-L26 WeakPolarHBondContact O-CB 3.36Å; C23-L26 PolarHBondContact O-N 2.95Å; C23-M44 VanDerWaalsContact O-CE 3.3Å; C23-M44 WeakPolarHBondContact O-CE 3.43Å; C23-V57 VanDerWaalsContact SG-CB 3.55Å; C23-C74 HydrophobicContact CB-CB 4.18Å; C23-C74 WeakPolarHBondContact CB-SG 3.48Å; C23-C74 WeakPolarHBondContact SG-CB 3.36Å; C23-C74 CovalentContact SG-SG 2.08Å; C23-C74 PolarHBondContact SG-SG 2.84Å; C23-H78 VanDerWaalsContact CB-O 3.25Å; C23-H78 WeakPolarHBondContact CB-O 3.49Å; C23-H78 PolarHBondContact N-O 3Å; C23-M80 HydrophobicContact CB-CG 3.92Å
24	S	90.4	Very high	88.8	Confident	51 Å²	51	56.1 Å²	56.1	36%	0.357	33%	0.331	S	S	.	.	G	3₁₀ helix	trans	-70.2	-19.6	173.7	54.6	0	0	0	0	115.6	Q22 R27 S76	Q22-S24 VanDerWaalsContact CD-OG 3.28Å; Q22-S24 WeakPolarHBondContact CG-OG 3.49Å; Q22-S24 PolarHBondContact O-N 2.86Å; Q22-S24 VanDerWaalsContact O-N 3.14Å; Q22-S24 PolarHBondContact OE1-OG 3.06Å; Q22-S24 VanDerWaalsContact OE1-OG 3.13Å; S24-R27 PolarHBondContact O-NH1 2.84Å; S24-S76 WeakPolarHBondContact CB-O 3.28Å; S24-S76 PolarHBondContact N-O 2.86Å; S24-S76 PolarHBondContact OG-O 2.75Å
25	A	93.3	Very high	90.9	Very high	37 Å²	37	59.8 Å²	59.8	31%	0.306	33%	0.327	S	S	.	.	G	3₁₀ helix	trans	-86.1	-15.6	177.4	0	0	0	0	0	112.4	Q21 Q22 C23 R27	Q21-A25 HydrophobicContact CG-CB 4Å; Q21-A25 PolarHBondContact NE2-O 3.44Å; Q22-A25 HydrophobicContact CB-CB 4.42Å; Q22-A25 WeakPolarHBondContact O-CA 3.41Å; Q22-A25 WeakPolarHBondContact O-CB 3.49Å; Q22-A25 PolarHBondContact O-N 2.78Å; C23-A25 VanDerWaalsContact C-N 3.33Å; C23-A25 PolarHBondContact O-N 3.39Å; A25-R27 PolarHBondContact O-NH1 3.48Å
26	L	94.3	Very high	92.5	Very high	5 Å²	5	59 Å²	59	3%	0.026	33%	0.325	C	S	.	.			trans	-63.7	153.5	173.5	-62.2	175.8	0	0	0	111.2	Q21 Q22 C23 V32 I41 M44 M59 M80 V82	Q21-L26 HydrophobicContact CG-CD2 4.43Å; Q22-L26 PolarHBondContact O-N 2.81Å; C23-L26 WeakPolarHBondContact O-CB 3.36Å; C23-L26 PolarHBondContact O-N 2.95Å; L26-V32 HydrophobicContact CD1-CB 4.18Å; L26-V32 HydrophobicContact CD1-CG2 3.78Å; L26-I41 HydrophobicContact CB-CD1 4.02Å; L26-I41 HydrophobicContact CD1-CD1 4.39Å; L26-I41 HydrophobicContact CD2-CD1 4.49Å; L26-M44 HydrophobicContact CB-CE 3.92Å; L26-M44 HydrophobicContact CB-SD 4.47Å; L26-M44 WeakPolarHBondContact O-CE 3.41Å; L26-M59 HydrophobicContact CB-SD 4.43Å; L26-M59 HydrophobicContact CD1-CE 3.96Å; L26-M59 HydrophobicContact CD1-SD 3.53Å; L26-M59 VanDerWaalsContact CD1-SD 3.53Å; L26-M80 HydrophobicContact CD1-CB 4.18Å; L26-M80 HydrophobicContact CD1-CG 4.26Å; L26-V82 HydrophobicContact CD2-CG2 3.71Å
27	R	93.4	Very high	93.4	Very high	158 Å²	158	58.4 Å²	58.4	60%	0.596	31%	0.311	S	S	*	.			trans	-139	153.7	-177.3	-63.3	-66.9	-179.1	-92.1	1	110.1	S24 A25 G30	S24-R27 PolarHBondContact O-NH1 2.84Å; A25-R27 PolarHBondContact O-NH1 3.48Å; R27-G30 WeakPolarHBondContact O-CA 3.38Å; R27-G30 PolarHBondContact O-N 3Å
28	K	92.9	Very high	93.8	Very high	136 Å²	136	56.8 Å²	56.8	59%	0.591	30%	0.297	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55	142.2	169.1	-176.2	172.7	176	167.4	0	109.9	G30 V42	K28-G30 PolarHBondContact O-N 3.28Å; K28-V42 WeakPolarHBondContact CE-O 3.18Å
29	N	93.4	Very high	94	Very high	97 Å²	97	55.6 Å²	55.6	52%	0.519	29%	0.29	S	S	.	.	T	Hydrogen-bonded Turn	trans	66.2	0	-169.2	-60.4	-66.3	0	0	0	115.9	K40 I41	N29-K40 WeakPolarHBondContact OD1-CE 3.37Å; N29-I41 WeakPolarHBondContact CA-O 3.29Å; N29-I41 PolarHBondContact N-O 2.79Å
30	G	95	Very high	94.2	Very high	24 Å²	24	55.8 Å²	55.8	25%	0.247	29%	0.29	C	S	.	.			trans	-74.2	-179.8	167.6	0	0	0	0	0	112.3	R27 K28 K40 I41	R27-G30 WeakPolarHBondContact O-CA 3.38Å; R27-G30 PolarHBondContact O-N 3Å; K28-G30 PolarHBondContact O-N 3.28Å; G30-K40 WeakPolarHBondContact O-CA 3.42Å; G30-I41 PolarHBondContact O-N 3.21Å
31	F	96.1	Very high	94.3	Very high	51 Å²	51	51.4 Å²	51.4	22%	0.224	26%	0.262	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.7	149.6	177	-57.8	-81.4	0	0	0	110.7	C39 K40 I64 V82 P83 I85	F31-C39 CarbonylContact C-O 3.52Å; F31-C39 VanDerWaalsContact CA-O 3.29Å; F31-C39 WeakPolarHBondContact CA-O 3.16Å; F31-K40 HydrophobicContact CD1-CB 4.14Å; F31-K40 HydrophobicContact CE1-CB 4.03Å; F31-K40 HydrophobicContact CE1-CG 4.24Å; F31-I64 HydrophobicContact CD1-CG2 4.21Å; F31-I64 HydrophobicContact CE1-CG2 4.05Å; F31-V82 WeakPolarHBondContact O-CG1 3.2Å; F31-P83 HydrophobicContact CB-CG 3.9Å; F31-I85 HydrophobicContact CB-CG1 4.37Å; F31-I85 HydrophobicContact CD1-CD1 4.41Å; F31-I85 HydrophobicContact CD1-CG1 4.08Å; F31-I85 HydrophobicContact CD2-CG1 3.93Å; F31-I85 HydrophobicContact CE1-CG1 4.36Å; F31-I85 HydrophobicContact CE2-CG1 4.23Å; F31-I85 HydrophobicContact CG-CG1 3.86Å; F31-I85 HydrophobicContact CZ-CG1 4.43Å
32	V	96.4	Very high	94.4	Very high	0 Å²	0	51 Å²	51	0%	0	26%	0.263	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-157.2	149.7	175.7	64.2	0	0	0	0	108.7	L26 L34 C39 I41 M80 D81	L26-V32 HydrophobicContact CD1-CB 4.18Å; L26-V32 HydrophobicContact CD1-CG2 3.78Å; V32-L34 HydrophobicContact CG1-CD1 4.32Å; V32-L34 HydrophobicContact CG1-CD2 3.86Å; V32-L34 HydrophobicContact CG1-CG 3.88Å; V32-L34 HydrophobicContact CG2-CD2 4.37Å; V32-C39 PolarHBondContact N-O 3.4Å; V32-C39 PolarHBondContact O-N 2.77Å; V32-I41 HydrophobicContact CB-CD1 4.12Å; V32-I41 HydrophobicContact CB-CG1 4.29Å; V32-I41 HydrophobicContact CG1-CD1 3.8Å; V32-I41 HydrophobicContact CG1-CG1 3.51Å; V32-M80 HydrophobicContact CG2-CB 3.95Å; V32-M80 HydrophobicContact CG2-CE 4.34Å; V32-D81 WeakPolarHBondContact CG2-O 3.34Å
33	V	95.9	Very high	94.4	Very high	18 Å²	18	51.8 Å²	51.8	11%	0.109	27%	0.267	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.2	117.4	172.2	-174.8	0	0	0	0	108.5	T18 R37 D81 P83 M142	T18-V33 HydrophobicContact CG2-CG2 3.73Å; V33-R37 WeakPolarHBondContact CA-O 3.46Å; V33-D81 HydrophobicContact CB-CB 3.92Å; V33-D81 HydrophobicContact CG2-CB 3.82Å; V33-D81 PolarHBondContact N-O 2.87Å; V33-P83 HydrophobicContact CG2-CB 4.21Å; V33-P83 HydrophobicContact CG2-CG 4.35Å; V33-M142 HydrophobicContact CB-SD 4.44Å; V33-M142 HydrophobicContact CG1-CE 4.02Å; V33-M142 HydrophobicContact CG1-SD 4.08Å; V33-M142 HydrophobicContact CG2-CE 4.1Å; V33-M142 HydrophobicContact CG2-SD 3.5Å; V33-M142 VanDerWaalsContact CG2-SD 3.5Å
34	L	94.9	Very high	94.6	Very high	1 Å²	1	54.2 Å²	54.2	1%	0.005	28%	0.279	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.2	123.8	173.6	-58.8	178.7	0	0	0	108.5	V32 G36 R37 C39 M59 D72 M80	V32-L34 HydrophobicContact CG1-CD1 4.32Å; V32-L34 HydrophobicContact CG1-CD2 3.86Å; V32-L34 HydrophobicContact CG1-CG 3.88Å; V32-L34 HydrophobicContact CG2-CD2 4.37Å; L34-G36 PolarHBondContact O-N 3.43Å; L34-G36 VanDerWaalsContact O-N 3.16Å; L34-R37 PolarHBondContact N-O 3.35Å; L34-R37 PolarHBondContact O-N 3.31Å; L34-C39 HydrophobicContact CD1-CB 4.1Å; L34-C39 HydrophobicContact CG-CB 4.22Å; L34-M59 HydrophobicContact CD2-CE 4.43Å; L34-D72 HydrophobicContact CD2-CB 3.94Å; L34-M80 HydrophobicContact CD2-CE 4.41Å
35	K	92.3	Very high	94.7	Very high	149 Å²	149	54.3 Å²	54.3	65%	0.648	28%	0.28	S	S	*	.	T	Hydrogen-bonded Turn	trans	50.5	39.9	179.9	-54.2	-174.4	-174.3	174.9	0	113	R37 Y70	K35-R37 VanDerWaalsContact C-N 3.31Å; K35-R37 PolarHBondContact O-N 2.93Å; K35-Y70 HydrophobicContact CB-CD1 4.47Å; K35-Y70 HydrophobicContact CD-CD1 4.15Å
36	G	91.3	Very high	94.6	Very high	55 Å²	55	57 Å²	57	57%	0.567	29%	0.293	S	S	*	.	T	Hydrogen-bonded Turn	trans	77.5	6.8	-179.9	0	0	0	0	0	115.4	L34	L34-G36 PolarHBondContact O-N 3.43Å; L34-G36 VanDerWaalsContact O-N 3.16Å
37	R	94.6	Very high	94.4	Very high	67 Å²	67	59.8 Å²	59.8	25%	0.253	31%	0.312	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.3	135.6	-179.2	-61.1	-67.1	-62.7	-163.7	12.6	111.4	V33 L34 K35 C39 D63 N66 Y70 E144	V33-R37 WeakPolarHBondContact CA-O 3.46Å; L34-R37 PolarHBondContact N-O 3.35Å; L34-R37 PolarHBondContact O-N 3.31Å; K35-R37 VanDerWaalsContact C-N 3.31Å; K35-R37 PolarHBondContact O-N 2.93Å; R37-C39 PolarHBondContact O-N 3.4Å; R37-C39 PolarHBondContact O-SG 2.92Å; R37-D63 IonicContact CZ-OD2 3.57Å; R37-D63 IonicContact NE-OD2 3.68Å; R37-D63 PolarHBondContact NE-OD2 3.38Å; R37-D63 IonicContact NH2-OD1 3.24Å; R37-D63 PolarHBondContact NH2-OD1 2.72Å; R37-D63 IonicContact NH2-OD2 3.48Å; R37-D63 PolarHBondContact NH2-OD2 2.89Å; R37-N66 VanDerWaalsContact CZ-ND2 3.34Å; R37-N66 PolarHBondContact NH2-ND2 3.05Å; R37-Y70 HydrophobicContact CB-CE2 4.25Å; R37-Y70 HydrophobicContact CG-CE2 4.23Å; R37-E144 IonicContact CZ-OE2 2.73Å; R37-E144 IonicContact NH2-OE1 2.63Å; R37-E144 IonicContact NH2-OE2 2.69Å; R37-E144 PolarHBondContact NH2-OE2 2.98Å
38	P	96	Very high	94.1	Very high	4 Å²	4	60.6 Å²	60.6	3%	0.026	32%	0.32	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.1	116.6	175.6	28.9	-32.4	0	0	0	110.2	I64 F65 P83 A141 M142	P38-I64 HydrophobicContact CB-CD1 3.91Å; P38-I64 HydrophobicContact CB-CG1 4.34Å; P38-I64 HydrophobicContact CG-CD1 4.13Å; P38-I64 HydrophobicContact CG-CG1 4.2Å; P38-I64 PolarHBondContact O-N 2.9Å; P38-F65 HydrophobicContact CG-CD2 3.94Å; P38-F65 HydrophobicContact CG-CE2 3.69Å; P38-P83 HydrophobicContact CB-CB 3.93Å; P38-P83 HydrophobicContact CB-CG 3.91Å; P38-A141 HydrophobicContact CB-CB 4.25Å; P38-A141 HydrophobicContact CG-CB 4.29Å; P38-M142 HydrophobicContact CB-CG 4.48Å; P38-M142 HydrophobicContact CB-SD 4.02Å; P38-M142 HydrophobicContact CG-SD 4.31Å
