A0A7N9CHX2_MACFA Loading...

Small integral membrane protein 5

AlphaFold DB , UniProt , Accession A0A7N9CHX2, Species MACFA (Macaca fascicularis, Crab-eating macaque), Gene SMIM5, Length 77 aa.

						>A0A7N9CHX2_MACFA|A0A7N9CHX2|SMIM5
MAATDFVQEMRAVGERLLLKLQRLPQAEPVEIVAFSVIVLFTATVLLLLLIACSCCCTHCCCPEQRGRKVQVQPTPP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.6	Low	72.6	Confident	208 Å²	208	122.5 Å²	122.5	100%	1.025	64%	0.642	S	S	*	*				0	-30.9	0	-67	172.5	-171.5	0	0	112.5	A3 T4	M1-A3 PolarHBondContact O-N 3.22Å; M1-T4 PolarHBondContact O-OG1 3.49Å
2	A	61.9	Low	73.5	Confident	82 Å²	82	116.3 Å²	116.3	68%	0.678	62%	0.62	S	S	*	*	H	α-helix	trans	-68	-30.9	173.9	0	0	0	0	0	115.4	T4 D5 F6	A2-T4 VanDerWaalsContact C-N 3.3Å; A2-T4 PolarHBondContact O-N 3.08Å; A2-D5 PolarHBondContact O-N 3.32Å; A2-F6 PolarHBondContact O-N 3.23Å
3	A	61.5	Low	74.5	Confident	74 Å²	74	112.7 Å²	112.7	61%	0.612	61%	0.605	S	S	*	*	H	α-helix	trans	-67.3	-29.1	-179.7	0	0	0	0	0	113.3	M1 V7	M1-A3 PolarHBondContact O-N 3.22Å; A3-V7 VanDerWaalsContact O-CG2 3.27Å; A3-V7 WeakPolarHBondContact O-CG2 3.47Å; A3-V7 PolarHBondContact O-N 3.43Å
4	T	70.6	Confident	75.1	Confident	97 Å²	97	107 Å²	107	60%	0.595	59%	0.586	S	S	*	*	H	α-helix	trans	-74.8	-37.9	179.1	42.7	0	0	0	0	111.8	M1 A2 V7 Q8	M1-T4 PolarHBondContact O-OG1 3.49Å; A2-T4 VanDerWaalsContact C-N 3.3Å; A2-T4 PolarHBondContact O-N 3.08Å; T4-V7 PolarHBondContact O-N 3.28Å; T4-Q8 PolarHBondContact O-N 3.44Å; T4-Q8 VanDerWaalsContact O-N 3.09Å
5	D	70.4	Confident	75.7	Confident	108 Å²	108	109.3 Å²	109.3	58%	0.578	59%	0.591	S	S	*	*	H	α-helix	trans	-65.1	-41.1	173.9	-76.2	-47.9	0	0	0	111.5	A2 V7 Q8 E9	A2-D5 PolarHBondContact O-N 3.32Å; D5-V7 PolarHBondContact O-N 2.66Å; D5-Q8 WeakPolarHBondContact O-CB 3.41Å; D5-Q8 PolarHBondContact O-N 3.16Å; D5-Q8 VanDerWaalsContact O-N 3.13Å; D5-E9 PolarHBondContact O-N 3.08Å
6	F	75.1	Confident	76.1	Confident	133 Å²	133	114.5 Å²	114.5	58%	0.583	60%	0.6	S	S	*	*	H	α-helix	trans	-64.7	-39.4	178.5	-152.3	-93.7	0	0	0	112.6	A2 Q8 E9 M10	A2-F6 PolarHBondContact O-N 3.23Å; F6-Q8 VanDerWaalsContact C-N 3.28Å; F6-Q8 PolarHBondContact O-N 3.16Å; F6-E9 PolarHBondContact O-N 2.99Å; F6-M10 HydrophobicContact CD1-CG 3.91Å; F6-M10 HydrophobicContact CE1-CE 4.49Å; F6-M10 HydrophobicContact CE1-CG 3.97Å; F6-M10 HydrophobicContact CE1-SD 4.31Å; F6-M10 VanDerWaalsContact O-CB 3.29Å; F6-M10 WeakPolarHBondContact O-CB 3.41Å; F6-M10 WeakPolarHBondContact O-CG 3.47Å; F6-M10 PolarHBondContact O-N 3.19Å
