A0A674I6C8_9SAUR Loading...

DET1- and DDB1-associated protein 1

Functions as a component of numerous distinct DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. In the DCX complexes, acts as a scaffolding subunit required to stabilize the complex.

AlphaFold DB , UniProt , Accession A0A674I6C8, Species 9SAUR (Terrapene triunguis, Three-toed box turtle), Gene DDA1, Length 101 aa.

						>A0A674I6C8_9SAUR|A0A674I6C8|DDA1
ADFLKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQWDKKNAAKKRDQEQVEIEGENSAPPRKIARTDSQDMNEDT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	A	62.8	Low	88.6	Confident	132 Å²	132	130.5 Å²	130.5	100%	1.091	73%	0.726	S	S	*	*				0	15.9	0	0	0	0	0	0	112.8	F3	A1-F3 PolarHBondContact O-N 3.45Å
2	D	76.8	Confident	89.1	Confident	111 Å²	111	134.9 Å²	134.9	59%	0.594	73%	0.732	S	S	*	*	G	3₁₀ helix	trans	-76.9	-6.2	-176.2	-62.4	-58.3	0	0	0	115	L4 K5	D2-L4 PolarHBondContact O-N 3.11Å; D2-K5 PolarHBondContact O-N 3.23Å; D2-K5 WeakPolarHBondContact OD1-CE 3.42Å; D2-K5 IonicContact OD1-NZ 2.69Å; D2-K5 PolarHBondContact OD1-NZ 3.41Å
3	F	89.3	Confident	89.6	Confident	194 Å²	194	129.6 Å²	129.6	85%	0.851	71%	0.711	S	S	*	*	G	3₁₀ helix	trans	-63.1	-25.9	-179.6	-177	-102.5	0	0	0	114	A1	A1-F3 PolarHBondContact O-N 3.45Å
4	L	88.8	Confident	89.8	Confident	139 Å²	139	127.3 Å²	127.3	73%	0.728	70%	0.698	S	S	*	*	G	3₁₀ helix	trans	-96.6	8.6	-175.9	-67.4	172.9	0	0	0	114.1	D2	D2-L4 PolarHBondContact O-N 3.11Å
5	K	91.9	Very high	89.9	Confident	151 Å²	151	129.8 Å²	129.8	66%	0.657	70%	0.699	S	S	*	*			trans	-90.5	156.1	177.7	-65.5	176.3	179.2	171.3	0	110.8	D2	D2-K5 PolarHBondContact O-N 3.23Å; D2-K5 WeakPolarHBondContact OD1-CE 3.42Å; D2-K5 IonicContact OD1-NZ 2.69Å; D2-K5 PolarHBondContact OD1-NZ 3.41Å
6	G	90.6	Very high	90	Very high	83 Å²	83	126.9 Å²	126.9	86%	0.856	69%	0.692	S	S	*	*			trans	78.9	26.4	171.2	0	0	0	0	0	115.8
7	L	92.9	Very high	89.9	Confident	128 Å²	128	131.9 Å²	131.9	67%	0.67	70%	0.698	S	S	*	*			trans	-58.7	149.1	174.5	-63.5	175.8	0	0	0	111.6	V9	L7-V9 PolarHBondContact O-N 3.45Å
8	P	95.8	Very high	89.6	Confident	103 Å²	103	133 Å²	133	67%	0.669	70%	0.696	S	S	*	*			trans	-55.1	131.5	179.9	-26.9	34.9	0	0	0	113	Y10	P8-Y10 HydrophobicContact CB-CE2 4.29Å
9	V	95	Very high	89	Confident	99 Å²	99	133.7 Å²	133.7	60%	0.6	70%	0.696	S	S	*	*			trans	-118.9	95.1	175.1	-176.5	0	0	0	0	109.2	L7 K12	L7-V9 PolarHBondContact O-N 3.45Å; V9-K12 HydrophobicContact CG1-CB 4.33Å; V9-K12 HydrophobicContact CG1-CG 3.64Å
10	Y	95.6	Very high	87.9	Confident	216 Å²	216	131.1 Å²	131.1	85%	0.847	69%	0.694	S	S	*	*	S	Bend	trans	-67.7	-38.2	174.1	-60.5	-78.7	0	0	0	111.7	P8	P8-Y10 HydrophobicContact CB-CE2 4.29Å
11	N	95.6	Very high	86.6	Confident	80 Å²	80	132.1 Å²	132.1	43%	0.428	70%	0.7	S	S	.	*			trans	-153.1	122.7	173.4	-179.6	-3.1	0	0	0	110.2	S13 N14	N11-S13 VanDerWaalsContact CG-OG 3.28Å; N11-S13 PolarHBondContact ND2-OG 3.28Å; N11-S13 PolarHBondContact O-N 3.1Å; N11-S13 PolarHBondContact OD1-N 3.19Å; N11-S13 PolarHBondContact OD1-OG 3.46Å; N11-N14 WeakPolarHBondContact CB-OD1 3.31Å; N11-N14 PolarHBondContact ND2-OD1 2.87Å; N11-N14 PolarHBondContact O-N 3.29Å
12	K	94.4	Very high	86.3	Confident	183 Å²	183	130.4 Å²	130.4	80%	0.796	68%	0.68	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.2	-25.2	-179.4	-69.1	177.3	-179.2	-179.6	0	112.9	V9	V9-K12 HydrophobicContact CG1-CB 4.33Å; V9-K12 HydrophobicContact CG1-CG 3.64Å
13	S	95.4	Very high	85.3	Confident	66 Å²	66	131.1 Å²	131.1	46%	0.462	69%	0.688	S	S	.	*	T	Hydrogen-bonded Turn	trans	-79.5	-25.5	-176.7	68.7	0	0	0	0	114.1	N11 F15 S16	N11-S13 VanDerWaalsContact CG-OG 3.28Å; N11-S13 PolarHBondContact ND2-OG 3.28Å; N11-S13 PolarHBondContact O-N 3.1Å; N11-S13 PolarHBondContact OD1-N 3.19Å; N11-S13 PolarHBondContact OD1-OG 3.46Å; S13-F15 PolarHBondContact O-N 3.31Å; S13-S16 WeakPolarHBondContact CA-OG 3.42Å; S13-S16 PolarHBondContact O-N 2.83Å; S13-S16 VanDerWaalsContact O-N 3.15Å; S13-S16 PolarHBondContact O-OG 3.43Å