39	C	96.8	Very high	93.6	Very high	0 Å²	0	57.4 Å²	57.4	0%	0	31%	0.312	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.1	144.5	-174.6	-62.6	0	0	0	0	111.7	F31 V32 L34 R37 I62	F31-C39 CarbonylContact C-O 3.52Å; F31-C39 VanDerWaalsContact CA-O 3.29Å; F31-C39 WeakPolarHBondContact CA-O 3.16Å; V32-C39 PolarHBondContact N-O 3.4Å; V32-C39 PolarHBondContact O-N 2.77Å; L34-C39 HydrophobicContact CD1-CB 4.1Å; L34-C39 HydrophobicContact CG-CB 4.22Å; R37-C39 PolarHBondContact O-N 3.4Å; R37-C39 PolarHBondContact O-SG 2.92Å; C39-I62 CarbonylContact C-O 3.57Å; C39-I62 VanDerWaalsContact CA-O 3.31Å; C39-I62 WeakPolarHBondContact CA-O 3.34Å
40	K	96.4	Very high	93.1	Very high	84 Å²	84	55.3 Å²	55.3	37%	0.365	31%	0.314	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.7	126.3	165.6	-176.4	-178.6	178	-176.4	0	109.6	N29 G30 F31 V42 G61 I62 I64	N29-K40 WeakPolarHBondContact OD1-CE 3.37Å; G30-K40 WeakPolarHBondContact O-CA 3.42Å; F31-K40 HydrophobicContact CD1-CB 4.14Å; F31-K40 HydrophobicContact CE1-CB 4.03Å; F31-K40 HydrophobicContact CE1-CG 4.24Å; K40-V42 PolarHBondContact O-N 2.94Å; K40-G61 CarbonylContact O-C 3.58Å; K40-G61 WeakPolarHBondContact O-CA 3.46Å; K40-I62 PolarHBondContact N-O 3.22Å; K40-I62 PolarHBondContact O-N 3.45Å; K40-I64 HydrophobicContact CB-CG2 4.06Å
41	I	96.4	Very high	92.4	Very high	0 Å²	0	63.5 Å²	63.5	0%	0	34%	0.342	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-71	113.3	-179.8	-57.1	170.2	0	0	0	109.5	L26 N29 G30 V32 E43 M44 M59	L26-I41 HydrophobicContact CB-CD1 4.02Å; L26-I41 HydrophobicContact CD1-CD1 4.39Å; L26-I41 HydrophobicContact CD2-CD1 4.49Å; N29-I41 WeakPolarHBondContact CA-O 3.29Å; N29-I41 PolarHBondContact N-O 2.79Å; G30-I41 PolarHBondContact O-N 3.21Å; V32-I41 HydrophobicContact CB-CD1 4.12Å; V32-I41 HydrophobicContact CB-CG1 4.29Å; V32-I41 HydrophobicContact CG1-CD1 3.8Å; V32-I41 HydrophobicContact CG1-CG1 3.51Å; I41-E43 WeakPolarHBondContact CG2-O 3.48Å; I41-M44 HydrophobicContact CG2-CB 4.18Å; I41-M59 HydrophobicContact CD1-SD 4.46Å
42	V	97.1	Very high	91.9	Very high	51 Å²	51	69.1 Å²	69.1	31%	0.309	37%	0.369	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.7	-28.3	177.1	-65.8	0	0	0	0	112.5	K28 K40 V60 I62	K28-V42 WeakPolarHBondContact CE-O 3.18Å; K40-V42 PolarHBondContact O-N 2.94Å; V42-V60 HydrophobicContact CG2-CB 4.28Å; V42-V60 HydrophobicContact CG2-CG1 3.84Å; V42-V60 VanDerWaalsContact CG2-O 3.3Å; V42-V60 WeakPolarHBondContact CG2-O 3.49Å; V42-V60 PolarHBondContact N-O 3.01Å; V42-I62 HydrophobicContact CG1-CB 4.34Å; V42-I62 HydrophobicContact CG1-CD1 3.71Å; V42-I62 HydrophobicContact CG1-CG1 3.79Å; V42-I62 HydrophobicContact CG2-CD1 4.27Å; V42-I62 HydrophobicContact CG2-CG1 3.97Å
43	E	94.9	Very high	91.1	Very high	99 Å²	99	70.4 Å²	70.4	46%	0.463	38%	0.383	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.1	142.5	177.3	-154	-176.4	123.5	0	0	110.5	I41 V60	I41-E43 WeakPolarHBondContact CG2-O 3.48Å; E43-V60 HydrophobicContact CB-CB 3.79Å; E43-V60 HydrophobicContact CB-CG2 4.08Å; E43-V60 PolarHBondContact N-O 3.5Å; E43-V60 VanDerWaalsContact N-O 3.14Å; E43-V60 PolarHBondContact O-N 2.97Å
44	M	93.9	Very high	90.5	Very high	52 Å²	52	76 Å²	76	26%	0.256	41%	0.407	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-147.8	124.6	177.1	-174.5	179.9	-168.6	0	0	108.2	C23 L26 I41 V57 H58 M59	C23-M44 VanDerWaalsContact O-CE 3.3Å; C23-M44 WeakPolarHBondContact O-CE 3.43Å; L26-M44 HydrophobicContact CB-CE 3.92Å; L26-M44 HydrophobicContact CB-SD 4.47Å; L26-M44 WeakPolarHBondContact O-CE 3.41Å; I41-M44 HydrophobicContact CG2-CB 4.18Å; M44-V57 HydrophobicContact CE-CG1 3.45Å; M44-V57 VanDerWaalsContact CE-CG1 3.45Å; M44-V57 HydrophobicContact CE-CG2 4.48Å; M44-V57 HydrophobicContact CG-CG1 3.68Å; M44-V57 HydrophobicContact SD-CG1 4.43Å; M44-H58 WeakPolarHBondContact CA-O 3.34Å; M44-M59 HydrophobicContact CE-SD 4.35Å; M44-M59 HydrophobicContact CG-CG 4.09Å
45	S	92.9	Very high	90.3	Very high	52 Å²	52	77 Å²	77	36%	0.364	42%	0.416	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.8	140.6	179	61.9	0	0	0	0	110.1	V57 H58	S45-V57 CarbonylContact O-C 3.52Å; S45-V57 WeakPolarHBondContact O-CA 3.44Å; S45-H58 PolarHBondContact N-O 3.26Å; S45-H58 PolarHBondContact O-N 2.95Å
46	T	91.1	Very high	90.3	Very high	94 Å²	94	74.2 Å²	74.2	58%	0.577	40%	0.404	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-114.2	126.7	-179.4	-55.5	0	0	0	0	109.4	A55 K56 V57	T46-A55 HydrophobicContact CG2-CB 3.81Å; T46-K56 CarbonylContact C-O 3.57Å; T46-K56 WeakPolarHBondContact CA-O 3.4Å; T46-V57 HydrophobicContact CG2-CG2 4.44Å
47	S	90.1	Very high	90.4	Very high	63 Å²	63	71.7 Å²	71.7	44%	0.441	38%	0.377	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.9	144.7	177.9	62.1	0	0	0	0	110.3	A55 K56	S47-A55 CarbonylContact O-C 3.59Å; S47-A55 VanDerWaalsContact O-CA 3.3Å; S47-A55 WeakPolarHBondContact O-CA 3.43Å; S47-K56 PolarHBondContact N-O 3.38Å; S47-K56 PolarHBondContact O-N 3.45Å; S47-K56 PolarHBondContact OG-O 3.46Å
48	K	87.3	Confident	90.5	Very high	175 Å²	175	71 Å²	71	76%	0.761	38%	0.377	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-99.8	131.9	170.9	-70.6	-172.6	179.4	-177.6	0	109.3	G50	K48-G50 VanDerWaalsContact C-N 3.31Å; K48-G50 PolarHBondContact O-N 2.69Å; K48-G50 VanDerWaalsContact O-N 3.11Å
49	T	82.4	Confident	90.4	Very high	69 Å²	69	70.8 Å²	70.8	42%	0.423	38%	0.375	S	S	.	.			trans	-87.2	69.3	176.8	48.4	0	0	0	0	110.8	G53 H54 K56	T49-G53 VanDerWaalsContact O-CA 3.25Å; T49-G53 WeakPolarHBondContact O-CA 3.46Å; T49-G53 PolarHBondContact O-N 3.12Å; T49-H54 PolarHBondContact OG1-O 2.8Å; T49-H54 VanDerWaalsContact OG1-O 3.05Å; T49-K56 HydrophobicContact CG2-CD 3.71Å; T49-K56 HydrophobicContact CG2-CG 4.17Å
50	G	83.5	Confident	90.4	Very high	53 Å²	53	71 Å²	71	55%	0.546	38%	0.376	S	S	.	.	S	Bend	trans	82.8	-167.3	179.9	0	0	0	0	0	114.8	K48 H52	K48-G50 VanDerWaalsContact C-N 3.31Å; K48-G50 PolarHBondContact O-N 2.69Å; K48-G50 VanDerWaalsContact O-N 3.11Å; G50-H52 PolarHBondContact O-N 3.37Å
51	K	80.8	Confident	90.4	Very high	196 Å²	196	67 Å²	67	85%	0.852	36%	0.359	S	S	*	.	S	Bend	trans	-66.7	-36.2	-170.8	-171.4	179.4	179.3	-176.6	0	114
52	H	85.8	Confident	90.4	Very high	169 Å²	169	70.1 Å²	70.1	78%	0.782	38%	0.375	S	S	*	.	S	Bend	trans	-117	2.1	-177.6	-61.7	-73.8	0	0	0	113.4	G50	G50-H52 PolarHBondContact O-N 3.37Å
53	G	78.2	Confident	90.3	Very high	28 Å²	28	67.8 Å²	67.8	29%	0.289	36%	0.361	S	S	.	.	P	Polyproline II helix	trans	-76	147.2	-176.9	0	0	0	0	0	112.9	T49	T49-G53 VanDerWaalsContact O-CA 3.25Å; T49-G53 WeakPolarHBondContact O-CA 3.46Å; T49-G53 PolarHBondContact O-N 3.12Å
54	H	84.2	Confident	90.2	Very high	135 Å²	135	64.8 Å²	64.8	63%	0.625	35%	0.348	S	S	*	.	P	Polyproline II helix	trans	-62.2	147.8	171.6	-65.2	-86	0	0	0	110.4	T49	T49-H54 PolarHBondContact OG1-O 2.8Å; T49-H54 VanDerWaalsContact OG1-O 3.05Å
55	A	90.7	Very high	90.1	Very high	22 Å²	22	64.2 Å²	64.2	18%	0.182	34%	0.344	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.2	135.9	173.4	0	0	0	0	0	109.5	T46 S47 S76	T46-A55 HydrophobicContact CG2-CB 3.81Å; S47-A55 CarbonylContact O-C 3.59Å; S47-A55 VanDerWaalsContact O-CA 3.3Å; S47-A55 WeakPolarHBondContact O-CA 3.43Å; A55-S76 WeakPolarHBondContact O-CB 3.43Å; A55-S76 PolarHBondContact O-N 2.83Å; A55-S76 PolarHBondContact O-OG 2.78Å
56	K	91.9	Very high	89.9	Confident	91 Å²	91	64.7 Å²	64.7	40%	0.396	34%	0.342	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.8	132.3	172.1	-65	-175.1	178.4	-178.6	0	108.1	T46 S47 T49 I73	T46-K56 CarbonylContact C-O 3.57Å; T46-K56 WeakPolarHBondContact CA-O 3.4Å; S47-K56 PolarHBondContact N-O 3.38Å; S47-K56 PolarHBondContact O-N 3.45Å; S47-K56 PolarHBondContact OG-O 3.46Å; T49-K56 HydrophobicContact CG2-CD 3.71Å; T49-K56 HydrophobicContact CG2-CG 4.17Å; K56-I73 HydrophobicContact CB-CG2 4.11Å; K56-I73 HydrophobicContact CD-CG2 4.42Å
57	V	94.2	Very high	89.9	Confident	2 Å²	2	62.7 Å²	62.7	1%	0.012	34%	0.341	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.2	122.3	175.9	-172.9	0	0	0	0	107.6	C23 M44 S45 T46 M59 I73 C74	C23-V57 VanDerWaalsContact SG-CB 3.55Å; M44-V57 HydrophobicContact CE-CG1 3.45Å; M44-V57 VanDerWaalsContact CE-CG1 3.45Å; M44-V57 HydrophobicContact CE-CG2 4.48Å; M44-V57 HydrophobicContact CG-CG1 3.68Å; M44-V57 HydrophobicContact SD-CG1 4.43Å; S45-V57 CarbonylContact O-C 3.52Å; S45-V57 WeakPolarHBondContact O-CA 3.44Å; T46-V57 HydrophobicContact CG2-CG2 4.44Å; V57-M59 HydrophobicContact CG1-CG 3.62Å; V57-M59 HydrophobicContact CG1-SD 4.22Å; V57-I73 CarbonylContact O-C 3.58Å; V57-I73 VanDerWaalsContact O-CA 3.31Å; V57-I73 WeakPolarHBondContact O-CA 3.41Å; V57-C74 PolarHBondContact N-O 2.83Å; V57-C74 PolarHBondContact O-N 2.88Å
58	H	94.8	Very high	90.1	Very high	52 Å²	52	65.9 Å²	65.9	24%	0.241	35%	0.346	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.3	122.1	166.3	172.1	-118.9	0	0	0	108.3	M44 S45 I73	M44-H58 WeakPolarHBondContact CA-O 3.34Å; S45-H58 PolarHBondContact N-O 3.26Å; S45-H58 PolarHBondContact O-N 2.95Å; H58-I73 HydrophobicContact CB-CG1 4.08Å