7	V	79.1	Confident	76.4	Confident	80 Å²	80	113.6 Å²	113.6	49%	0.485	60%	0.595	S	S	.	*	H	α-helix	trans	-65.2	-35.7	174.3	171	0	0	0	0	110.9	A3 T4 D5 R11	A3-V7 VanDerWaalsContact O-CG2 3.27Å; A3-V7 WeakPolarHBondContact O-CG2 3.47Å; A3-V7 PolarHBondContact O-N 3.43Å; T4-V7 PolarHBondContact O-N 3.28Å; D5-V7 PolarHBondContact O-N 2.66Å; V7-R11 WeakPolarHBondContact O-CG 3.38Å; V7-R11 PolarHBondContact O-N 3.48Å
8	Q	81.5	Confident	76.6	Confident	139 Å²	139	113.1 Å²	113.1	65%	0.65	59%	0.592	S	S	*	*	H	α-helix	trans	-71.5	-40.9	178.4	-166.9	139.6	-40.6	0	0	112	T4 D5 F6 R11 A12	T4-Q8 PolarHBondContact O-N 3.44Å; T4-Q8 VanDerWaalsContact O-N 3.09Å; D5-Q8 WeakPolarHBondContact O-CB 3.41Å; D5-Q8 PolarHBondContact O-N 3.16Å; D5-Q8 VanDerWaalsContact O-N 3.13Å; F6-Q8 VanDerWaalsContact C-N 3.28Å; F6-Q8 PolarHBondContact O-N 3.16Å; Q8-R11 PolarHBondContact O-N 3.35Å; Q8-A12 PolarHBondContact O-N 3.44Å
9	E	79.1	Confident	76.6	Confident	130 Å²	130	113 Å²	113	61%	0.607	59%	0.592	S	S	*	*	H	α-helix	trans	-64.7	-43.4	171.8	-72.2	-158.8	165.3	0	0	111.9	D5 F6 R11 A12 V13	D5-E9 PolarHBondContact O-N 3.08Å; F6-E9 PolarHBondContact O-N 2.99Å; E9-R11 VanDerWaalsContact C-N 3.29Å; E9-R11 PolarHBondContact O-N 3.33Å; E9-A12 PolarHBondContact O-N 2.85Å; E9-A12 VanDerWaalsContact O-N 3.16Å; E9-V13 WeakPolarHBondContact O-CB 3.48Å; E9-V13 VanDerWaalsContact O-CG2 3.29Å; E9-V13 WeakPolarHBondContact O-CG2 3.39Å; E9-V13 PolarHBondContact O-N 3.07Å
10	M	82.1	Confident	76.4	Confident	108 Å²	108	115.2 Å²	115.2	53%	0.532	60%	0.596	S	S	.	*	H	α-helix	trans	-59.9	-38.6	174.8	-75.8	-79.4	100.6	0	0	112.1	F6 G14	F6-M10 HydrophobicContact CD1-CG 3.91Å; F6-M10 HydrophobicContact CE1-CE 4.49Å; F6-M10 HydrophobicContact CE1-CG 3.97Å; F6-M10 HydrophobicContact CE1-SD 4.31Å; F6-M10 VanDerWaalsContact O-CB 3.29Å; F6-M10 WeakPolarHBondContact O-CB 3.41Å; F6-M10 WeakPolarHBondContact O-CG 3.47Å; F6-M10 PolarHBondContact O-N 3.19Å; M10-G14 WeakPolarHBondContact O-CA 3.29Å; M10-G14 PolarHBondContact O-N 3.31Å