14	N	92.7	Very high	83.7	Confident	97 Å²	97	128.3 Å²	128.3	52%	0.519	69%	0.691	S	S	.	*	T	Hydrogen-bonded Turn	trans	-50.3	-39	-166.9	-76.3	-1.9	0	0	0	114.5	N11	N11-N14 WeakPolarHBondContact CB-OD1 3.31Å; N11-N14 PolarHBondContact ND2-OD1 2.87Å; N11-N14 PolarHBondContact O-N 3.29Å
15	F	91	Very high	82	Confident	165 Å²	165	131 Å²	131	72%	0.724	70%	0.697	S	S	*	*	T	Hydrogen-bonded Turn	trans	-120.7	2.4	-178.7	-62.9	-77.9	0	0	0	113.7	S13 R17 F18	S13-F15 PolarHBondContact O-N 3.31Å; F15-R17 PolarHBondContact O-N 3.15Å; F15-R17 VanDerWaalsContact O-N 3.15Å; F15-F18 PolarHBondContact O-N 3.21Å
16	S	91.8	Very high	80.3	Confident	83 Å²	83	128 Å²	128	58%	0.58	70%	0.7	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.2	-23.5	-176.5	62.6	0	0	0	0	114.6	S13	S13-S16 WeakPolarHBondContact CA-OG 3.42Å; S13-S16 PolarHBondContact O-N 2.83Å; S13-S16 VanDerWaalsContact O-N 3.15Å; S13-S16 PolarHBondContact O-OG 3.43Å
17	R	88.1	Confident	78.7	Confident	212 Å²	212	128 Å²	128	80%	0.8	69%	0.687	S	S	*	*	T	Hydrogen-bonded Turn	trans	-119	10.3	-176.2	-63.2	177.1	64.1	-171.3	0.3	113	F15 H19	F15-R17 PolarHBondContact O-N 3.15Å; F15-R17 VanDerWaalsContact O-N 3.15Å; R17-H19 PolarHBondContact O-CD2 3.37Å; R17-H19 PolarHBondContact O-N 2.94Å
18	F	84.6	Confident	77.1	Confident	152 Å²	152	129.9 Å²	129.9	67%	0.667	70%	0.698	S	S	*	*			trans	-73.9	123.2	179.8	179.1	-100	0	0	0	109.5	F15 A20	F15-F18 PolarHBondContact O-N 3.21Å; F18-A20 HydrophobicContact CE1-CB 4.19Å
19	H	78.1	Confident	75.6	Confident	147 Å²	147	135.2 Å²	135.2	68%	0.681	71%	0.705	S	S	*	*			trans	-125	112.5	177.5	-63.4	-72.9	0	0	0	109.3	R17 D21	R17-H19 PolarHBondContact O-CD2 3.37Å; R17-H19 PolarHBondContact O-N 2.94Å; H19-D21 VanDerWaalsContact C-N 3.35Å
20	A	67.5	Low	74.7	Confident	80 Å²	80	141.2 Å²	141.2	66%	0.661	72%	0.716	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.9	-28.6	179.4	0	0	0	0	0	112.7	F18 S22	F18-A20 HydrophobicContact CE1-CB 4.19Å; A20-S22 VanDerWaalsContact C-N 3.33Å; A20-S22 PolarHBondContact O-N 3.41Å
21	D	59.7	Low	74.2	Confident	153 Å²	153	136.6 Å²	136.6	82%	0.818	71%	0.713	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.5	17.8	-171.3	-55.2	-42.9	0	0	0	114.1	H19 V23	H19-D21 VanDerWaalsContact C-N 3.35Å; D21-V23 PolarHBondContact O-N 3.13Å
22	S	56.1	Low	73.9	Confident	96 Å²	96	138.5 Å²	138.5	67%	0.671	73%	0.733	S	S	*	*	S	Bend	trans	-71.3	79.3	171.3	-161.9	0	0	0	0	109.6	A20 C24	A20-S22 VanDerWaalsContact C-N 3.33Å; A20-S22 PolarHBondContact O-N 3.41Å; S22-C24 PolarHBondContact O-N 3.5Å
23	V	56.4	Low	73.9	Confident	127 Å²	127	135.2 Å²	135.2	77%	0.77	73%	0.728	S	S	*	*	T	Hydrogen-bonded Turn	trans	17.4	85.6	164.2	-159.2	0	0	0	0	113.6	D21 K25	D21-V23 PolarHBondContact O-N 3.13Å; V23-K25 PolarHBondContact O-N 2.92Å
24	C	55.3	Low	73.9	Confident	135 Å²	135	140.6 Å²	140.6	91%	0.912	74%	0.739	S	S	*	*	T	Hydrogen-bonded Turn	trans	10.5	55.6	160.3	-70.6	0	0	0	0	118.1	S22	S22-C24 PolarHBondContact O-N 3.5Å
25	K	54.4	Low	74	Confident	195 Å²	195	142.3 Å²	142.3	85%	0.848	75%	0.747	S	S	*	*			trans	-131.5	31.2	157.5	-65.6	-168.9	-176.3	-179.8	0	108.9	V23 S27	V23-K25 PolarHBondContact O-N 2.92Å; K25-S27 PolarHBondContact O-N 3.45Å
26	A	55.1	Low	74.2	Confident	87 Å²	87	138.7 Å²	138.7	72%	0.719	74%	0.741	S	S	*	*			trans	-58.9	87.5	154.5	0	0	0	0	0	105.4	N28	A26-N28 PolarHBondContact O-N 3.25Å
27	S	58.2	Low	74.5	Confident	85 Å²	85	141.1 Å²	141.1	59%	0.594	75%	0.752	S	S	*	*			trans	-41.8	118.4	170.9	-176.1	0	0	0	0	105.3	K25 R29	K25-S27 PolarHBondContact O-N 3.45Å; S27-R29 PolarHBondContact O-N 3.29Å; S27-R29 WeakPolarHBondContact OG-CB 3.2Å; S27-R29 PolarHBondContact OG-N 3.37Å