59	M	94.8	Very high	90.5	Very high	0 Å²	0	64 Å²	64	0%	0	34%	0.339	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.7	141.6	-178.7	-63.6	-177.2	-60.2	0	0	110.1	L26 L34 I41 M44 V57 E71 D72 C74 M80	L26-M59 HydrophobicContact CB-SD 4.43Å; L26-M59 HydrophobicContact CD1-CE 3.96Å; L26-M59 HydrophobicContact CD1-SD 3.53Å; L26-M59 VanDerWaalsContact CD1-SD 3.53Å; L34-M59 HydrophobicContact CD2-CE 4.43Å; I41-M59 HydrophobicContact CD1-SD 4.46Å; M44-M59 HydrophobicContact CE-SD 4.35Å; M44-M59 HydrophobicContact CG-CG 4.09Å; V57-M59 HydrophobicContact CG1-CG 3.62Å; V57-M59 HydrophobicContact CG1-SD 4.22Å; M59-E71 VanDerWaalsContact O-CA 3.31Å; M59-E71 WeakPolarHBondContact O-CA 3.46Å; M59-D72 PolarHBondContact N-O 2.96Å; M59-D72 PolarHBondContact O-N 3.12Å; M59-C74 WeakPolarHBondContact CE-SG 3.43Å; M59-M80 HydrophobicContact CE-CE 3.98Å; M59-M80 HydrophobicContact CE-CG 4.45Å
60	V	96.6	Very high	91.2	Very high	3 Å²	3	63 Å²	63	2%	0.018	33%	0.327	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.7	121.5	173.8	-179.1	0	0	0	0	107.5	V42 E43 K69 Y70 E71	V42-V60 HydrophobicContact CG2-CB 4.28Å; V42-V60 HydrophobicContact CG2-CG1 3.84Å; V42-V60 VanDerWaalsContact CG2-O 3.3Å; V42-V60 WeakPolarHBondContact CG2-O 3.49Å; V42-V60 PolarHBondContact N-O 3.01Å; E43-V60 HydrophobicContact CB-CB 3.79Å; E43-V60 HydrophobicContact CB-CG2 4.08Å; E43-V60 PolarHBondContact N-O 3.5Å; E43-V60 VanDerWaalsContact N-O 3.14Å; E43-V60 PolarHBondContact O-N 2.97Å; V60-K69 HydrophobicContact CG1-CD 4.06Å; V60-K69 HydrophobicContact CG1-CG 3.83Å; V60-Y70 WeakPolarHBondContact CA-O 3.41Å; V60-E71 HydrophobicContact CG2-CB 4.3Å
61	G	97.1	Very high	91.8	Very high	0 Å²	0	65.6 Å²	65.6	0%	0	33%	0.325	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.1	154.2	176.7	0	0	0	0	0	112.1	K40 K69 Y70	K40-G61 CarbonylContact O-C 3.58Å; K40-G61 WeakPolarHBondContact O-CA 3.46Å; G61-K69 WeakPolarHBondContact O-CA 3.42Å; G61-Y70 PolarHBondContact N-O 3.38Å; G61-Y70 PolarHBondContact O-N 3.05Å; G61-Y70 VanDerWaalsContact O-O 3.08Å
62	I	96.6	Very high	92.4	Very high	67 Å²	67	59.2 Å²	59.2	34%	0.344	30%	0.3	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.2	127.5	166.6	-61.3	-178.5	0	0	0	107.1	C39 K40 V42 I64 G67	C39-I62 CarbonylContact C-O 3.57Å; C39-I62 VanDerWaalsContact CA-O 3.31Å; C39-I62 WeakPolarHBondContact CA-O 3.34Å; K40-I62 PolarHBondContact N-O 3.22Å; K40-I62 PolarHBondContact O-N 3.45Å; V42-I62 HydrophobicContact CG1-CB 4.34Å; V42-I62 HydrophobicContact CG1-CD1 3.71Å; V42-I62 HydrophobicContact CG1-CG1 3.79Å; V42-I62 HydrophobicContact CG2-CD1 4.27Å; V42-I62 HydrophobicContact CG2-CG1 3.97Å; I62-I64 PolarHBondContact O-N 3.44Å; I62-G67 WeakPolarHBondContact CG2-O 3.34Å
63	D	95.4	Very high	92.7	Very high	2 Å²	2	55.9 Å²	55.9	1%	0.011	29%	0.287	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-59.8	130.5	174.5	-178.9	-49.2	0	0	0	110.4	R37 F65 N66 G67 K68 Y70	R37-D63 IonicContact CZ-OD2 3.57Å; R37-D63 IonicContact NE-OD2 3.68Å; R37-D63 PolarHBondContact NE-OD2 3.38Å; R37-D63 IonicContact NH2-OD1 3.24Å; R37-D63 PolarHBondContact NH2-OD1 2.72Å; R37-D63 IonicContact NH2-OD2 3.48Å; R37-D63 PolarHBondContact NH2-OD2 2.89Å; D63-F65 PolarHBondContact O-N 2.96Å; D63-F65 WeakPolarHBondContact OD1-CA 3.45Å; D63-F65 PolarHBondContact OD1-N 2.73Å; D63-N66 WeakPolarHBondContact CB-OD1 3.39Å; D63-N66 VanDerWaalsContact CG-ND2 3.31Å; D63-N66 PolarHBondContact OD1-N 3.45Å; D63-N66 PolarHBondContact OD2-ND2 3.48Å; D63-N66 PolarHBondContact OD2-OD1 2.67Å; D63-G67 WeakPolarHBondContact O-CA 3.25Å; D63-G67 PolarHBondContact O-N 3.39Å; D63-G67 VanDerWaalsContact O-N 3.09Å; D63-K68 WeakPolarHBondContact CB-O 3.27Å; D63-K68 PolarHBondContact N-O 2.92Å; D63-Y70 HydrophobicContact CB-CD2 4.01Å; D63-Y70 HydrophobicContact CB-CE2 3.69Å
64	I	92.6	Very high	93.4	Very high	36 Å²	36	54.9 Å²	54.9	19%	0.185	28%	0.276	C	S	.	.	T	Hydrogen-bonded Turn	trans	-75.1	-13.1	-171.3	66.2	-174.1	0	0	0	113.5	F31 P38 K40 I62 I85 L139 A141	F31-I64 HydrophobicContact CD1-CG2 4.21Å; F31-I64 HydrophobicContact CE1-CG2 4.05Å; P38-I64 HydrophobicContact CB-CD1 3.91Å; P38-I64 HydrophobicContact CB-CG1 4.34Å; P38-I64 HydrophobicContact CG-CD1 4.13Å; P38-I64 HydrophobicContact CG-CG1 4.2Å; P38-I64 PolarHBondContact O-N 2.9Å; K40-I64 HydrophobicContact CB-CG2 4.06Å; I62-I64 PolarHBondContact O-N 3.44Å; I64-I85 HydrophobicContact CD1-CD1 3.62Å; I64-L139 HydrophobicContact CD1-CD1 4.47Å; I64-L139 HydrophobicContact CD1-CD2 3.47Å; I64-L139 VanDerWaalsContact CD1-CD2 3.47Å; I64-L139 HydrophobicContact CG1-CD2 4.19Å; I64-A141 HydrophobicContact CD1-CB 3.86Å
65	F	90.9	Very high	93.8	Very high	40 Å²	40	50.3 Å²	50.3	18%	0.175	26%	0.258	C	S	.	.	T	Hydrogen-bonded Turn	trans	-106.4	-48.2	-178.9	-63.2	-64.1	0	0	0	112.4	P38 D63 L139 A141 E144 A146	P38-F65 HydrophobicContact CG-CD2 3.94Å; P38-F65 HydrophobicContact CG-CE2 3.69Å; D63-F65 PolarHBondContact O-N 2.96Å; D63-F65 WeakPolarHBondContact OD1-CA 3.45Å; D63-F65 PolarHBondContact OD1-N 2.73Å; F65-L139 HydrophobicContact CE1-CD2 3.81Å; F65-L139 HydrophobicContact CZ-CD2 3.68Å; F65-A141 HydrophobicContact CE2-CB 3.96Å; F65-A141 HydrophobicContact CZ-CB 3.89Å; F65-E144 WeakPolarHBondContact CB-OE1 3.3Å; F65-E144 HydrophobicContact CD1-CG 4.08Å; F65-E144 HydrophobicContact CD2-CB 4.07Å; F65-E144 HydrophobicContact CD2-CG 3.7Å; F65-E144 VanDerWaalsContact CD2-OE2 3.25Å; F65-E144 WeakPolarHBondContact CD2-OE2 3.47Å; F65-E144 HydrophobicContact CE1-CG 4.1Å; F65-E144 HydrophobicContact CE2-CB 3.62Å; F65-E144 HydrophobicContact CE2-CG 3.71Å; F65-E144 VanDerWaalsContact CG-CD 3.49Å; F65-E144 HydrophobicContact CG-CG 3.88Å; F65-E144 WeakPolarHBondContact CG-OE1 3.42Å; F65-E144 HydrophobicContact CZ-CB 3.87Å; F65-E144 HydrophobicContact CZ-CG 3.92Å; F65-E144 VanDerWaalsContact CZ-O 3.23Å; F65-E144 WeakPolarHBondContact CZ-O 3.41Å; F65-A146 HydrophobicContact CD1-CB 3.59Å; F65-A146 HydrophobicContact CE1-CB 3.83Å
66	N	89.4	Confident	93.8	Very high	61 Å²	61	50.3 Å²	50.3	33%	0.326	26%	0.257	S	S	.	.	T	Hydrogen-bonded Turn	trans	-102.8	-4.4	-174.8	67.2	39	0	0	0	114.3	R37 D63 K68	R37-N66 VanDerWaalsContact CZ-ND2 3.34Å; R37-N66 PolarHBondContact NH2-ND2 3.05Å; D63-N66 WeakPolarHBondContact CB-OD1 3.39Å; D63-N66 VanDerWaalsContact CG-ND2 3.31Å; D63-N66 PolarHBondContact OD1-N 3.45Å; D63-N66 PolarHBondContact OD2-ND2 3.48Å; D63-N66 PolarHBondContact OD2-OD1 2.67Å; N66-K68 PolarHBondContact O-N 2.97Å; N66-K68 VanDerWaalsContact O-N 3.11Å; N66-K68 WeakPolarHBondContact OD1-CA 3.5Å; N66-K68 WeakPolarHBondContact OD1-CB 3.47Å; N66-K68 VanDerWaalsContact OD1-CG 3.26Å; N66-K68 WeakPolarHBondContact OD1-CG 3.23Å; N66-K68 PolarHBondContact OD1-N 3.47Å
67	G	90	Very high	93.8	Very high	53 Å²	53	49.5 Å²	49.5	55%	0.546	26%	0.26	S	S	.	.			trans	68.1	6.2	179	0	0	0	0	0	115.3	I62 D63	I62-G67 WeakPolarHBondContact CG2-O 3.34Å; D63-G67 WeakPolarHBondContact O-CA 3.25Å; D63-G67 PolarHBondContact O-N 3.39Å; D63-G67 VanDerWaalsContact O-N 3.09Å
68	K	94.6	Very high	93.8	Very high	129 Å²	129	54.5 Å²	54.5	56%	0.561	28%	0.282	S	S	*	.			trans	-73	142.7	177.7	-64.9	176.7	-180	175.8	0	110.5	D63 N66 Y70	D63-K68 WeakPolarHBondContact CB-O 3.27Å; D63-K68 PolarHBondContact N-O 2.92Å; N66-K68 PolarHBondContact O-N 2.97Å; N66-K68 VanDerWaalsContact O-N 3.11Å; N66-K68 WeakPolarHBondContact OD1-CA 3.5Å; N66-K68 WeakPolarHBondContact OD1-CB 3.47Å; N66-K68 VanDerWaalsContact OD1-CG 3.26Å; N66-K68 WeakPolarHBondContact OD1-CG 3.23Å; N66-K68 PolarHBondContact OD1-N 3.47Å; K68-Y70 HydrophobicContact CB-CE2 3.84Å; K68-Y70 WeakPolarHBondContact O-CD2 3.43Å
69	K	96.6	Very high	93.7	Very high	137 Å²	137	57.3 Å²	57.3	60%	0.596	30%	0.299	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-83.9	131.3	177.8	-168.5	-177.8	-178.2	-173.4	0	110.1	V60 G61	V60-K69 HydrophobicContact CG1-CD 4.06Å; V60-K69 HydrophobicContact CG1-CG 3.83Å; G61-K69 WeakPolarHBondContact O-CA 3.42Å
70	Y	96.7	Very high	93.6	Very high	48 Å²	48	58.5 Å²	58.5	19%	0.188	31%	0.305	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.3	143.2	174	-65.8	-81.7	0	0	0	109.7	K35 R37 V60 G61 D63 K68	K35-Y70 HydrophobicContact CB-CD1 4.47Å; K35-Y70 HydrophobicContact CD-CD1 4.15Å; R37-Y70 HydrophobicContact CB-CE2 4.25Å; R37-Y70 HydrophobicContact CG-CE2 4.23Å; V60-Y70 WeakPolarHBondContact CA-O 3.41Å; G61-Y70 PolarHBondContact N-O 3.38Å; G61-Y70 PolarHBondContact O-N 3.05Å; G61-Y70 VanDerWaalsContact O-O 3.08Å; D63-Y70 HydrophobicContact CB-CD2 4.01Å; D63-Y70 HydrophobicContact CB-CE2 3.69Å; K68-Y70 HydrophobicContact CB-CE2 3.84Å; K68-Y70 WeakPolarHBondContact O-CD2 3.43Å
71	E	95.1	Very high	93.6	Very high	106 Å²	106	62.2 Å²	62.2	50%	0.495	33%	0.325	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.6	147.8	177.9	64.1	-172.8	-150.6	0	0	110.5	M59 V60	M59-E71 VanDerWaalsContact O-CA 3.31Å; M59-E71 WeakPolarHBondContact O-CA 3.46Å; V60-E71 HydrophobicContact CG2-CB 4.3Å
72	D	94.2	Very high	93.5	Very high	63 Å²	63	62.7 Å²	62.7	34%	0.337	33%	0.328	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-153.5	158	177.5	-162.3	14.1	0	0	0	111.7	L34 M59	L34-D72 HydrophobicContact CD2-CB 3.94Å; M59-D72 PolarHBondContact N-O 2.96Å; M59-D72 PolarHBondContact O-N 3.12Å
73	I	93.2	Very high	93.4	Very high	99 Å²	99	59.7 Å²	59.7	51%	0.508	31%	0.313	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.9	108.7	177.4	-58.4	174.9	0	0	0	109.4	K56 V57 H58	K56-I73 HydrophobicContact CB-CG2 4.11Å; K56-I73 HydrophobicContact CD-CG2 4.42Å; V57-I73 CarbonylContact O-C 3.58Å; V57-I73 VanDerWaalsContact O-CA 3.31Å; V57-I73 WeakPolarHBondContact O-CA 3.41Å; H58-I73 HydrophobicContact CB-CG1 4.08Å