11	R	82.6	Confident	76.1	Confident	189 Å²	189	115.1 Å²	115.1	71%	0.713	60%	0.596	S	S	*	*	H	α-helix	trans	-65.3	-45.1	172.8	-78.6	-172.8	-167.7	-130.1	6.7	112	V7 Q8 E9 G14 E15	V7-R11 WeakPolarHBondContact O-CG 3.38Å; V7-R11 PolarHBondContact O-N 3.48Å; Q8-R11 PolarHBondContact O-N 3.35Å; E9-R11 VanDerWaalsContact C-N 3.29Å; E9-R11 PolarHBondContact O-N 3.33Å; R11-G14 PolarHBondContact O-N 2.89Å; R11-E15 PolarHBondContact O-N 2.73Å
12	A	83.6	Confident	76.7	Confident	47 Å²	47	111 Å²	111	39%	0.388	58%	0.575	S	S	.	*	H	α-helix	trans	-65.8	-39.9	-179.6	0	0	0	0	0	112.4	Q8 E9 R16	Q8-A12 PolarHBondContact O-N 3.44Å; E9-A12 PolarHBondContact O-N 2.85Å; E9-A12 VanDerWaalsContact O-N 3.16Å; A12-R16 WeakPolarHBondContact O-CG 3.33Å; A12-R16 PolarHBondContact O-N 3.26Å; A12-R16 VanDerWaalsContact O-N 3.15Å
13	V	86.3	Confident	76.9	Confident	70 Å²	70	116.9 Å²	116.9	42%	0.424	58%	0.579	S	S	.	*	H	α-helix	trans	-66.9	-41.9	173	174.1	0	0	0	0	110.2	E9 R16 L17	E9-V13 WeakPolarHBondContact O-CB 3.48Å; E9-V13 VanDerWaalsContact O-CG2 3.29Å; E9-V13 WeakPolarHBondContact O-CG2 3.39Å; E9-V13 PolarHBondContact O-N 3.07Å; V13-R16 PolarHBondContact O-N 2.78Å; V13-L17 HydrophobicContact CG1-CD1 3.83Å; V13-L17 HydrophobicContact CG1-CG 4.4Å; V13-L17 WeakPolarHBondContact O-CB 3.28Å; V13-L17 WeakPolarHBondContact O-CG 2.68Å; V13-L17 PolarHBondContact O-N 3.43Å
14	G	83.4	Confident	76.9	Confident	33 Å²	33	119 Å²	119	34%	0.34	58%	0.58	S	S	.	*	H	α-helix	trans	-58.4	-48.2	175.3	0	0	0	0	0	112.8	M10 R11 R16 L17 L18	M10-G14 WeakPolarHBondContact O-CA 3.29Å; M10-G14 PolarHBondContact O-N 3.31Å; R11-G14 PolarHBondContact O-N 2.89Å; G14-R16 PolarHBondContact O-N 3.12Å; G14-L17 PolarHBondContact O-N 3.43Å; G14-L18 VanDerWaalsContact O-CB 3.26Å; G14-L18 WeakPolarHBondContact O-CB 3.04Å; G14-L18 PolarHBondContact O-N 3.18Å
15	E	83.5	Confident	76.5	Confident	141 Å²	141	116.8 Å²	116.8	66%	0.659	57%	0.567	S	S	*	*	H	α-helix	trans	-63.3	-41.6	176.8	-82.2	-160.1	145.5	0	0	112.5	R11 L17 L18 L19	R11-E15 PolarHBondContact O-N 2.73Å; E15-L17 VanDerWaalsContact C-N 3.34Å; E15-L17 PolarHBondContact O-N 3.48Å; E15-L18 PolarHBondContact O-N 2.83Å; E15-L19 WeakPolarHBondContact O-CB 3.17Å; E15-L19 WeakPolarHBondContact O-CG 3.26Å; E15-L19 PolarHBondContact O-N 3.48Å