28	N	57.5	Low	74.9	Confident	166 Å²	166	139.5 Å²	139.5	89%	0.888	75%	0.746	S	S	*	*			trans	-59.8	32.3	162.1	-69.1	-61.1	0	0	0	111	A26 R30	A26-N28 PolarHBondContact O-N 3.25Å; N28-R30 PolarHBondContact O-N 3.06Å
29	R	64.6	Low	75.4	Confident	215 Å²	215	141.6 Å²	141.6	81%	0.811	76%	0.758	S	S	*	*			trans	-67	93.5	167.8	-118	-178.7	171.2	179.7	-2.3	105.5	S27	S27-R29 PolarHBondContact O-N 3.29Å; S27-R29 WeakPolarHBondContact OG-CB 3.2Å; S27-R29 PolarHBondContact OG-N 3.37Å
30	R	76.1	Confident	76.2	Confident	225 Å²	225	142.6 Å²	142.6	85%	0.849	76%	0.757	S	S	*	*			trans	-40.5	133.2	155.5	-63.3	179.6	177.4	-177.9	-1.9	107.2	N28 S32	N28-R30 PolarHBondContact O-N 3.06Å; R30-S32 PolarHBondContact O-N 3.42Å
31	P	85.8	Confident	77.6	Confident	119 Å²	119	144.7 Å²	144.7	77%	0.773	76%	0.764	S	S	*	*			trans	-45.1	142.6	171.6	-28.5	35	0	0	0	109.9	V33	P31-V33 PolarHBondContact O-N 3.46Å
32	S	89	Confident	79.4	Confident	121 Å²	121	142.2 Å²	142.2	85%	0.846	76%	0.759	S	S	*	*	P	Polyproline II helix	trans	-54.7	134.5	175.7	-175	0	0	0	0	109.2	R30	R30-S32 PolarHBondContact O-N 3.42Å
33	V	94.1	Very high	81.3	Confident	114 Å²	114	147 Å²	147	69%	0.691	77%	0.77	S	S	*	*	P	Polyproline II helix	trans	-74	137.1	178.8	179.7	0	0	0	0	108.3	P31 L35	P31-V33 PolarHBondContact O-N 3.46Å; V33-L35 WeakPolarHBondContact O-CD1 3.47Å; V33-L35 PolarHBondContact O-N 2.86Å
34	Y	95.4	Very high	83.3	Confident	179 Å²	179	149.2 Å²	149.2	70%	0.702	77%	0.772	S	S	*	*	P	Polyproline II helix	trans	-74.1	120.7	170.5	176.1	-117.3	0	0	0	109.6	P36	Y34-P36 HydrophobicContact CD1-CG 3.89Å; Y34-P36 HydrophobicContact CE1-CB 3.86Å; Y34-P36 HydrophobicContact CE1-CG 3.54Å; Y34-P36 WeakPolarHBondContact O-CD 3.41Å
35	L	95.6	Very high	85.3	Confident	132 Å²	132	149.4 Å²	149.4	69%	0.691	76%	0.763	S	S	*	*			trans	-105.4	101.6	171	-68.2	95.6	0	0	0	108.8	V33 T37	V33-L35 WeakPolarHBondContact O-CD1 3.47Å; V33-L35 PolarHBondContact O-N 2.86Å; L35-T37 PolarHBondContact O-N 3.44Å
36	P	95.6	Very high	87.3	Confident	90 Å²	90	148.4 Å²	148.4	58%	0.584	77%	0.765	S	S	*	*			trans	-62.7	123.2	175.6	-9.6	20.2	0	0	0	110.2	Y34	Y34-P36 HydrophobicContact CD1-CG 3.89Å; Y34-P36 HydrophobicContact CE1-CB 3.86Å; Y34-P36 HydrophobicContact CE1-CG 3.54Å; Y34-P36 WeakPolarHBondContact O-CD 3.41Å
37	T	97.1	Very high	89.4	Confident	133 Å²	133	149.7 Å²	149.7	82%	0.816	76%	0.763	S	S	*	*			trans	-110.2	-10.7	178.6	51.6	0	0	0	0	113.5	L35	L35-T37 PolarHBondContact O-N 3.44Å
38	R	96.9	Very high	91.3	Very high	179 Å²	179	152 Å²	152	68%	0.675	77%	0.774	S	S	*	*	S	Bend	trans	-129.1	136.3	179.4	-64.1	-177.5	-179.6	178.1	-0.5	108.3	Y40	R38-Y40 HydrophobicContact CB-CE2 3.82Å; R38-Y40 WeakPolarHBondContact CD-OH 3.4Å
39	E	94.5	Very high	93.2	Very high	196 Å²	196	149.7 Å²	149.7	92%	0.916	76%	0.758	S	S	*	*			trans	-87.2	135.9	172.2	-64.1	-169.2	170.8	0	0	109.7
40	Y	96.4	Very high	94.8	Very high	167 Å²	167	149.4 Å²	149.4	66%	0.655	76%	0.763	S	S	*	*			trans	-125.1	126.5	172.1	-63.1	-80.2	0	0	0	107.4	R38	R38-Y40 HydrophobicContact CB-CE2 3.82Å; R38-Y40 WeakPolarHBondContact CD-OH 3.4Å
41	P	96.2	Very high	95.8	Very high	125 Å²	125	141.4 Å²	141.4	81%	0.812	74%	0.739	S	S	*	*			trans	-68.6	142.6	-178.8	28.4	-34.1	0	0	0	110.9
42	S	96.6	Very high	96.4	Very high	101 Å²	101	140.2 Å²	140.2	71%	0.706	73%	0.726	S	S	*	*			trans	-73.1	135.3	171.8	-60.3	0	0	0	0	110.6	Q44	S42-Q44 VanDerWaalsContact C-N 3.32Å
43	E	97.5	Very high	96.8	Very high	197 Å²	197	140.4 Å²	140.4	92%	0.921	72%	0.716	S	S	*	*	S	Bend	trans	-69.6	-30.5	176.6	-65.1	-179.2	179.7	0	0	112.8
44	Q	97.8	Very high	97	Very high	172 Å²	172	140 Å²	140	80%	0.804	71%	0.71	S	S	*	*			trans	-138.8	154.5	-177.3	-64.3	-177.4	-13.1	0	0	110.7	S42	S42-Q44 VanDerWaalsContact C-N 3.32Å