74	C	91.3	Very high	93.3	Very high	6 Å²	6	62.6 Å²	62.6	4%	0.041	33%	0.328	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108	143.3	174.3	48.5	0	0	0	0	112.5	C23 V57 M59 S76 M80	C23-C74 HydrophobicContact CB-CB 4.18Å; C23-C74 WeakPolarHBondContact CB-SG 3.48Å; C23-C74 WeakPolarHBondContact SG-CB 3.36Å; C23-C74 CovalentContact SG-SG 2.08Å; C23-C74 PolarHBondContact SG-SG 2.84Å; V57-C74 PolarHBondContact N-O 2.83Å; V57-C74 PolarHBondContact O-N 2.88Å; M59-C74 WeakPolarHBondContact CE-SG 3.43Å; C74-S76 PolarHBondContact O-N 2.89Å; C74-M80 HydrophobicContact CB-CE 4.49Å; C74-M80 HydrophobicContact CB-CG 4.43Å; C74-M80 HydrophobicContact CB-SD 3.71Å; C74-M80 VanDerWaalsContact SG-SD 3.68Å
75	P	93.7	Very high	93.2	Very high	40 Å²	40	62.9 Å²	62.9	26%	0.26	33%	0.33	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-53.9	137.7	159.1	-25.6	36.7	0	0	0	110.6	T77 H78	P75-T77 PolarHBondContact O-N 3.48Å; P75-H78 WeakPolarHBondContact CD-ND1 3.43Å; P75-H78 WeakPolarHBondContact CG-ND1 3.26Å; P75-H78 PolarHBondContact O-N 3.44Å
76	S	91.3	Very high	93.2	Very high	22 Å²	22	67.2 Å²	67.2	15%	0.154	35%	0.348	C	S	.	.	T	Hydrogen-bonded Turn	trans	-59.6	-25.5	-174.2	66	0	0	0	0	113.6	Q22 S24 A55 C74	Q22-S76 WeakPolarHBondContact CG-O 3.21Å; S24-S76 WeakPolarHBondContact CB-O 3.28Å; S24-S76 PolarHBondContact N-O 2.86Å; S24-S76 PolarHBondContact OG-O 2.75Å; A55-S76 WeakPolarHBondContact O-CB 3.43Å; A55-S76 PolarHBondContact O-N 2.83Å; A55-S76 PolarHBondContact O-OG 2.78Å; C74-S76 PolarHBondContact O-N 2.89Å
77	T	91.3	Very high	93.3	Very high	74 Å²	74	71.7 Å²	71.7	45%	0.454	36%	0.361	S	S	.	.	T	Hydrogen-bonded Turn	trans	-88.5	-12.6	-178.8	52.9	0	0	0	0	114.1	P75	P75-T77 PolarHBondContact O-N 3.48Å
78	H	92.8	Very high	93.4	Very high	106 Å²	106	73.5 Å²	73.5	49%	0.491	36%	0.357	S	S	.	.	S	Bend	trans	-71	147.3	177.4	-75.4	-178	0	0	0	111.1	C23 P75	C23-H78 VanDerWaalsContact CB-O 3.25Å; C23-H78 WeakPolarHBondContact CB-O 3.49Å; C23-H78 PolarHBondContact N-O 3Å; P75-H78 WeakPolarHBondContact CD-ND1 3.43Å; P75-H78 WeakPolarHBondContact CG-ND1 3.26Å; P75-H78 PolarHBondContact O-N 3.44Å
79	N	92.9	Very high	93.3	Very high	112 Å²	112	70.3 Å²	70.3	60%	0.599	35%	0.346	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-80.6	138.6	168.8	-70.2	-31.3	0	0	0	109.4	P20 Q21 Q22	P20-N79 HydrophobicContact CB-CB 4.31Å; Q21-N79 WeakPolarHBondContact O-CA 3.12Å; Q22-N79 PolarHBondContact N-OD1 3.24Å
80	M	94	Very high	93.2	Very high	25 Å²	25	64.1 Å²	64.1	12%	0.123	32%	0.319	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.1	148.4	172.7	-62	-65.2	-71.4	0	0	108.3	Q21 C23 L26 V32 L34 M59 C74	Q21-M80 PolarHBondContact N-O 2.94Å; Q21-M80 PolarHBondContact O-N 3.34Å; C23-M80 HydrophobicContact CB-CG 3.92Å; L26-M80 HydrophobicContact CD1-CB 4.18Å; L26-M80 HydrophobicContact CD1-CG 4.26Å; V32-M80 HydrophobicContact CG2-CB 3.95Å; V32-M80 HydrophobicContact CG2-CE 4.34Å; L34-M80 HydrophobicContact CD2-CE 4.41Å; M59-M80 HydrophobicContact CE-CE 3.98Å; M59-M80 HydrophobicContact CE-CG 4.45Å; C74-M80 HydrophobicContact CB-CE 4.49Å; C74-M80 HydrophobicContact CB-CG 4.43Å; C74-M80 HydrophobicContact CB-SD 3.71Å; C74-M80 VanDerWaalsContact SG-SD 3.68Å
81	D	95.1	Very high	93	Very high	81 Å²	81	64.4 Å²	64.4	43%	0.433	32%	0.323	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.7	132.1	172.4	-72.2	-64.6	0	0	0	110.6	T18 V32 V33	T18-D81 HydrophobicContact CG2-CB 4.24Å; T18-D81 PolarHBondContact OG1-OD1 2.9Å; V32-D81 WeakPolarHBondContact CG2-O 3.34Å; V33-D81 HydrophobicContact CB-CB 3.92Å; V33-D81 HydrophobicContact CG2-CB 3.82Å; V33-D81 PolarHBondContact N-O 2.87Å
82	V	95.3	Very high	92.9	Very high	9 Å²	9	59.9 Å²	59.9	6%	0.055	30%	0.302	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112	125.4	172.2	179.2	0	0	0	0	108.1	T18 F19 Q21 L26 F31	T18-V82 CarbonylContact C-O 3.55Å; T18-V82 WeakPolarHBondContact CA-O 3.49Å; T18-V82 WeakPolarHBondContact CB-O 3.17Å; F19-V82 HydrophobicContact CD1-CB 4.26Å; F19-V82 HydrophobicContact CD1-CG1 4.43Å; F19-V82 WeakPolarHBondContact CD1-O 3.36Å; F19-V82 HydrophobicContact CD2-CB 4.14Å; F19-V82 HydrophobicContact CE1-CB 3.85Å; F19-V82 HydrophobicContact CE1-CG1 3.57Å; F19-V82 HydrophobicContact CE2-CB 3.72Å; F19-V82 HydrophobicContact CE2-CG1 3.9Å; F19-V82 HydrophobicContact CE2-CG2 4.24Å; F19-V82 HydrophobicContact CG-CB 4.41Å; F19-V82 HydrophobicContact CZ-CB 3.57Å; F19-V82 HydrophobicContact CZ-CG1 3.27Å; F19-V82 HydrophobicContact CZ-CG2 4.43Å; F19-V82 PolarHBondContact N-O 2.85Å; F19-V82 PolarHBondContact O-N 2.73Å; Q21-V82 HydrophobicContact CB-CG2 3.62Å; L26-V82 HydrophobicContact CD2-CG2 3.71Å; F31-V82 WeakPolarHBondContact O-CG1 3.2Å
83	P	95.1	Very high	92.9	Very high	4 Å²	4	60.4 Å²	60.4	3%	0.026	30%	0.304	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.4	141.1	-179.8	30.7	-34.9	0	0	0	110.7	F31 V33 P38 I85 M142	F31-P83 HydrophobicContact CB-CG 3.9Å; V33-P83 HydrophobicContact CG2-CB 4.21Å; V33-P83 HydrophobicContact CG2-CG 4.35Å; P38-P83 HydrophobicContact CB-CB 3.93Å; P38-P83 HydrophobicContact CB-CG 3.91Å; P83-I85 HydrophobicContact CB-CD1 3.93Å; P83-I85 HydrophobicContact CG-CD1 3.8Å; P83-I85 HydrophobicContact CG-CG1 4.35Å; P83-I85 PolarHBondContact O-N 3.02Å; P83-M142 HydrophobicContact CB-CG 3.89Å; P83-M142 HydrophobicContact CB-SD 4.05Å
84	N	92.8	Very high	92.8	Very high	63 Å²	63	56.1 Å²	56.1	34%	0.337	28%	0.284	S	S	.	.			trans	-75.4	107.9	166.7	-80.2	-46	0	0	0	108.9	S16 A17 F19	S16-N84 PolarHBondContact O-ND2 2.89Å; A17-N84 PolarHBondContact O-N 2.94Å; F19-N84 VanDerWaalsContact CD1-OD1 3.3Å; F19-N84 WeakPolarHBondContact CD1-OD1 3.38Å; F19-N84 WeakPolarHBondContact CE1-OD1 3.49Å
85	I	91.4	Very high	92.8	Very high	43 Å²	43	58 Å²	58	22%	0.221	29%	0.293	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95	121.1	178.5	-52.4	-58.4	0	0	0	109	F31 I64 P83 R87 L139 A141	F31-I85 HydrophobicContact CB-CG1 4.37Å; F31-I85 HydrophobicContact CD1-CD1 4.41Å; F31-I85 HydrophobicContact CD1-CG1 4.08Å; F31-I85 HydrophobicContact CD2-CG1 3.93Å; F31-I85 HydrophobicContact CE1-CG1 4.36Å; F31-I85 HydrophobicContact CE2-CG1 4.23Å; F31-I85 HydrophobicContact CG-CG1 3.86Å; F31-I85 HydrophobicContact CZ-CG1 4.43Å; I64-I85 HydrophobicContact CD1-CD1 3.62Å; P83-I85 HydrophobicContact CB-CD1 3.93Å; P83-I85 HydrophobicContact CG-CD1 3.8Å; P83-I85 HydrophobicContact CG-CG1 4.35Å; P83-I85 PolarHBondContact O-N 3.02Å; I85-R87 HydrophobicContact CG2-CG 4.43Å; I85-L139 HydrophobicContact CG2-CD1 3.9Å; I85-L139 HydrophobicContact CG2-CD2 4.09Å; I85-L139 HydrophobicContact CG2-CG 3.84Å; I85-A141 HydrophobicContact CD1-CB 3.35Å
86	K	90.9	Very high	92.7	Very high	130 Å²	130	59.7 Å²	59.7	57%	0.565	30%	0.303	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-108.6	138.4	169.9	-64.4	178.5	-177.3	175.7	0	108.9	L139 S140	K86-L139 WeakPolarHBondContact O-CA 3.17Å; K86-S140 PolarHBondContact N-O 3.03Å; K86-S140 PolarHBondContact O-N 3.04Å
87	R	91.9	Very high	92.5	Very high	155 Å²	155	66 Å²	66	59%	0.585	34%	0.335	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-127.1	125.4	172.7	-68.8	-179.5	-177.6	173.6	-4.6	108.1	I85 T137 V138 L139	I85-R87 HydrophobicContact CG2-CG 4.43Å; R87-T137 HydrophobicContact CB-CG2 4.21Å; R87-V138 WeakPolarHBondContact CA-O 3.33Å; R87-L139 HydrophobicContact CG-CB 4.4Å; R87-L139 HydrophobicContact CG-CD1 4.24Å; R87-L139 HydrophobicContact CG-CG 4.2Å
88	L	91.5	Very high	92.3	Very high	91 Å²	91	63.8 Å²	63.8	48%	0.476	33%	0.326	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.1	136.8	179.6	-67.8	172.7	0	0	0	107.8	Y90 T137 V138	L88-Y90 HydrophobicContact CB-CD2 4.3Å; L88-Y90 HydrophobicContact CB-CE2 3.44Å; L88-Y90 VanDerWaalsContact CB-CE2 3.44Å; L88-Y90 WeakPolarHBondContact CD1-OH 3.29Å; L88-Y90 WeakPolarHBondContact O-CD2 3.39Å; L88-Y90 WeakPolarHBondContact O-CE2 3.41Å; L88-T137 CarbonylContact O-C 3.49Å; L88-T137 WeakPolarHBondContact O-CA 3.44Å; L88-V138 PolarHBondContact N-O 2.87Å; L88-V138 PolarHBondContact O-N 3.36Å
89	D	92.8	Very high	92.2	Very high	62 Å²	62	64.1 Å²	64.1	33%	0.332	32%	0.324	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.1	135.8	174.6	-66.8	-26.4	0	0	0	108.1	T137 K151	D89-T137 VanDerWaalsContact OD1-CB 3.29Å; D89-T137 WeakPolarHBondContact OD1-CB 3.49Å; D89-T137 WeakPolarHBondContact OD1-CG2 3.43Å; D89-T137 PolarHBondContact OD1-OG1 2.86Å; D89-K151 IonicContact OD1-NZ 3.27Å; D89-K151 PolarHBondContact OD1-NZ 2.79Å; D89-K151 IonicContact OD2-NZ 2.86Å; D89-K151 PolarHBondContact OD2-NZ 2.79Å
90	Y	93.5	Very high	92.1	Very high	7 Å²	7	58.8 Å²	58.8	3%	0.027	30%	0.295	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.6	142.3	179.3	-60.8	-105.1	0	0	0	109.4	L88 L102 L103 Q104 R110 L135 I136 V138	L88-Y90 HydrophobicContact CB-CD2 4.3Å; L88-Y90 HydrophobicContact CB-CE2 3.44Å; L88-Y90 VanDerWaalsContact CB-CE2 3.44Å; L88-Y90 WeakPolarHBondContact CD1-OH 3.29Å; L88-Y90 WeakPolarHBondContact O-CD2 3.39Å; L88-Y90 WeakPolarHBondContact O-CE2 3.41Å; Y90-L102 HydrophobicContact CD1-CB 4.08Å; Y90-L102 HydrophobicContact CG-CB 4.12Å; Y90-L102 HydrophobicContact CG-CD1 4.39Å; Y90-L103 CarbonylContact C-O 3.59Å; Y90-L103 WeakPolarHBondContact CA-O 3.41Å; Y90-Q104 HydrophobicContact CD1-CB 4.43Å; Y90-Q104 HydrophobicContact CD1-CG 3.34Å; Y90-Q104 HydrophobicContact CE1-CG 3.12Å; Y90-R110 PolarHBondContact OH-NH1 3.44Å; Y90-L135 CarbonylContact O-C 3.53Å; Y90-L135 WeakPolarHBondContact O-CA 3.49Å; Y90-I136 PolarHBondContact N-O 3.47Å; Y90-I136 PolarHBondContact O-N 3.14Å; Y90-V138 HydrophobicContact CD2-CB 4.06Å; Y90-V138 HydrophobicContact CD2-CG2 3.57Å; Y90-V138 HydrophobicContact CE2-CB 3.7Å; Y90-V138 HydrophobicContact CE2-CG2 3.67Å
91	Q	93.8	Very high	92.1	Very high	55 Å²	55	58 Å²	58	26%	0.257	29%	0.292	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.4	127.6	171.3	-178	177	2.4	0	0	110	I93 L102 L103 L135 M153	Q91-I93 HydrophobicContact CG-CG2 4.24Å; Q91-I93 PolarHBondContact O-N 2.85Å; Q91-L102 CarbonylContact O-C 3.59Å; Q91-L102 WeakPolarHBondContact O-CA 3.46Å; Q91-L103 HydrophobicContact CB-CB 4.29Å; Q91-L103 PolarHBondContact N-O 2.9Å; Q91-L103 PolarHBondContact O-N 3.01Å; Q91-L135 HydrophobicContact CB-CD2 4.11Å; Q91-M153 HydrophobicContact CG-CE 4.04Å
92	L	93.2	Very high	92	Very high	11 Å²	11	54.1 Å²	54.1	6%	0.058	27%	0.271	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.2	120.6	170.9	-175.7	68.8	0	0	0	109.2	G94 I95 L100 L102 I124 Y128 I134 I136	L92-G94 WeakPolarHBondContact CD1-O 3.43Å; L92-I95 HydrophobicContact CD1-CG1 4.36Å; L92-I95 HydrophobicContact CD2-CD1 4.4Å; L92-I95 HydrophobicContact CD2-CG1 4.38Å; L92-L100 HydrophobicContact CD1-CB 4.18Å; L92-L100 HydrophobicContact CD1-CD2 3.98Å; L92-L102 HydrophobicContact CB-CD2 4.47Å; L92-L102 HydrophobicContact CD1-CD2 3.81Å; L92-I124 HydrophobicContact CD2-CG2 3.63Å; L92-Y128 HydrophobicContact CD2-CD2 3.86Å; L92-Y128 HydrophobicContact CD2-CG 4.3Å; L92-Y128 HydrophobicContact CG-CD2 4.19Å; L92-I134 HydrophobicContact CB-CD1 4.41Å; L92-I134 HydrophobicContact CB-CG1 3.78Å; L92-I134 HydrophobicContact CD2-CD1 3.63Å; L92-I134 HydrophobicContact CD2-CG1 3.88Å; L92-I134 HydrophobicContact CG-CG1 4.5Å; L92-I134 PolarHBondContact N-O 3.41Å; L92-I136 HydrophobicContact CB-CG1 4.1Å
93	I	93.8	Very high	91.9	Very high	74 Å²	74	55.8 Å²	55.8	38%	0.379	28%	0.28	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.2	-19.4	177.9	59.8	164.1	0	0	0	112.7	Q91 S101 L103 V109 Y128	Q91-I93 HydrophobicContact CG-CG2 4.24Å; Q91-I93 PolarHBondContact O-N 2.85Å; I93-S101 WeakPolarHBondContact CG1-O 3.48Å; I93-S101 PolarHBondContact N-O 3.11Å; I93-L103 HydrophobicContact CD1-CB 4.29Å; I93-L103 HydrophobicContact CG1-CB 4.44Å; I93-L103 HydrophobicContact CG2-CB 3.72Å; I93-L103 HydrophobicContact CG2-CD2 4.14Å; I93-V109 HydrophobicContact CD1-CG1 3.84Å; I93-V109 HydrophobicContact CD1-CG2 3.88Å; I93-Y128 PolarHBondContact O-OH 2.9Å
94	G	91.3	Very high	91.7	Very high	8 Å²	8	58.2 Å²	58.2	8%	0.082	29%	0.291	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-167.3	162.4	-179.4	0	0	0	0	0	114	L92 S101	L92-G94 WeakPolarHBondContact CD1-O 3.43Å; G94-S101 PolarHBondContact N-O 3.36Å; G94-S101 PolarHBondContact O-N 2.82Å
95	I	91.4	Very high	91.4	Very high	47 Å²	47	63 Å²	63	24%	0.241	32%	0.316	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.6	118.3	169.9	-52.9	175.7	0	0	0	107.1	L92 Y99 L100 M115 I124 Y128	L92-I95 HydrophobicContact CD1-CG1 4.36Å; L92-I95 HydrophobicContact CD2-CD1 4.4Å; L92-I95 HydrophobicContact CD2-CG1 4.38Å; I95-Y99 CarbonylContact C-O 3.59Å; I95-Y99 WeakPolarHBondContact CA-O 3.47Å; I95-L100 HydrophobicContact CG1-CD2 4.14Å; I95-M115 HydrophobicContact CG2-SD 4.44Å; I95-I124 HydrophobicContact CD1-CG2 3.99Å; I95-Y128 HydrophobicContact CD1-CD1 4.13Å; I95-Y128 HydrophobicContact CD1-CG 4.12Å; I95-Y128 HydrophobicContact CG1-CD1 4.39Å; I95-Y128 HydrophobicContact CG1-CG 4.44Å
96	T	90.1	Very high	91.2	Very high	75 Å²	75	64.6 Å²	64.6	46%	0.46	33%	0.331	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.3	122.9	-176.3	-51.7	0	0	0	0	109.6	G98 Y99	T96-G98 PolarHBondContact O-N 3.25Å; T96-Y99 PolarHBondContact N-O 3.12Å; T96-Y99 WeakPolarHBondContact O-CA 3.42Å; T96-Y99 WeakPolarHBondContact O-CB 3.17Å; T96-Y99 PolarHBondContact O-N 2.74Å
97	D	87.6	Confident	91.1	Very high	155 Å²	155	60.9 Å²	60.9	83%	0.829	33%	0.33	S	S	*	.	T	Hydrogen-bonded Turn	trans	50.2	31.2	178.2	-62.4	-40.6	0	0	0	114.8	Y99	D97-Y99 WeakPolarHBondContact O-CD2 3.42Å
98	G	86.3	Confident	91	Very high	26 Å²	26	59.4 Å²	59.4	27%	0.268	33%	0.33	S	S	.	.	T	Hydrogen-bonded Turn	trans	81.5	10.3	-177.9	0	0	0	0	0	115.1	T96 K114 M115	T96-G98 PolarHBondContact O-N 3.25Å; G98-K114 WeakPolarHBondContact O-CG 3.44Å; G98-M115 WeakPolarHBondContact O-CB 3.4Å; G98-M115 PolarHBondContact O-N 2.74Å
99	Y	90.8	Very high	91	Very high	114 Å²	114	58.6 Å²	58.6	45%	0.447	33%	0.328	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.1	145.1	170.5	-67.2	-95.3	0	0	0	110.6	I95 T96 D97 L113 K114	I95-Y99 CarbonylContact C-O 3.59Å; I95-Y99 WeakPolarHBondContact CA-O 3.47Å; T96-Y99 PolarHBondContact N-O 3.12Å; T96-Y99 WeakPolarHBondContact O-CA 3.42Å; T96-Y99 WeakPolarHBondContact O-CB 3.17Å; T96-Y99 PolarHBondContact O-N 2.74Å; D97-Y99 WeakPolarHBondContact O-CD2 3.42Å; Y99-L113 WeakPolarHBondContact CA-O 3.48Å; Y99-K114 HydrophobicContact CD1-CB 4.49Å; Y99-K114 HydrophobicContact CE1-CB 4.4Å
100	L	91.8	Very high	90.9	Very high	0 Å²	0	57.5 Å²	57.5	0%	0	32%	0.32	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.2	124.5	178.1	-58.3	177.1	0	0	0	109.3	L92 I95 L102 L113 M115 I124 I136 A147	L92-L100 HydrophobicContact CD1-CB 4.18Å; L92-L100 HydrophobicContact CD1-CD2 3.98Å; I95-L100 HydrophobicContact CG1-CD2 4.14Å; L100-L102 HydrophobicContact CB-CD1 4.3Å; L100-L102 HydrophobicContact CB-CD2 3.99Å; L100-L102 HydrophobicContact CB-CG 3.89Å; L100-L113 PolarHBondContact N-O 2.57Å; L100-M115 HydrophobicContact CD2-CB 4.1Å; L100-M115 HydrophobicContact CD2-CG 4.16Å; L100-M115 HydrophobicContact CG-CB 4.34Å; L100-I124 HydrophobicContact CD1-CD1 4.48Å; L100-I124 HydrophobicContact CD2-CG2 4.08Å; L100-I136 HydrophobicContact CD1-CG2 4.49Å; L100-A147 HydrophobicContact CD1-CB 4.48Å
101	S	93.9	Very high	90.8	Very high	7 Å²	7	62.6 Å²	62.6	5%	0.049	34%	0.344	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.1	109.7	167.4	-52.6	0	0	0	0	108.4	I93 G94 R110 E111	I93-S101 WeakPolarHBondContact CG1-O 3.48Å; I93-S101 PolarHBondContact N-O 3.11Å; G94-S101 PolarHBondContact N-O 3.36Å; G94-S101 PolarHBondContact O-N 2.82Å; S101-R110 CarbonylContact C-O 3.59Å; S101-R110 WeakPolarHBondContact CA-O 3.3Å; S101-E111 PolarHBondContact OG-OE1 2.83Å
102	L	93.3	Very high	90.5	Very high	1 Å²	1	64.5 Å²	64.5	1%	0.005	36%	0.356	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.1	123.4	-169.6	-64.8	-178.5	0	0	0	110.4	Y90 Q91 L92 L100 V109 R110 L113 I136 V138	Y90-L102 HydrophobicContact CD1-CB 4.08Å; Y90-L102 HydrophobicContact CG-CB 4.12Å; Y90-L102 HydrophobicContact CG-CD1 4.39Å; Q91-L102 CarbonylContact O-C 3.59Å; Q91-L102 WeakPolarHBondContact O-CA 3.46Å; L92-L102 HydrophobicContact CB-CD2 4.47Å; L92-L102 HydrophobicContact CD1-CD2 3.81Å; L100-L102 HydrophobicContact CB-CD1 4.3Å; L100-L102 HydrophobicContact CB-CD2 3.99Å; L100-L102 HydrophobicContact CB-CG 3.89Å; L102-V109 CarbonylContact O-C 3.45Å; L102-V109 WeakPolarHBondContact O-CA 3.48Å; L102-R110 HydrophobicContact CB-CB 4.45Å; L102-R110 PolarHBondContact N-O 3.2Å; L102-R110 PolarHBondContact O-N 2.95Å; L102-L113 HydrophobicContact CD1-CB 4.37Å; L102-L113 HydrophobicContact CD1-CD1 3.63Å; L102-I136 HydrophobicContact CD2-CB 3.96Å; L102-I136 HydrophobicContact CD2-CG1 3.9Å; L102-V138 HydrophobicContact CD1-CG2 3.89Å
103	L	93.2	Very high	90.4	Very high	44 Å²	44	64.6 Å²	64.6	23%	0.23	36%	0.356	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.1	128.4	178	178.5	67.9	0	0	0	110.5	Y90 Q91 I93 V109	Y90-L103 CarbonylContact C-O 3.59Å; Y90-L103 WeakPolarHBondContact CA-O 3.41Å; Q91-L103 HydrophobicContact CB-CB 4.29Å; Q91-L103 PolarHBondContact N-O 2.9Å; Q91-L103 PolarHBondContact O-N 3.01Å; I93-L103 HydrophobicContact CD1-CB 4.29Å; I93-L103 HydrophobicContact CG1-CB 4.44Å; I93-L103 HydrophobicContact CG2-CB 3.72Å; I93-L103 HydrophobicContact CG2-CD2 4.14Å; L103-V109 HydrophobicContact CD1-CG2 3.7Å
104	Q	90.8	Very high	90.1	Very high	54 Å²	54	67.4 Å²	67.4	25%	0.252	37%	0.366	S	S	.	.			trans	-84.4	158.7	169.1	-70.1	-171.6	40.3	0	0	111.7	Y90 S106 G107 E108	Y90-Q104 HydrophobicContact CD1-CB 4.43Å; Y90-Q104 HydrophobicContact CD1-CG 3.34Å; Y90-Q104 HydrophobicContact CE1-CG 3.12Å; Q104-S106 WeakPolarHBondContact CB-OG 3.49Å; Q104-S106 PolarHBondContact O-N 3.09Å; Q104-S106 VanDerWaalsContact O-N 3.12Å; Q104-G107 PolarHBondContact O-N 3.16Å; Q104-E108 PolarHBondContact N-O 3.32Å
105	D	86.1	Confident	90	Very high	164 Å²	164	69.4 Å²	69.4	88%	0.877	37%	0.373	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.8	-22.6	170.6	-60	-42.2	0	0	0	113	G107	D105-G107 PolarHBondContact O-N 3.44Å
106	S	87.9	Confident	89.8	Confident	76 Å²	76	68.4 Å²	68.4	53%	0.531	37%	0.37	S	S	.	.	T	Hydrogen-bonded Turn	trans	-70.8	-13.3	174.4	63	0	0	0	0	113.6	Q104 E108	Q104-S106 WeakPolarHBondContact CB-OG 3.49Å; Q104-S106 PolarHBondContact O-N 3.09Å; Q104-S106 VanDerWaalsContact O-N 3.12Å; S106-E108 PolarHBondContact OG-N 2.94Å; S106-E108 PolarHBondContact OG-OE2 3.27Å; S106-E108 VanDerWaalsContact OG-OE2 3.06Å
107	G	87.5	Confident	89.6	Confident	53 Å²	53	72.9 Å²	72.9	55%	0.546	39%	0.386	S	S	.	.	S	Bend	trans	89.7	-1.1	-171.3	0	0	0	0	0	114	Q104 D105	Q104-G107 PolarHBondContact O-N 3.16Å; D105-G107 PolarHBondContact O-N 3.44Å