45	I	96.6	Very high	97.1	Very high	139 Å²	139	136.1 Å²	136.1	71%	0.713	70%	0.7	S	S	*	*			trans	-122	142.7	175.3	61.3	165.8	0	0	0	110.3	V47	I45-V47 HydrophobicContact CD1-CG1 3.85Å; I45-V47 HydrophobicContact CG1-CG1 4.01Å
46	I	97.5	Very high	97.2	Very high	175 Å²	175	135.2 Å²	135.2	90%	0.897	69%	0.688	S	S	*	*			trans	-81.6	122.2	173.7	-62.5	165.4	0	0	0	107.8
47	V	98.3	Very high	97.3	Very high	113 Å²	113	137.1 Å²	137.1	69%	0.685	68%	0.684	S	S	*	*			trans	-118.4	145.1	177.1	-62	0	0	0	0	110.7	I45	I45-V47 HydrophobicContact CD1-CG1 3.85Å; I45-V47 HydrophobicContact CG1-CG1 4.01Å
48	T	98.1	Very high	97.4	Very high	135 Å²	135	135 Å²	135	83%	0.828	67%	0.668	S	S	*	*			trans	-97.3	144.4	172	51.8	0	0	0	0	110.1	K50	T48-K50 PolarHBondContact O-N 3.24Å
49	E	97.6	Very high	97.4	Very high	117 Å²	117	132.2 Å²	132.2	55%	0.547	66%	0.662	S	S	.	*			trans	-68	126.6	175.4	-168.2	179.7	176.2	0	0	109.8	T51 R56	E49-T51 HydrophobicContact CG-CG2 4.14Å; E49-T51 WeakPolarHBondContact CG-OG1 3.21Å; E49-T51 PolarHBondContact O-N 3.24Å; E49-T51 PolarHBondContact OE1-OG1 3.43Å; E49-R56 WeakPolarHBondContact OE1-CD 3.2Å; E49-R56 WeakPolarHBondContact OE2-CD 3.39Å; E49-R56 IonicContact OE2-CZ 3.65Å; E49-R56 IonicContact OE2-NE 3.95Å; E49-R56 IonicContact OE2-NH1 2.62Å; E49-R56 PolarHBondContact OE2-NH1 3.46Å
50	K	97.5	Very high	97.5	Very high	209 Å²	209	127.5 Å²	127.5	91%	0.909	64%	0.64	S	S	*	*			trans	-72.8	-14.9	-178.1	65.6	179.8	179	-179.1	0	114.2	T48	T48-K50 PolarHBondContact O-N 3.24Å
51	T	97.6	Very high	97.5	Very high	57 Å²	57	123.4 Å²	123.4	35%	0.35	63%	0.627	S	S	.	*	S	Bend	trans	-74	135.9	-172.6	63.3	0	0	0	0	110.6	E49 I53	E49-T51 HydrophobicContact CG-CG2 4.14Å; E49-T51 WeakPolarHBondContact CG-OG1 3.21Å; E49-T51 PolarHBondContact O-N 3.24Å; E49-T51 PolarHBondContact OE1-OG1 3.43Å; T51-I53 PolarHBondContact O-N 2.89Å
52	N	98	Very high	97.4	Very high	94 Å²	94	125.1 Å²	125.1	50%	0.503	62%	0.617	S	S	.	*			trans	-60.3	135.7	169.9	-177	-82.3	0	0	0	110.5	L54 L55 R56	N52-L54 VanDerWaalsContact C-N 3.27Å; N52-L54 PolarHBondContact O-N 3.47Å; N52-L54 VanDerWaalsContact OD1-CB 3.31Å; N52-L54 WeakPolarHBondContact OD1-CB 3.35Å; N52-L54 PolarHBondContact OD1-N 2.99Å; N52-L55 HydrophobicContact CB-CB 4.37Å; N52-L55 HydrophobicContact CB-CD1 4.17Å; N52-L55 HydrophobicContact CB-CG 4.29Å; N52-L55 PolarHBondContact O-N 3.3Å; N52-R56 PolarHBondContact O-N 3.35Å
53	I	98.2	Very high	97.3	Very high	124 Å²	124	125.2 Å²	125.2	64%	0.636	61%	0.61	S	S	*	*	H	α-helix	trans	-60.9	-33.5	-174.9	58.2	170	0	0	0	113.4	T51 Y57	T51-I53 PolarHBondContact O-N 2.89Å; I53-Y57 PolarHBondContact O-N 3.18Å; I53-Y57 VanDerWaalsContact O-N 3.11Å
54	L	98.1	Very high	97.1	Very high	106 Å²	106	121.2 Å²	121.2	56%	0.555	59%	0.59	S	S	*	*	H	α-helix	trans	-70.3	-45.8	178.1	178.7	60.9	0	0	0	110.5	N52 Y57 L58	N52-L54 VanDerWaalsContact C-N 3.27Å; N52-L54 PolarHBondContact O-N 3.47Å; N52-L54 VanDerWaalsContact OD1-CB 3.31Å; N52-L54 WeakPolarHBondContact OD1-CB 3.35Å; N52-L54 PolarHBondContact OD1-N 2.99Å; L54-Y57 WeakPolarHBondContact O-CB 3.48Å; L54-Y57 PolarHBondContact O-N 3.44Å; L54-L58 HydrophobicContact CD1-CD1 4.34Å; L54-L58 HydrophobicContact CD1-CG 4.34Å; L54-L58 HydrophobicContact CG-CD1 4.19Å; L54-L58 WeakPolarHBondContact O-CG 3.35Å; L54-L58 PolarHBondContact O-N 3.14Å
55	L	98.1	Very high	96.9	Very high	97 Å²	97	119.4 Å²	119.4	51%	0.508	58%	0.579	S	S	.	*	H	α-helix	trans	-63	-43.2	177.7	-69	177.9	0	0	0	111.8	N52 Y57 L58 H59	N52-L55 HydrophobicContact CB-CB 4.37Å; N52-L55 HydrophobicContact CB-CD1 4.17Å; N52-L55 HydrophobicContact CB-CG 4.29Å; N52-L55 PolarHBondContact O-N 3.3Å; L55-Y57 VanDerWaalsContact C-N 3.29Å; L55-Y57 PolarHBondContact O-N 3.45Å; L55-L58 PolarHBondContact O-N 2.84Å; L55-H59 WeakPolarHBondContact O-CB 3.48Å; L55-H59 PolarHBondContact O-N 3.04Å