108	E	90.9	Very high	89.5	Confident	123 Å²	123	67.7 Å²	67.7	58%	0.575	37%	0.369	S	S	*	.			trans	-77.7	135.2	176	-67.8	176.7	102	0	0	111.4	Q104 S106	Q104-E108 PolarHBondContact N-O 3.32Å; S106-E108 PolarHBondContact OG-N 2.94Å; S106-E108 PolarHBondContact OG-OE2 3.27Å; S106-E108 VanDerWaalsContact OG-OE2 3.06Å
109	V	91.6	Very high	89.6	Confident	74 Å²	74	72.7 Å²	72.7	45%	0.448	39%	0.39	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.5	135.1	177.2	178.5	0	0	0	0	109.6	I93 L102 L103 E111	I93-V109 HydrophobicContact CD1-CG1 3.84Å; I93-V109 HydrophobicContact CD1-CG2 3.88Å; L102-V109 CarbonylContact O-C 3.45Å; L102-V109 WeakPolarHBondContact O-CA 3.48Å; L103-V109 HydrophobicContact CD1-CG2 3.7Å; V109-E111 HydrophobicContact CG1-CG 4.09Å
110	R	89.8	Confident	89.5	Confident	40 Å²	40	70.1 Å²	70.1	15%	0.151	38%	0.382	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.8	136.5	176.6	-81.2	-173.3	54.8	-177.5	-1.2	110.7	Y90 S101 L102 D112 L113 E145	Y90-R110 PolarHBondContact OH-NH1 3.44Å; S101-R110 CarbonylContact C-O 3.59Å; S101-R110 WeakPolarHBondContact CA-O 3.3Å; L102-R110 HydrophobicContact CB-CB 4.45Å; L102-R110 PolarHBondContact N-O 3.2Å; L102-R110 PolarHBondContact O-N 2.95Å; R110-D112 WeakPolarHBondContact CB-OD1 3.31Å; R110-D112 IonicContact CZ-OD1 3.87Å; R110-D112 IonicContact CZ-OD2 2.72Å; R110-D112 IonicContact NE-OD1 3.39Å; R110-D112 PolarHBondContact NE-OD1 3.34Å; R110-D112 IonicContact NE-OD2 3.2Å; R110-D112 IonicContact NH2-OD1 2.67Å; R110-D112 PolarHBondContact NH2-OD1 2.69Å; R110-D112 IonicContact NH2-OD2 2.89Å; R110-D112 PolarHBondContact NH2-OD2 3.36Å; R110-L113 VanDerWaalsContact NH2-CD1 3.3Å; R110-E145 IonicContact CZ-OE2 3.82Å; R110-E145 VanDerWaalsContact CZ-OE2 3.27Å; R110-E145 IonicContact NH1-OE2 3.47Å; R110-E145 PolarHBondContact NH1-OE2 2.8Å; R110-E145 IonicContact NH2-OE2 2.97Å; R110-E145 PolarHBondContact NH2-OE2 3.24Å
111	E	91.8	Very high	89.4	Confident	113 Å²	113	70.2 Å²	70.2	53%	0.528	38%	0.384	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.9	14.2	-178.2	-53.1	-170	100.4	0	0	112	S101 V109	S101-E111 PolarHBondContact OG-OE1 2.83Å; V109-E111 HydrophobicContact CG1-CG 4.09Å
112	D	87.9	Confident	89.2	Confident	95 Å²	95	76 Å²	76	51%	0.508	41%	0.408	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.4	-16.6	-175.7	61.3	-57.8	0	0	0	113.3	R110	R110-D112 WeakPolarHBondContact CB-OD1 3.31Å; R110-D112 IonicContact CZ-OD1 3.87Å; R110-D112 IonicContact CZ-OD2 2.72Å; R110-D112 IonicContact NE-OD1 3.39Å; R110-D112 PolarHBondContact NE-OD1 3.34Å; R110-D112 IonicContact NE-OD2 3.2Å; R110-D112 IonicContact NH2-OD1 2.67Å; R110-D112 PolarHBondContact NH2-OD1 2.69Å; R110-D112 IonicContact NH2-OD2 2.89Å; R110-D112 PolarHBondContact NH2-OD2 3.36Å
113	L	89.8	Confident	89.1	Confident	14 Å²	14	80.1 Å²	80.1	7%	0.073	43%	0.427	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.1	121.8	-176.4	-77	166	0	0	0	111.8	Y99 L100 L102 R110 V138 E145	Y99-L113 WeakPolarHBondContact CA-O 3.48Å; L100-L113 PolarHBondContact N-O 2.57Å; L102-L113 HydrophobicContact CD1-CB 4.37Å; L102-L113 HydrophobicContact CD1-CD1 3.63Å; R110-L113 VanDerWaalsContact NH2-CD1 3.3Å; L113-V138 HydrophobicContact CD1-CB 4.25Å; L113-V138 HydrophobicContact CD1-CG1 3.69Å; L113-V138 HydrophobicContact CD1-CG2 3.52Å; L113-V138 HydrophobicContact CD2-CG1 4.42Å; L113-E145 HydrophobicContact CD2-CB 3.96Å
114	K	89.3	Confident	89.1	Confident	132 Å²	132	78 Å²	78	57%	0.574	42%	0.416	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-70.8	143.7	173.6	-162.9	178.2	-178.3	-172.1	0	110.6	G98 Y99	G98-K114 WeakPolarHBondContact O-CG 3.44Å; Y99-K114 HydrophobicContact CD1-CB 4.49Å; Y99-K114 HydrophobicContact CE1-CB 4.4Å
115	M	88.1	Confident	89.1	Confident	50 Å²	50	80 Å²	80	25%	0.246	43%	0.426	C	S	.	.	P	Polyproline II helix	trans	-57.2	132.6	172.1	-173.7	170.3	66.3	0	0	110.5	I95 G98 L100	I95-M115 HydrophobicContact CG2-SD 4.44Å; G98-M115 WeakPolarHBondContact O-CB 3.4Å; G98-M115 PolarHBondContact O-N 2.74Å; L100-M115 HydrophobicContact CD2-CB 4.1Å; L100-M115 HydrophobicContact CD2-CG 4.16Å; L100-M115 HydrophobicContact CG-CB 4.34Å
116	P	87.1	Confident	89.3	Confident	26 Å²	26	76.7 Å²	76.7	17%	0.169	41%	0.411	C	S	.	.	P	Polyproline II helix	trans	-64	144.6	178	26	-33.9	0	0	0	110.9	M120 G121 I124 A147	P116-M120 HydrophobicContact CB-CG 4.46Å; P116-M120 HydrophobicContact CB-SD 4.17Å; P116-M120 HydrophobicContact CG-CB 4.3Å; P116-M120 HydrophobicContact CG-CG 3.9Å; P116-M120 HydrophobicContact CG-SD 3.93Å; P116-G121 WeakPolarHBondContact O-CA 3.48Å; P116-G121 PolarHBondContact O-N 2.81Å; P116-I124 HydrophobicContact CG-CD1 3.62Å; P116-A147 HydrophobicContact CG-CB 4.16Å
117	E	85.6	Confident	89.5	Confident	169 Å²	169	75.3 Å²	75.3	79%	0.79	40%	0.396	S	S	*	.	P	Polyproline II helix	trans	-78	163.5	176.7	-61.6	-174.6	165.4	0	0	111.8
118	G	86.9	Confident	89.6	Confident	47 Å²	47	77 Å²	77	49%	0.485	39%	0.386	S	S	.	.	T	Hydrogen-bonded Turn	trans	82.4	-151.3	174.6	0	0	0	0	0	114	M120 G121 K122	G118-M120 VanDerWaalsContact C-N 3.28Å; G118-M120 PolarHBondContact O-N 3.31Å; G118-G121 PolarHBondContact O-N 2.88Å; G118-K122 PolarHBondContact O-N 3.05Å
119	D	87.4	Confident	89.6	Confident	130 Å²	130	77.1 Å²	77.1	70%	0.695	39%	0.391	S	S	*	.	H	α-helix	trans	-67.8	-29.4	-172.7	-62	-33.8	0	0	0	112.6	K122 E123	D119-K122 PolarHBondContact O-N 3Å; D119-E123 WeakPolarHBondContact O-CB 3.29Å; D119-E123 PolarHBondContact O-N 3.17Å
120	M	87.9	Confident	89.5	Confident	60 Å²	60	76.7 Å²	76.7	30%	0.296	40%	0.395	S	S	.	.	H	α-helix	trans	-65.7	-45.4	177.9	-172.8	179.5	-71.9	0	0	112	P116 G118 K122 E123 I124 V148 I150	P116-M120 HydrophobicContact CB-CG 4.46Å; P116-M120 HydrophobicContact CB-SD 4.17Å; P116-M120 HydrophobicContact CG-CB 4.3Å; P116-M120 HydrophobicContact CG-CG 3.9Å; P116-M120 HydrophobicContact CG-SD 3.93Å; G118-M120 VanDerWaalsContact C-N 3.28Å; G118-M120 PolarHBondContact O-N 3.31Å; M120-K122 VanDerWaalsContact C-N 3.32Å; M120-K122 PolarHBondContact O-N 3.24Å; M120-E123 PolarHBondContact O-N 3.32Å; M120-I124 HydrophobicContact CG-CD1 4.34Å; M120-I124 WeakPolarHBondContact O-CG1 3.31Å; M120-I124 PolarHBondContact O-N 2.89Å; M120-V148 WeakPolarHBondContact CE-O 3.3Å; M120-I150 HydrophobicContact CG-CD1 3.94Å; M120-I150 HydrophobicContact CG-CG1 4.25Å
121	G	89.9	Confident	89.4	Confident	3 Å²	3	78 Å²	78	3%	0.031	42%	0.42	C	S	.	.	H	α-helix	trans	-60.7	-42.6	177.1	0	0	0	0	0	112.2	P116 G118 E123 I124 E125	P116-G121 WeakPolarHBondContact O-CA 3.48Å; P116-G121 PolarHBondContact O-N 2.81Å; G118-G121 PolarHBondContact O-N 2.88Å; G121-E123 VanDerWaalsContact C-N 3.33Å; G121-E123 PolarHBondContact O-N 2.79Å; G121-I124 WeakPolarHBondContact O-CB 3.3Å; G121-I124 PolarHBondContact O-N 2.89Å; G121-E125 PolarHBondContact O-N 2.81Å
122	K	90.9	Very high	89.4	Confident	129 Å²	129	77.2 Å²	77.2	56%	0.561	42%	0.417	S	S	*	.	H	α-helix	trans	-63.3	-38.9	175.7	-65.1	176.3	-175.6	170.8	0	112.4	G118 D119 M120 E125 T126	G118-K122 PolarHBondContact O-N 3.05Å; D119-K122 PolarHBondContact O-N 3Å; M120-K122 VanDerWaalsContact C-N 3.32Å; M120-K122 PolarHBondContact O-N 3.24Å; K122-E125 PolarHBondContact O-N 2.95Å; K122-T126 WeakPolarHBondContact O-CB 3.31Å; K122-T126 PolarHBondContact O-N 2.63Å; K122-T126 PolarHBondContact O-OG1 2.88Å
123	E	91.4	Very high	89.4	Confident	86 Å²	86	78.2 Å²	78.2	40%	0.402	42%	0.419	S	S	.	.	H	α-helix	trans	-66	-39.9	176.8	-170.1	-176.7	161.1	0	0	111.4	D119 M120 G121 T126 K127 I150	D119-E123 WeakPolarHBondContact O-CB 3.29Å; D119-E123 PolarHBondContact O-N 3.17Å; M120-E123 PolarHBondContact O-N 3.32Å; G121-E123 VanDerWaalsContact C-N 3.33Å; G121-E123 PolarHBondContact O-N 2.79Å; E123-T126 PolarHBondContact O-N 2.82Å; E123-K127 HydrophobicContact CG-CD 4.24Å; E123-K127 WeakPolarHBondContact O-CB 3.19Å; E123-K127 WeakPolarHBondContact O-CG 3.45Å; E123-K127 PolarHBondContact O-N 2.89Å; E123-K127 WeakPolarHBondContact OE1-CE 3.4Å; E123-K127 IonicContact OE1-NZ 2.88Å; E123-K127 PolarHBondContact OE1-NZ 2.8Å; E123-I150 HydrophobicContact CB-CD1 3.84Å; E123-I150 HydrophobicContact CG-CD1 3.85Å
124	I	91.6	Very high	89.6	Confident	0 Å²	0	77.6 Å²	77.6	0%	0	42%	0.415	C	S	.	.	H	α-helix	trans	-59.6	-51.5	174	-69.3	171.1	0	0	0	110.3	L92 I95 L100 P116 M120 G121 T126 K127 Y128 I134 I136 I150	L92-I124 HydrophobicContact CD2-CG2 3.63Å; I95-I124 HydrophobicContact CD1-CG2 3.99Å; L100-I124 HydrophobicContact CD1-CD1 4.48Å; L100-I124 HydrophobicContact CD2-CG2 4.08Å; P116-I124 HydrophobicContact CG-CD1 3.62Å; M120-I124 HydrophobicContact CG-CD1 4.34Å; M120-I124 WeakPolarHBondContact O-CG1 3.31Å; M120-I124 PolarHBondContact O-N 2.89Å; G121-I124 WeakPolarHBondContact O-CB 3.3Å; G121-I124 PolarHBondContact O-N 2.89Å; I124-T126 PolarHBondContact O-N 3.01Å; I124-K127 PolarHBondContact O-N 2.9Å; I124-Y128 VanDerWaalsContact O-CB 3.29Å; I124-Y128 WeakPolarHBondContact O-CB 3.34Å; I124-Y128 PolarHBondContact O-N 2.86Å; I124-I134 HydrophobicContact CG2-CD1 4.35Å; I124-I136 HydrophobicContact CD1-CD1 3.91Å; I124-I136 HydrophobicContact CG1-CD1 3.88Å; I124-I150 HydrophobicContact CD1-CD1 4.34Å; I124-I150 HydrophobicContact CD1-CG1 4.32Å; I124-I150 HydrophobicContact CG1-CD1 3.49Å; I124-I150 VanDerWaalsContact CG1-CD1 3.49Å; I124-I150 HydrophobicContact CG1-CG1 3.78Å