56	R	97.8	Very high	96.5	Very high	114 Å²	114	114.8 Å²	114.8	43%	0.43	56%	0.556	S	S	.	*	H	α-helix	trans	-57.2	-44.1	175	-172.8	175.4	63.7	-171.4	-2.5	111.3	E49 N52 Q60	E49-R56 WeakPolarHBondContact OE1-CD 3.2Å; E49-R56 WeakPolarHBondContact OE2-CD 3.39Å; E49-R56 IonicContact OE2-CZ 3.65Å; E49-R56 IonicContact OE2-NE 3.95Å; E49-R56 IonicContact OE2-NH1 2.62Å; E49-R56 PolarHBondContact OE2-NH1 3.46Å; N52-R56 PolarHBondContact O-N 3.35Å; R56-Q60 VanDerWaalsContact O-CB 3.26Å; R56-Q60 WeakPolarHBondContact O-CB 3.48Å; R56-Q60 PolarHBondContact O-N 2.94Å
57	Y	98.1	Very high	95.8	Very high	129 Å²	129	109.4 Å²	109.4	51%	0.506	54%	0.537	S	S	.	.	H	α-helix	trans	-63.2	-48.5	176.5	176.5	-97.9	0	0	0	112.3	I53 L54 L55 Q60 Q61	I53-Y57 PolarHBondContact O-N 3.18Å; I53-Y57 VanDerWaalsContact O-N 3.11Å; L54-Y57 WeakPolarHBondContact O-CB 3.48Å; L54-Y57 PolarHBondContact O-N 3.44Å; L55-Y57 VanDerWaalsContact C-N 3.29Å; L55-Y57 PolarHBondContact O-N 3.45Å; Y57-Q60 PolarHBondContact O-N 3.31Å; Y57-Q61 HydrophobicContact CD1-CG 4.24Å; Y57-Q61 HydrophobicContact CD2-CG 4.45Å; Y57-Q61 HydrophobicContact CE1-CG 3.76Å; Y57-Q61 HydrophobicContact CE2-CG 4.01Å; Y57-Q61 WeakPolarHBondContact O-CG 3.47Å; Y57-Q61 PolarHBondContact O-N 3Å
58	L	98.1	Very high	94.6	Very high	90 Å²	90	106.6 Å²	106.6	47%	0.471	53%	0.526	S	S	.	.	H	α-helix	trans	-62.6	-44.9	-179	-68.7	174.8	0	0	0	112	L54 L55 Q60 Q61 W62	L54-L58 HydrophobicContact CD1-CD1 4.34Å; L54-L58 HydrophobicContact CD1-CG 4.34Å; L54-L58 HydrophobicContact CG-CD1 4.19Å; L54-L58 WeakPolarHBondContact O-CG 3.35Å; L54-L58 PolarHBondContact O-N 3.14Å; L55-L58 PolarHBondContact O-N 2.84Å; L58-Q60 VanDerWaalsContact C-N 3.35Å; L58-Q60 PolarHBondContact O-N 3.25Å; L58-Q61 PolarHBondContact O-N 3.49Å; L58-W62 WeakPolarHBondContact O-CB 3.43Å; L58-W62 PolarHBondContact O-N 2.91Å
59	H	97	Very high	93.1	Very high	119 Å²	119	105.8 Å²	105.8	55%	0.551	51%	0.511	S	S	*	.	H	α-helix	trans	-59.9	-45.4	174	-72.9	178.9	0	0	0	111.4	L55 Q61 W62 D63	L55-H59 WeakPolarHBondContact O-CB 3.48Å; L55-H59 PolarHBondContact O-N 3.04Å; H59-Q61 VanDerWaalsContact C-N 3.32Å; H59-Q61 PolarHBondContact O-N 3.15Å; H59-W62 WeakPolarHBondContact O-CB 3.46Å; H59-W62 PolarHBondContact O-N 3.35Å; H59-W62 VanDerWaalsContact O-N 3.15Å; H59-D63 WeakPolarHBondContact O-CB 3.42Å; H59-D63 VanDerWaalsContact O-CG 3.3Å; H59-D63 PolarHBondContact O-N 3.26Å
60	Q	96.6	Very high	91.6	Very high	97 Å²	97	107.2 Å²	107.2	45%	0.453	52%	0.515	S	S	.	.	H	α-helix	trans	-61.1	-40	178.4	-170.1	-175.6	25.9	0	0	112.4	R56 Y57 L58 K64	R56-Q60 VanDerWaalsContact O-CB 3.26Å; R56-Q60 WeakPolarHBondContact O-CB 3.48Å; R56-Q60 PolarHBondContact O-N 2.94Å; Y57-Q60 PolarHBondContact O-N 3.31Å; L58-Q60 VanDerWaalsContact C-N 3.35Å; L58-Q60 PolarHBondContact O-N 3.25Å; Q60-K64 HydrophobicContact CG-CD 4.36Å; Q60-K64 WeakPolarHBondContact O-CB 3.26Å; Q60-K64 WeakPolarHBondContact O-CD 3.39Å; Q60-K64 WeakPolarHBondContact O-CG 3.39Å; Q60-K64 PolarHBondContact O-N 3.38Å; Q60-K64 VanDerWaalsContact O-N 3.14Å
61	Q	96.3	Very high	89.8	Confident	82 Å²	82	106.1 Å²	106.1	38%	0.383	51%	0.506	S	S	.	.	H	α-helix	trans	-66.9	-41.5	175.5	-70.2	-61.6	-34.8	0	0	111.7	Y57 L58 H59 K65	Y57-Q61 HydrophobicContact CD1-CG 4.24Å; Y57-Q61 HydrophobicContact CD2-CG 4.45Å; Y57-Q61 HydrophobicContact CE1-CG 3.76Å; Y57-Q61 HydrophobicContact CE2-CG 4.01Å; Y57-Q61 WeakPolarHBondContact O-CG 3.47Å; Y57-Q61 PolarHBondContact O-N 3Å; L58-Q61 PolarHBondContact O-N 3.49Å; H59-Q61 VanDerWaalsContact C-N 3.32Å; H59-Q61 PolarHBondContact O-N 3.15Å; Q61-K65 WeakPolarHBondContact O-CB 3.49Å; Q61-K65 PolarHBondContact O-N 2.92Å
62	W	95.1	Very high	87.9	Confident	161 Å²	161	108 Å²	108	61%	0.61	51%	0.513	S	S	*	.	H	α-helix	trans	-62.7	-49	177.7	-178.3	-98.4	0	0	0	112.1	L58 H59 K64 K65 N66	L58-W62 WeakPolarHBondContact O-CB 3.43Å; L58-W62 PolarHBondContact O-N 2.91Å; H59-W62 WeakPolarHBondContact O-CB 3.46Å; H59-W62 PolarHBondContact O-N 3.35Å; H59-W62 VanDerWaalsContact O-N 3.15Å; W62-K64 VanDerWaalsContact C-N 3.35Å; W62-K64 PolarHBondContact O-N 2.94Å; W62-K65 PolarHBondContact O-N 2.95Å; W62-N66 VanDerWaalsContact CD1-ND2 3.28Å; W62-N66 PolarHBondContact NE1-ND2 3.2Å; W62-N66 PolarHBondContact O-N 3.26Å; W62-N66 PolarHBondContact O-ND2 2.96Å
63	D	94	Very high	85.9	Confident	103 Å²	103	109 Å²	109	55%	0.551	52%	0.515	S	S	*	.	H	α-helix	trans	-62.5	-42.1	179.7	-68.6	-20.8	0	0	0	111.4	H59 K65 N66 A67	H59-D63 WeakPolarHBondContact O-CB 3.42Å; H59-D63 VanDerWaalsContact O-CG 3.3Å; H59-D63 PolarHBondContact O-N 3.26Å; D63-K65 PolarHBondContact O-N 3.11Å; D63-N66 PolarHBondContact O-N 3.25Å; D63-A67 WeakPolarHBondContact O-CB 3.4Å; D63-A67 PolarHBondContact O-N 3.35Å
64	K	93.9	Very high	83.8	Confident	113 Å²	113	109.1 Å²	109.1	49%	0.491	51%	0.513	S	S	.	.	H	α-helix	trans	-59.3	-45.1	173.7	-76.7	172.9	-178.7	176	0	112.1	Q60 W62 N66 A67 A68	Q60-K64 HydrophobicContact CG-CD 4.36Å; Q60-K64 WeakPolarHBondContact O-CB 3.26Å; Q60-K64 WeakPolarHBondContact O-CD 3.39Å; Q60-K64 WeakPolarHBondContact O-CG 3.39Å; Q60-K64 PolarHBondContact O-N 3.38Å; Q60-K64 VanDerWaalsContact O-N 3.14Å; W62-K64 VanDerWaalsContact C-N 3.35Å; W62-K64 PolarHBondContact O-N 2.94Å; K64-N66 VanDerWaalsContact C-N 3.32Å; K64-N66 PolarHBondContact O-N 2.62Å; K64-A67 PolarHBondContact O-N 3.35Å; K64-A68 PolarHBondContact O-N 3.43Å
65	K	91.9	Very high	81.6	Confident	133 Å²	133	110.1 Å²	110.1	58%	0.578	52%	0.515	S	S	*	.	H	α-helix	trans	-64.3	-36.9	179.1	-174.3	175.6	-178.3	177.2	0	112	Q61 W62 D63 K69	Q61-K65 WeakPolarHBondContact O-CB 3.49Å; Q61-K65 PolarHBondContact O-N 2.92Å; W62-K65 PolarHBondContact O-N 2.95Å; D63-K65 PolarHBondContact O-N 3.11Å; K65-K69 PolarHBondContact O-N 3.45Å
66	N	88.2	Confident	79.4	Confident	43 Å²	43	110.2 Å²	110.2	23%	0.23	52%	0.519	C	S	.	.	H	α-helix	trans	-80.5	-30.4	179.5	-68.6	-29.8	0	0	0	113.1	W62 D63 K64 A68 K69 K70	W62-N66 VanDerWaalsContact CD1-ND2 3.28Å; W62-N66 PolarHBondContact NE1-ND2 3.2Å; W62-N66 PolarHBondContact O-N 3.26Å; W62-N66 PolarHBondContact O-ND2 2.96Å; D63-N66 PolarHBondContact O-N 3.25Å; K64-N66 VanDerWaalsContact C-N 3.32Å; K64-N66 PolarHBondContact O-N 2.62Å; N66-A68 VanDerWaalsContact C-N 3.28Å; N66-A68 PolarHBondContact O-N 2.94Å; N66-K69 PolarHBondContact O-N 3.36Å; N66-K70 PolarHBondContact O-N 3.32Å
67	A	84.6	Confident	77.2	Confident	62 Å²	62	110.2 Å²	110.2	51%	0.512	52%	0.524	S	S	.	.	H	α-helix	trans	-61.6	-38.1	171.6	0	0	0	0	0	111.7	D63 K64 K70 R71	D63-A67 WeakPolarHBondContact O-CB 3.4Å; D63-A67 PolarHBondContact O-N 3.35Å; K64-A67 PolarHBondContact O-N 3.35Å; A67-K70 PolarHBondContact O-N 2.97Å; A67-R71 PolarHBondContact O-N 2.96Å
68	A	72.6	Confident	75.2	Confident	54 Å²	54	110.3 Å²	110.3	45%	0.446	53%	0.532	S	S	.	.	H	α-helix	trans	-62.5	-43.8	173.5	0	0	0	0	0	112	K64 N66 K70 R71 D72	K64-A68 PolarHBondContact O-N 3.43Å; N66-A68 VanDerWaalsContact C-N 3.28Å; N66-A68 PolarHBondContact O-N 2.94Å; A68-K70 PolarHBondContact O-N 3.29Å; A68-R71 PolarHBondContact O-N 3.05Å; A68-D72 PolarHBondContact O-N 3.43Å
69	K	66.1	Low	72.9	Confident	118 Å²	118	113.7 Å²	113.7	51%	0.513	55%	0.545	S	S	.	.	H	α-helix	trans	-63.9	-37.2	178.2	-70.3	-179.5	174.5	-171.1	0	113.5	K65 N66 R71 D72 Q73	K65-K69 PolarHBondContact O-N 3.45Å; N66-K69 PolarHBondContact O-N 3.36Å; K69-R71 VanDerWaalsContact C-N 3.33Å; K69-D72 PolarHBondContact O-N 3.31Å; K69-Q73 WeakPolarHBondContact O-CB 3.31Å; K69-Q73 PolarHBondContact O-N 3.36Å