125	E	90.9	Very high	89.7	Confident	97 Å²	97	73 Å²	73	45%	0.453	40%	0.397	S	S	.	.	H	α-helix	trans	-60.4	-46.2	179.8	-170.6	174.7	-153.2	0	0	111.3	G121 K122 K127 Y128 D129	G121-E125 PolarHBondContact O-N 2.81Å; K122-E125 PolarHBondContact O-N 2.95Å; E125-K127 PolarHBondContact O-N 2.84Å; E125-Y128 PolarHBondContact O-N 2.81Å; E125-D129 WeakPolarHBondContact O-CB 3.35Å; E125-D129 PolarHBondContact O-N 2.82Å
126	T	91.9	Very high	89.9	Confident	94 Å²	94	70.7 Å²	70.7	58%	0.577	39%	0.385	S	S	*	.	H	α-helix	trans	-60.7	-44.6	179.3	-57.2	0	0	0	0	112.2	K122 E123 I124 A130	K122-T126 WeakPolarHBondContact O-CB 3.31Å; K122-T126 PolarHBondContact O-N 2.63Å; K122-T126 PolarHBondContact O-OG1 2.88Å; E123-T126 PolarHBondContact O-N 2.82Å; I124-T126 PolarHBondContact O-N 3.01Å; T126-A130 WeakPolarHBondContact O-CB 3.48Å; T126-A130 PolarHBondContact O-N 2.97Å
127	K	90.9	Very high	90.2	Very high	46 Å²	46	69.8 Å²	69.8	20%	0.2	38%	0.38	C	S	.	.	H	α-helix	trans	-70.7	-36.8	179.6	-74.8	179.7	172.2	171.5	0	112	E123 I124 E125 A130 G131 E132 I134 I150	E123-K127 HydrophobicContact CG-CD 4.24Å; E123-K127 WeakPolarHBondContact O-CB 3.19Å; E123-K127 WeakPolarHBondContact O-CG 3.45Å; E123-K127 PolarHBondContact O-N 2.89Å; E123-K127 WeakPolarHBondContact OE1-CE 3.4Å; E123-K127 IonicContact OE1-NZ 2.88Å; E123-K127 PolarHBondContact OE1-NZ 2.8Å; I124-K127 PolarHBondContact O-N 2.9Å; E125-K127 PolarHBondContact O-N 2.84Å; K127-A130 PolarHBondContact O-N 3.25Å; K127-G131 PolarHBondContact O-N 2.82Å; K127-E132 HydrophobicContact CB-CB 4.49Å; K127-E132 WeakPolarHBondContact O-CB 3.22Å; K127-E132 PolarHBondContact O-N 3.14Å; K127-I134 HydrophobicContact CB-CD1 4.05Å; K127-I134 HydrophobicContact CB-CG2 3.89Å; K127-I134 HydrophobicContact CD-CG2 3.92Å; K127-I134 HydrophobicContact CG-CG2 4.46Å; K127-I150 HydrophobicContact CD-CG2 4.21Å
128	Y	90.1	Very high	90.5	Very high	89 Å²	89	62 Å²	62	35%	0.349	34%	0.343	S	S	.	.	H	α-helix	trans	-63.5	-47	174.5	-175.6	-102.5	0	0	0	111.6	L92 I93 I95 I124 E125 A130 G131	L92-Y128 HydrophobicContact CD2-CD2 3.86Å; L92-Y128 HydrophobicContact CD2-CG 4.3Å; L92-Y128 HydrophobicContact CG-CD2 4.19Å; I93-Y128 PolarHBondContact O-OH 2.9Å; I95-Y128 HydrophobicContact CD1-CD1 4.13Å; I95-Y128 HydrophobicContact CD1-CG 4.12Å; I95-Y128 HydrophobicContact CG1-CD1 4.39Å; I95-Y128 HydrophobicContact CG1-CG 4.44Å; I124-Y128 VanDerWaalsContact O-CB 3.29Å; I124-Y128 WeakPolarHBondContact O-CB 3.34Å; I124-Y128 PolarHBondContact O-N 2.86Å; E125-Y128 PolarHBondContact O-N 2.81Å; Y128-A130 VanDerWaalsContact C-N 3.27Å; Y128-A130 PolarHBondContact O-N 2.82Å; Y128-G131 WeakPolarHBondContact O-CA 3.32Å; Y128-G131 PolarHBondContact O-N 2.08Å
129	D	90.2	Very high	90.8	Very high	125 Å²	125	60 Å²	60	67%	0.668	32%	0.321	S	S	*	.	H	α-helix	trans	-65.2	-29.5	177.2	-75.9	-16.4	0	0	0	113	E125 G131	E125-D129 WeakPolarHBondContact O-CB 3.35Å; E125-D129 PolarHBondContact O-N 2.82Å; D129-G131 PolarHBondContact O-N 3.28Å
130	A	90.9	Very high	91	Very high	66 Å²	66	55 Å²	55	55%	0.545	30%	0.297	S	S	.	.	T	Hydrogen-bonded Turn	trans	-71.1	-8.5	172	0	0	0	0	0	113.3	T126 K127 Y128 E132	T126-A130 WeakPolarHBondContact O-CB 3.48Å; T126-A130 PolarHBondContact O-N 2.97Å; K127-A130 PolarHBondContact O-N 3.25Å; Y128-A130 VanDerWaalsContact C-N 3.27Å; Y128-A130 PolarHBondContact O-N 2.82Å; A130-E132 VanDerWaalsContact C-N 3.28Å; A130-E132 HydrophobicContact CB-CG 4.13Å
131	G	87.6	Confident	91.2	Very high	66 Å²	66	52.2 Å²	52.2	68%	0.68	28%	0.284	S	S	*	.	T	Hydrogen-bonded Turn	trans	71	22.9	-175.2	0	0	0	0	0	113.1	K127 Y128 D129	K127-G131 PolarHBondContact O-N 2.82Å; Y128-G131 WeakPolarHBondContact O-CA 3.32Å; Y128-G131 PolarHBondContact O-N 2.08Å; D129-G131 PolarHBondContact O-N 3.28Å
132	E	90.3	Very high	91.1	Very high	97 Å²	97	54.7 Å²	54.7	45%	0.453	30%	0.295	S	S	.	.			trans	-79.2	136.8	175.8	-66.8	-177.7	-156	0	0	110.7	K127 A130 I134	K127-E132 HydrophobicContact CB-CB 4.49Å; K127-E132 WeakPolarHBondContact O-CB 3.22Å; K127-E132 PolarHBondContact O-N 3.14Å; A130-E132 VanDerWaalsContact C-N 3.28Å; A130-E132 HydrophobicContact CB-CG 4.13Å; E132-I134 HydrophobicContact CB-CG2 4.28Å; E132-I134 PolarHBondContact O-N 2.82Å
133	E	89.3	Confident	90.8	Very high	116 Å²	116	56.1 Å²	56.1	54%	0.542	31%	0.309	S	S	.	.			trans	-78.1	114.3	171.8	-66.2	-177.8	151.8	0	0	109.6	M153	E133-M153 HydrophobicContact CB-CB 3.99Å; E133-M153 HydrophobicContact CB-CE 3.89Å; E133-M153 HydrophobicContact CB-CG 4.49Å; E133-M153 HydrophobicContact CG-CE 4.41Å; E133-M153 PolarHBondContact O-N 2.93Å
134	I	92.5	Very high	90.7	Very high	1 Å²	1	55.4 Å²	55.4	1%	0.005	31%	0.306	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.8	145	-179	67.2	179	0	0	0	111.9	L92 I124 K127 E132 I136 I150 K151	L92-I134 HydrophobicContact CB-CD1 4.41Å; L92-I134 HydrophobicContact CB-CG1 3.78Å; L92-I134 HydrophobicContact CD2-CD1 3.63Å; L92-I134 HydrophobicContact CD2-CG1 3.88Å; L92-I134 HydrophobicContact CG-CG1 4.5Å; L92-I134 PolarHBondContact N-O 3.41Å; I124-I134 HydrophobicContact CG2-CD1 4.35Å; K127-I134 HydrophobicContact CB-CD1 4.05Å; K127-I134 HydrophobicContact CB-CG2 3.89Å; K127-I134 HydrophobicContact CD-CG2 3.92Å; K127-I134 HydrophobicContact CG-CG2 4.46Å; E132-I134 HydrophobicContact CB-CG2 4.28Å; E132-I134 PolarHBondContact O-N 2.82Å; I134-I136 HydrophobicContact CD1-CD1 4.03Å; I134-I136 HydrophobicContact CG1-CD1 4.31Å; I134-I150 HydrophobicContact CB-CG2 4.2Å; I134-I150 HydrophobicContact CD1-CG2 4.12Å; I134-I150 HydrophobicContact CG2-CG2 4.47Å; I134-K151 CarbonylContact C-O 3.52Å; I134-K151 WeakPolarHBondContact CA-O 3.25Å
135	L	92.3	Very high	90.7	Very high	37 Å²	37	59 Å²	59	19%	0.194	32%	0.322	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101	130.1	169.6	-64.2	167.9	0	0	0	109.3	Y90 Q91 K151 M153	Y90-L135 CarbonylContact O-C 3.53Å; Y90-L135 WeakPolarHBondContact O-CA 3.49Å; Q91-L135 HydrophobicContact CB-CD2 4.11Å; L135-K151 HydrophobicContact CB-CB 4.19Å; L135-K151 PolarHBondContact N-O 2.8Å; L135-K151 PolarHBondContact O-N 3.29Å; L135-M153 HydrophobicContact CD1-CG 3.84Å; L135-M153 HydrophobicContact CD1-SD 4.47Å; L135-M153 HydrophobicContact CD2-CG 4.01Å; L135-M153 HydrophobicContact CD2-SD 4.12Å; L135-M153 HydrophobicContact CG-CG 3.55Å; L135-M153 HydrophobicContact CG-SD 4.28Å
136	I	93.3	Very high	90.6	Very high	0 Å²	0	55.8 Å²	55.8	0%	0	31%	0.312	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100	118.7	173.4	-54.8	-57.2	0	0	0	108.3	Y90 L92 L100 L102 I124 I134 V138 A147 I150	Y90-I136 PolarHBondContact N-O 3.47Å; Y90-I136 PolarHBondContact O-N 3.14Å; L92-I136 HydrophobicContact CB-CG1 4.1Å; L100-I136 HydrophobicContact CD1-CG2 4.49Å; L102-I136 HydrophobicContact CD2-CB 3.96Å; L102-I136 HydrophobicContact CD2-CG1 3.9Å; I124-I136 HydrophobicContact CD1-CD1 3.91Å; I124-I136 HydrophobicContact CG1-CD1 3.88Å; I134-I136 HydrophobicContact CD1-CD1 4.03Å; I134-I136 HydrophobicContact CG1-CD1 4.31Å; I136-V138 HydrophobicContact CG2-CG2 4.42Å; I136-V138 PolarHBondContact O-N 3.5Å; I136-A147 HydrophobicContact CG2-CB 3.67Å; I136-I150 HydrophobicContact CD1-CG1 4.17Å; I136-I150 HydrophobicContact CD1-CG2 4.3Å
137	T	92.3	Very high	90.5	Very high	8 Å²	8	52 Å²	52	5%	0.049	29%	0.29	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.7	114.1	171.2	-54.6	0	0	0	0	108.9	R87 L88 D89 V148 A149 K151	R87-T137 HydrophobicContact CB-CG2 4.21Å; L88-T137 CarbonylContact O-C 3.49Å; L88-T137 WeakPolarHBondContact O-CA 3.44Å; D89-T137 VanDerWaalsContact OD1-CB 3.29Å; D89-T137 WeakPolarHBondContact OD1-CB 3.49Å; D89-T137 WeakPolarHBondContact OD1-CG2 3.43Å; D89-T137 PolarHBondContact OD1-OG1 2.86Å; T137-V148 HydrophobicContact CG2-CG2 4.14Å; T137-V148 WeakPolarHBondContact O-CG2 3.34Å; T137-V148 PolarHBondContact O-N 2.77Å; T137-A149 PolarHBondContact N-O 3.5Å; T137-K151 WeakPolarHBondContact OG1-CE 3.45Å; T137-K151 PolarHBondContact OG1-NZ 2.79Å
138	V	92.2	Very high	90.5	Very high	4 Å²	4	52 Å²	52	2%	0.024	29%	0.294	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.6	130.3	171.5	-177.2	0	0	0	0	108.8	R87 L88 Y90 L102 L113 I136 E145 A146	R87-V138 WeakPolarHBondContact CA-O 3.33Å; L88-V138 PolarHBondContact N-O 2.87Å; L88-V138 PolarHBondContact O-N 3.36Å; Y90-V138 HydrophobicContact CD2-CB 4.06Å; Y90-V138 HydrophobicContact CD2-CG2 3.57Å; Y90-V138 HydrophobicContact CE2-CB 3.7Å; Y90-V138 HydrophobicContact CE2-CG2 3.67Å; L102-V138 HydrophobicContact CD1-CG2 3.89Å; L113-V138 HydrophobicContact CD1-CB 4.25Å; L113-V138 HydrophobicContact CD1-CG1 3.69Å; L113-V138 HydrophobicContact CD1-CG2 3.52Å; L113-V138 HydrophobicContact CD2-CG1 4.42Å; I136-V138 HydrophobicContact CG2-CG2 4.42Å; I136-V138 PolarHBondContact O-N 3.5Å; V138-E145 HydrophobicContact CG1-CB 4.16Å; V138-A146 WeakPolarHBondContact CA-O 3.44Å
139	L	92.6	Very high	90.5	Very high	5 Å²	5	49.4 Å²	49.4	3%	0.026	29%	0.291	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.8	129.1	171.9	-172	152.2	0	0	0	109.2	I64 F65 I85 K86 R87 A141 E145 A146 V148	I64-L139 HydrophobicContact CD1-CD1 4.47Å; I64-L139 HydrophobicContact CD1-CD2 3.47Å; I64-L139 VanDerWaalsContact CD1-CD2 3.47Å; I64-L139 HydrophobicContact CG1-CD2 4.19Å; F65-L139 HydrophobicContact CE1-CD2 3.81Å; F65-L139 HydrophobicContact CZ-CD2 3.68Å; I85-L139 HydrophobicContact CG2-CD1 3.9Å; I85-L139 HydrophobicContact CG2-CD2 4.09Å; I85-L139 HydrophobicContact CG2-CG 3.84Å; K86-L139 WeakPolarHBondContact O-CA 3.17Å; R87-L139 HydrophobicContact CG-CB 4.4Å; R87-L139 HydrophobicContact CG-CD1 4.24Å; R87-L139 HydrophobicContact CG-CG 4.2Å; L139-A141 HydrophobicContact CD2-CB 4.06Å; L139-E145 CarbonylContact O-C 3.57Å; L139-E145 VanDerWaalsContact O-CA 3.27Å; L139-E145 WeakPolarHBondContact O-CA 3.41Å; L139-A146 PolarHBondContact N-O 3.46Å; L139-A146 PolarHBondContact O-N 3.46Å; L139-V148 HydrophobicContact CB-CB 4.36Å; L139-V148 HydrophobicContact CB-CG1 3.67Å; L139-V148 HydrophobicContact CB-CG2 3.73Å; L139-V148 HydrophobicContact CD1-CG1 4.39Å; L139-V148 HydrophobicContact CD1-CG2 4.41Å
140	S	91.6	Very high	90.5	Very high	26 Å²	26	44.9 Å²	44.9	18%	0.182	27%	0.267	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.7	129.2	176.3	-178.3	0	0	0	0	110.1	K86 E144 E145	K86-S140 PolarHBondContact N-O 3.03Å; K86-S140 PolarHBondContact O-N 3.04Å; S140-E144 WeakPolarHBondContact CA-O 3.48Å; S140-E145 WeakPolarHBondContact CB-OE1 3.25Å; S140-E145 WeakPolarHBondContact OG-CG 3.42Å; S140-E145 PolarHBondContact OG-OE1 3.13Å
141	A	92.3	Very high	90.5	Very high	2 Å²	2	46 Å²	46	2%	0.017	26%	0.259	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-155.6	131.7	179.2	0	0	0	0	0	111.7	P38 I64 F65 I85 L139 N143 E144	P38-A141 HydrophobicContact CB-CB 4.25Å; P38-A141 HydrophobicContact CG-CB 4.29Å; I64-A141 HydrophobicContact CD1-CB 3.86Å; F65-A141 HydrophobicContact CE2-CB 3.96Å; F65-A141 HydrophobicContact CZ-CB 3.89Å; I85-A141 HydrophobicContact CD1-CB 3.35Å; L139-A141 HydrophobicContact CD2-CB 4.06Å; A141-N143 PolarHBondContact O-N 3.42Å; A141-N143 VanDerWaalsContact O-N 3.12Å; A141-E144 PolarHBondContact N-O 3.26Å; A141-E144 PolarHBondContact O-N 3.39Å
142	M	87.5	Confident	90.5	Very high	54 Å²	54	46 Å²	46	27%	0.266	25%	0.253	S	S	.	.	T	Hydrogen-bonded Turn	trans	49.5	37.8	175	-59	-177.6	69.3	0	0	114.8	A17 T18 V33 P38 P83 E144	A17-M142 HydrophobicContact CB-CG 4.47Å; T18-M142 HydrophobicContact CG2-CE 3.84Å; T18-M142 HydrophobicContact CG2-CG 4.1Å; T18-M142 HydrophobicContact CG2-SD 3.98Å; V33-M142 HydrophobicContact CB-SD 4.44Å; V33-M142 HydrophobicContact CG1-CE 4.02Å; V33-M142 HydrophobicContact CG1-SD 4.08Å; V33-M142 HydrophobicContact CG2-CE 4.1Å; V33-M142 HydrophobicContact CG2-SD 3.5Å; V33-M142 VanDerWaalsContact CG2-SD 3.5Å; P38-M142 HydrophobicContact CB-CG 4.48Å; P38-M142 HydrophobicContact CB-SD 4.02Å; P38-M142 HydrophobicContact CG-SD 4.31Å; P83-M142 HydrophobicContact CB-CG 3.89Å; P83-M142 HydrophobicContact CB-SD 4.05Å; M142-E144 VanDerWaalsContact C-N 3.32Å
143	N	85.6	Confident	90	Very high	159 Å²	159	44.5 Å²	44.5	85%	0.85	25%	0.247	S	C	*	.	T	Hydrogen-bonded Turn	trans	72.4	13.6	-177.2	-39.9	-75.2	0	0	0	115.6	A141	A141-N143 PolarHBondContact O-N 3.42Å; A141-N143 VanDerWaalsContact O-N 3.12Å
144	E	89	Confident	89	Confident	72 Å²	72	43.8 Å²	43.8	34%	0.336	26%	0.261	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.5	138.2	170.1	-173.7	172	-176.6	0	0	108.8	R37 F65 S140 A141 M142	R37-E144 IonicContact CZ-OE2 2.73Å; R37-E144 IonicContact NH2-OE1 2.63Å; R37-E144 IonicContact NH2-OE2 2.69Å; R37-E144 PolarHBondContact NH2-OE2 2.98Å; F65-E144 WeakPolarHBondContact CB-OE1 3.3Å; F65-E144 HydrophobicContact CD1-CG 4.08Å; F65-E144 HydrophobicContact CD2-CB 4.07Å; F65-E144 HydrophobicContact CD2-CG 3.7Å; F65-E144 VanDerWaalsContact CD2-OE2 3.25Å; F65-E144 WeakPolarHBondContact CD2-OE2 3.47Å; F65-E144 HydrophobicContact CE1-CG 4.1Å; F65-E144 HydrophobicContact CE2-CB 3.62Å; F65-E144 HydrophobicContact CE2-CG 3.71Å; F65-E144 VanDerWaalsContact CG-CD 3.49Å; F65-E144 HydrophobicContact CG-CG 3.88Å; F65-E144 WeakPolarHBondContact CG-OE1 3.42Å; F65-E144 HydrophobicContact CZ-CB 3.87Å; F65-E144 HydrophobicContact CZ-CG 3.92Å; F65-E144 VanDerWaalsContact CZ-O 3.23Å; F65-E144 WeakPolarHBondContact CZ-O 3.41Å; S140-E144 WeakPolarHBondContact CA-O 3.48Å; A141-E144 PolarHBondContact N-O 3.26Å; A141-E144 PolarHBondContact O-N 3.39Å; M142-E144 VanDerWaalsContact C-N 3.32Å
145	E	90.9	Very high	87.1	Confident	75 Å²	75	56.5 Å²	56.5	35%	0.35	32%	0.316	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.9	140.7	178	-55.6	-156.8	152	0	0	110.8	R110 L113 V138 L139 S140	R110-E145 IonicContact CZ-OE2 3.82Å; R110-E145 VanDerWaalsContact CZ-OE2 3.27Å; R110-E145 IonicContact NH1-OE2 3.47Å; R110-E145 PolarHBondContact NH1-OE2 2.8Å; R110-E145 IonicContact NH2-OE2 2.97Å; R110-E145 PolarHBondContact NH2-OE2 3.24Å; L113-E145 HydrophobicContact CD2-CB 3.96Å; V138-E145 HydrophobicContact CG1-CB 4.16Å; L139-E145 CarbonylContact O-C 3.57Å; L139-E145 VanDerWaalsContact O-CA 3.27Å; L139-E145 WeakPolarHBondContact O-CA 3.41Å; S140-E145 WeakPolarHBondContact CB-OE1 3.25Å; S140-E145 WeakPolarHBondContact OG-CG 3.42Å; S140-E145 PolarHBondContact OG-OE1 3.13Å
146	A	89.4	Confident	86.9	Confident	29 Å²	29	57.5 Å²	57.5	24%	0.24	32%	0.322	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.9	148.5	175.4	0	0	0	0	0	112	F65 V138 L139 V148	F65-A146 HydrophobicContact CD1-CB 3.59Å; F65-A146 HydrophobicContact CE1-CB 3.83Å; V138-A146 WeakPolarHBondContact CA-O 3.44Å; L139-A146 PolarHBondContact N-O 3.46Å; L139-A146 PolarHBondContact O-N 3.46Å; A146-V148 PolarHBondContact O-N 3.05Å
147	A	90.1	Very high	86.5	Confident	14 Å²	14	60.5 Å²	60.5	12%	0.116	34%	0.339	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.9	125.5	166	0	0	0	0	0	109.6	L100 P116 I136	L100-A147 HydrophobicContact CD1-CB 4.48Å; P116-A147 HydrophobicContact CG-CB 4.16Å; I136-A147 HydrophobicContact CG2-CB 3.67Å
148	V	90.1	Very high	86.2	Confident	47 Å²	47	63.4 Å²	63.4	29%	0.285	36%	0.355	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.9	-13.9	-174.6	-63.4	0	0	0	0	114.3	M120 T137 L139 A146	M120-V148 WeakPolarHBondContact CE-O 3.3Å; T137-V148 HydrophobicContact CG2-CG2 4.14Å; T137-V148 WeakPolarHBondContact O-CG2 3.34Å; T137-V148 PolarHBondContact O-N 2.77Å; L139-V148 HydrophobicContact CB-CB 4.36Å; L139-V148 HydrophobicContact CB-CG1 3.67Å; L139-V148 HydrophobicContact CB-CG2 3.73Å; L139-V148 HydrophobicContact CD1-CG1 4.39Å; L139-V148 HydrophobicContact CD1-CG2 4.41Å; A146-V148 PolarHBondContact O-N 3.05Å
149	A	89.8	Confident	85.9	Confident	34 Å²	34	66.9 Å²	66.9	28%	0.281	38%	0.375	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-154.7	152.9	176.5	0	0	0	0	0	112	T137	T137-A149 PolarHBondContact N-O 3.5Å
150	I	91.2	Very high	85.5	Confident	31 Å²	31	70.8 Å²	70.8	16%	0.159	40%	0.396	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114	130.9	172.6	-51.2	164.1	0	0	0	106.9	M120 E123 I124 K127 I134 I136	M120-I150 HydrophobicContact CG-CD1 3.94Å; M120-I150 HydrophobicContact CG-CG1 4.25Å; E123-I150 HydrophobicContact CB-CD1 3.84Å; E123-I150 HydrophobicContact CG-CD1 3.85Å; I124-I150 HydrophobicContact CD1-CD1 4.34Å; I124-I150 HydrophobicContact CD1-CG1 4.32Å; I124-I150 HydrophobicContact CG1-CD1 3.49Å; I124-I150 VanDerWaalsContact CG1-CD1 3.49Å; I124-I150 HydrophobicContact CG1-CG1 3.78Å; K127-I150 HydrophobicContact CD-CG2 4.21Å; I134-I150 HydrophobicContact CB-CG2 4.2Å; I134-I150 HydrophobicContact CD1-CG2 4.12Å; I134-I150 HydrophobicContact CG2-CG2 4.47Å; I136-I150 HydrophobicContact CD1-CG1 4.17Å; I136-I150 HydrophobicContact CD1-CG2 4.3Å
151	K	91.2	Very high	85	Confident	89 Å²	89	73.8 Å²	73.8	39%	0.387	41%	0.411	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.6	142	173	-62.7	168.1	-179	163.4	0	108.3	D89 I134 L135 T137	D89-K151 IonicContact OD1-NZ 3.27Å; D89-K151 PolarHBondContact OD1-NZ 2.79Å; D89-K151 IonicContact OD2-NZ 2.86Å; D89-K151 PolarHBondContact OD2-NZ 2.79Å; I134-K151 CarbonylContact C-O 3.52Å; I134-K151 WeakPolarHBondContact CA-O 3.25Å; L135-K151 HydrophobicContact CB-CB 4.19Å; L135-K151 PolarHBondContact N-O 2.8Å; L135-K151 PolarHBondContact O-N 3.29Å; T137-K151 WeakPolarHBondContact OG1-CE 3.45Å; T137-K151 PolarHBondContact OG1-NZ 2.79Å
152	A	87.3	Confident	84.5	Confident	67 Å²	67	78.9 Å²	78.9	55%	0.554	44%	0.439	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-76.4	138.2	169.1	0	0	0	0	0	109.1	A154	A152-A154 PolarHBondContact O-N 3.48Å; A152-A154 VanDerWaalsContact O-N 3.17Å
153	M	80.6	Confident	84.3	Confident	64 Å²	64	80.8 Å²	80.8	32%	0.315	45%	0.452	S	S	.	.			trans	-70.9	107.9	161.7	-80.1	-138.5	-77	0	0	107.7	Q91 E133 L135 K155	Q91-M153 HydrophobicContact CG-CE 4.04Å; E133-M153 HydrophobicContact CB-CB 3.99Å; E133-M153 HydrophobicContact CB-CE 3.89Å; E133-M153 HydrophobicContact CB-CG 4.49Å; E133-M153 HydrophobicContact CG-CE 4.41Å; E133-M153 PolarHBondContact O-N 2.93Å; L135-M153 HydrophobicContact CD1-CG 3.84Å; L135-M153 HydrophobicContact CD1-SD 4.47Å; L135-M153 HydrophobicContact CD2-CG 4.01Å; L135-M153 HydrophobicContact CD2-SD 4.12Å; L135-M153 HydrophobicContact CG-CG 3.55Å; L135-M153 HydrophobicContact CG-SD 4.28Å; M153-K155 PolarHBondContact O-N 3.11Å
154	A	67.1	Low	84.2	Confident	101 Å²	101	74.3 Å²	74.3	84%	0.835	42%	0.419	S	S	*	.			trans	-67.9	122.7	169.5	0	0	0	0	0	108	A152	A152-A154 PolarHBondContact O-N 3.48Å; A152-A154 VanDerWaalsContact O-N 3.17Å
155	K	53.6	Low	83.8	Confident	269 Å²	269	74.5 Å²	74.5	100%	1.17	43%	0.426	S	S	*	.			trans	-71.9	0	177.2	-162.5	176.7	-173.5	172.3	0	112.2	M153	M153-K155 PolarHBondContact O-N 3.11Å

Retrieved 155 of 155 residues in 1100 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).