70	K	66.3	Low	70.5	Confident	146 Å²	146	109.8 Å²	109.8	64%	0.635	54%	0.538	S	S	*	.	H	α-helix	trans	-65	-37	177.9	-72.7	-175.2	175	-169.8	0	112.2	N66 A67 A68 E74	N66-K70 PolarHBondContact O-N 3.32Å; A67-K70 PolarHBondContact O-N 2.97Å; A68-K70 PolarHBondContact O-N 3.29Å; K70-E74 WeakPolarHBondContact O-CG 3.49Å; K70-E74 PolarHBondContact O-N 2.83Å; K70-E74 VanDerWaalsContact O-N 3.13Å
71	R	59.8	Low	68.1	Low	187 Å²	187	113.4 Å²	113.4	71%	0.706	56%	0.555	S	S	*	*	H	α-helix	trans	-66.8	-43	176.3	-174.7	179.9	-66.8	171.1	-1.6	112.4	A67 A68 K69 Q75	A67-R71 PolarHBondContact O-N 2.96Å; A68-R71 PolarHBondContact O-N 3.05Å; K69-R71 VanDerWaalsContact C-N 3.33Å; R71-Q75 PolarHBondContact O-N 3.15Å
72	D	56.8	Low	65.7	Low	96 Å²	96	117.3 Å²	117.3	51%	0.513	58%	0.578	S	S	.	*	H	α-helix	trans	-71.4	-34.6	178.5	-67.8	-10.9	0	0	0	111.3	A68 K69 Q75 V76	A68-D72 PolarHBondContact O-N 3.43Å; K69-D72 PolarHBondContact O-N 3.31Å; D72-Q75 PolarHBondContact O-N 3.04Å; D72-V76 WeakPolarHBondContact O-CG2 3.37Å; D72-V76 PolarHBondContact O-N 2.89Å
73	Q	56.5	Low	63.5	Low	114 Å²	114	114 Å²	114	53%	0.533	58%	0.579	S	S	.	*	H	α-helix	trans	-66.6	-36	177.6	-168.8	159	20.4	0	0	112.3	K69 Q75 V76 E77	K69-Q73 WeakPolarHBondContact O-CB 3.31Å; K69-Q73 PolarHBondContact O-N 3.36Å; Q73-Q75 VanDerWaalsContact C-N 3.34Å; Q73-Q75 PolarHBondContact O-N 3.21Å; Q73-V76 PolarHBondContact O-N 3.38Å; Q73-E77 WeakPolarHBondContact O-CB 3.47Å; Q73-E77 WeakPolarHBondContact O-CG 3.39Å; Q73-E77 PolarHBondContact O-N 3.26Å
74	E	53.6	Low	61.1	Low	128 Å²	128	113.4 Å²	113.4	60%	0.598	59%	0.589	S	S	*	*	H	α-helix	trans	-64.3	-35.9	171.6	-75.5	173.4	-178.6	0	0	112.3	K70 I78	K70-E74 WeakPolarHBondContact O-CG 3.49Å; K70-E74 PolarHBondContact O-N 2.83Å; K70-E74 VanDerWaalsContact O-N 3.13Å; E74-I78 VanDerWaalsContact O-CD1 3.31Å; E74-I78 WeakPolarHBondContact O-CD1 3.48Å; E74-I78 WeakPolarHBondContact O-CG1 3.48Å; E74-I78 PolarHBondContact O-N 3.41Å
75	Q	53.2	Low	58.9	Low	126 Å²	126	113.4 Å²	113.4	59%	0.589	60%	0.601	S	S	*	*	H	α-helix	trans	-70.5	-40.4	173.7	-82	-176.4	-16.7	0	0	112.6	R71 D72 Q73 I78 E79	R71-Q75 PolarHBondContact O-N 3.15Å; D72-Q75 PolarHBondContact O-N 3.04Å; Q73-Q75 VanDerWaalsContact C-N 3.34Å; Q73-Q75 PolarHBondContact O-N 3.21Å; Q75-I78 PolarHBondContact O-N 3.15Å; Q75-E79 PolarHBondContact O-N 3.43Å; Q75-E79 VanDerWaalsContact O-N 3.15Å
76	V	51.9	Low	57.3	Low	100 Å²	100	113 Å²	113	61%	0.606	61%	0.611	S	S	*	*	H	α-helix	trans	-71.7	-31.8	179	174.5	0	0	0	0	112	D72 Q73 G80	D72-V76 WeakPolarHBondContact O-CG2 3.37Å; D72-V76 PolarHBondContact O-N 2.89Å; Q73-V76 PolarHBondContact O-N 3.38Å; V76-G80 WeakPolarHBondContact O-CA 3.36Å; V76-G80 PolarHBondContact O-N 2.68Å
77	E	51.5	Low	55.9	Low	113 Å²	113	122.3 Å²	122.3	53%	0.528	64%	0.643	S	S	.	*	H	α-helix	trans	-68.1	-39.7	173.4	-79.4	177.6	178.9	0	0	111.5	Q73 E79 G80 E81	Q73-E77 WeakPolarHBondContact O-CB 3.47Å; Q73-E77 WeakPolarHBondContact O-CG 3.39Å; Q73-E77 PolarHBondContact O-N 3.26Å; E77-E79 PolarHBondContact O-N 3.29Å; E77-G80 PolarHBondContact O-N 3.3Å; E77-E81 WeakPolarHBondContact O-CG 3.36Å; E77-E81 PolarHBondContact O-N 3.15Å; E77-E81 VanDerWaalsContact O-N 3.1Å
78	I	54.7	Low	54.7	Low	132 Å²	132	129.4 Å²	129.4	68%	0.677	66%	0.663	S	S	*	*	H	α-helix	trans	-65.9	-36.5	176.1	-64.4	165.3	0	0	0	111.8	E74 Q75	E74-I78 VanDerWaalsContact O-CD1 3.31Å; E74-I78 WeakPolarHBondContact O-CD1 3.48Å; E74-I78 WeakPolarHBondContact O-CG1 3.48Å; E74-I78 PolarHBondContact O-N 3.41Å; Q75-I78 PolarHBondContact O-N 3.15Å
79	E	49.5	Very low	54.3	Low	160 Å²	160	134.4 Å²	134.4	75%	0.748	68%	0.68	S	S	*	*	H	α-helix	trans	-81.1	-25.7	176.2	-67.7	-174.6	169.6	0	0	113	Q75 E77	Q75-E79 PolarHBondContact O-N 3.43Å; Q75-E79 VanDerWaalsContact O-N 3.15Å; E77-E79 PolarHBondContact O-N 3.29Å
80	G	47.4	Very low	53.6	Low	38 Å²	38	132.9 Å²	132.9	39%	0.392	69%	0.69	S	S	.	*	H	α-helix	trans	-84.9	-20.2	-177.3	0	0	0	0	0	115.5	V76 E77 N82 S83	V76-G80 WeakPolarHBondContact O-CA 3.36Å; V76-G80 PolarHBondContact O-N 2.68Å; E77-G80 PolarHBondContact O-N 3.3Å; G80-N82 PolarHBondContact O-N 2.69Å; G80-S83 PolarHBondContact O-N 3Å
81	E	45.9	Very low	53.1	Low	173 Å²	173	137.8 Å²	137.8	81%	0.808	70%	0.704	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.1	-12	176.9	-81.9	-173.5	162.1	0	0	113.9	E77	E77-E81 WeakPolarHBondContact O-CG 3.36Å; E77-E81 PolarHBondContact O-N 3.15Å; E77-E81 VanDerWaalsContact O-N 3.1Å
82	N	46.7	Very low	52.8	Low	163 Å²	163	134.7 Å²	134.7	87%	0.872	71%	0.706	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.2	7.3	176.4	-130.7	-11.5	0	0	0	114.4	G80	G80-N82 PolarHBondContact O-N 2.69Å
83	S	47.8	Very low	52.3	Low	91 Å²	91	137.1 Å²	137.1	64%	0.636	72%	0.719	S	S	*	*	S	Bend	trans	-126.4	112.2	168.5	84	0	0	0	0	110.3	G80	G80-S83 PolarHBondContact O-N 3Å
84	A	43.1	Very low	52.3	Low	92 Å²	92	137.1 Å²	137.1	76%	0.76	73%	0.732	S	S	*	*			trans	-54.4	143.8	178.9	0	0	0	0	0	111.6
85	P	48.4	Very low	52.1	Low	113 Å²	113	138.4 Å²	138.4	73%	0.734	74%	0.738	S	S	*	*			trans	-67.8	138.5	-174.6	-10.3	23.8	0	0	0	111.2	R87	P85-R87 PolarHBondContact O-N 3.19Å; P85-R87 VanDerWaalsContact O-N 3.11Å
86	P	57.9	Low	51.6	Low	124 Å²	124	137.6 Å²	137.6	81%	0.805	74%	0.738	S	S	*	*			trans	-70.3	110.9	176.3	28	-31.2	0	0	0	109.5	K88	P86-K88 PolarHBondContact O-N 2.69Å
87	R	60	Low	51.4	Low	238 Å²	238	140.1 Å²	140.1	90%	0.898	75%	0.745	S	S	*	*			trans	-66.5	113.3	171.9	-74.3	-175.9	-96.1	-170.8	-5.4	109.1	P85 I89	P85-R87 PolarHBondContact O-N 3.19Å; P85-R87 VanDerWaalsContact O-N 3.11Å; R87-I89 PolarHBondContact O-N 3.36Å
88	K	58.8	Low	51.1	Low	211 Å²	211	143 Å²	143	92%	0.917	76%	0.764	S	S	*	*	P	Polyproline II helix	trans	-69.3	122.5	171.9	-73.9	-175.2	176.5	-178.8	0	109.7	P86	P86-K88 PolarHBondContact O-N 2.69Å
89	I	63.3	Low	50.9	Low	160 Å²	160	144.7 Å²	144.7	82%	0.821	77%	0.769	S	S	*	*	P	Polyproline II helix	trans	-93.5	128.5	170.9	-54.5	169	0	0	0	107.6	R87	R87-I89 PolarHBondContact O-N 3.36Å
90	A	51.4	Low	50.8	Low	86 Å²	86	143.8 Å²	143.8	71%	0.711	77%	0.769	S	S	*	*	P	Polyproline II helix	trans	-74.5	127.3	174.5	0	0	0	0	0	110	T92	A90-T92 PolarHBondContact O-N 2.75Å
91	R	57.2	Low	50.5	Low	248 Å²	248	152 Å²	152	94%	0.936	81%	0.812	S	S	*	*			trans	-82.4	105.1	168	-79	-176.9	170.6	112.8	-2.3	107.9	D93	R91-D93 PolarHBondContact O-N 2.64Å
92	T	53.6	Low	50.7	Low	122 Å²	122	151 Å²	151	75%	0.748	81%	0.813	S	S	*	*			trans	-76.5	114.4	165.8	50.2	0	0	0	0	107.9	A90	A90-T92 PolarHBondContact O-N 2.75Å
93	D	45.3	Very low	50.9	Low	147 Å²	147	150.4 Å²	150.4	79%	0.786	81%	0.809	S	S	*	*			trans	-61.1	132.3	168	-123.5	-24.3	0	0	0	108.7	R91	R91-D93 PolarHBondContact O-N 2.64Å
94	S	57.9	Low	51.1	Low	115 Å²	115	153.7 Å²	153.7	80%	0.804	82%	0.819	S	S	*	*			trans	-123.9	80.6	170.9	-64.7	0	0	0	0	107.8
95	Q	47.8	Very low	51.6	Low	155 Å²	155	157.3 Å²	157.3	72%	0.724	82%	0.822	S	S	*	*			trans	-107	140.9	152.2	-87.4	-171.3	-78.2	0	0	105.1
96	D	43.4	Very low	51.8	Low	109 Å²	109	160.1 Å²	160.1	58%	0.583	83%	0.828	S	S	*	*			cis	-173.6	162	14.6	-129.6	-36	0	0	0	107.3
97	M	47.3	Very low	51.4	Low	152 Å²	152	162.5 Å²	162.5	75%	0.749	83%	0.83	S	S	*	*			trans	63.6	118.1	155.9	-54.5	-54.5	-170.9	0	0	120.8
98	N	45.8	Very low	50.8	Low	174 Å²	174	157.1 Å²	157.1	93%	0.93	83%	0.825	S	S	*	*			trans	-135.1	110.6	133.4	-106.6	6.2	0	0	0	107.9
99	E	50.9	Low	50.1	Low	167 Å²	167	152.9 Å²	152.9	78%	0.78	82%	0.817	S	S	*	*			trans	-84	165.2	167.8	-143.4	176.2	-174.9	0	0	109.6
100	D	47.1	Very low	49.1	Very low	141 Å²	141	152.3 Å²	152.3	75%	0.754	82%	0.817	S	S	*	*			trans	84.5	91.4	166.5	-59.8	-26.6	0	0	0	119.9
101	T	40.9	Very low	48.8	Very low	212 Å²	212	158.4 Å²	158.4	100%	1.301	83%	0.827	S	S	*	*				158.8	0	104.9	-51.1	0	0	0	0	110.5

Retrieved 101 of 101 residues in 123.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).