16	R	82.3	Confident	75.8	Confident	193 Å²	193	119.4 Å²	119.4	73%	0.728	58%	0.576	S	S	*	*	H	α-helix	trans	-64.3	-40.2	176.8	-74.4	179.5	-178.8	-159.2	2.1	112.1	A12 V13 G14 K20	A12-R16 WeakPolarHBondContact O-CG 3.33Å; A12-R16 PolarHBondContact O-N 3.26Å; A12-R16 VanDerWaalsContact O-N 3.15Å; V13-R16 PolarHBondContact O-N 2.78Å; G14-R16 PolarHBondContact O-N 3.12Å; R16-K20 WeakPolarHBondContact O-CG 3.38Å; R16-K20 PolarHBondContact O-N 3.5Å
17	L	81.8	Confident	75	Confident	99 Å²	99	116.8 Å²	116.8	52%	0.518	58%	0.579	S	S	.	*	H	α-helix	trans	-66.7	-44.4	175.2	-75.6	168.6	0	0	0	110.9	V13 G14 E15 L19 K20 L21	V13-L17 HydrophobicContact CG1-CD1 3.83Å; V13-L17 HydrophobicContact CG1-CG 4.4Å; V13-L17 WeakPolarHBondContact O-CB 3.28Å; V13-L17 WeakPolarHBondContact O-CG 2.68Å; V13-L17 PolarHBondContact O-N 3.43Å; G14-L17 PolarHBondContact O-N 3.43Å; E15-L17 VanDerWaalsContact C-N 3.34Å; E15-L17 PolarHBondContact O-N 3.48Å; L17-L19 PolarHBondContact O-N 3.17Å; L17-K20 PolarHBondContact O-N 3.43Å; L17-L21 VanDerWaalsContact O-CB 3.26Å; L17-L21 WeakPolarHBondContact O-CB 3.44Å; L17-L21 PolarHBondContact O-N 2.88Å
18	L	79.2	Confident	73.9	Confident	104 Å²	104	118.2 Å²	118.2	55%	0.545	58%	0.58	S	S	.	*	H	α-helix	trans	-62	-43	178.6	-166	150.5	0	0	0	111.3	G14 E15 K20 L21 Q22	G14-L18 VanDerWaalsContact O-CB 3.26Å; G14-L18 WeakPolarHBondContact O-CB 3.04Å; G14-L18 PolarHBondContact O-N 3.18Å; E15-L18 PolarHBondContact O-N 2.83Å; L18-K20 VanDerWaalsContact C-N 3.34Å; L18-K20 PolarHBondContact O-N 3.49Å; L18-L21 CarbonylContact O-C 3.42Å; L18-L21 PolarHBondContact O-N 3.41Å; L18-Q22 WeakPolarHBondContact O-CB 3.48Å; L18-Q22 PolarHBondContact O-N 2.93Å
19	L	76.6	Confident	72.9	Confident	112 Å²	112	116.4 Å²	116.4	59%	0.586	58%	0.58	S	S	*	*	H	α-helix	trans	-62.6	-38.7	174.5	-77.2	168.3	0	0	0	112.5	E15 L17 Q22 R23	E15-L19 WeakPolarHBondContact O-CB 3.17Å; E15-L19 WeakPolarHBondContact O-CG 3.26Å; E15-L19 PolarHBondContact O-N 3.48Å; L17-L19 PolarHBondContact O-N 3.17Å; L19-Q22 PolarHBondContact O-N 2.75Å; L19-R23 WeakPolarHBondContact O-CB 3.3Å; L19-R23 PolarHBondContact O-N 3.26Å; L19-R23 VanDerWaalsContact O-N 3.12Å
20	K	72.8	Confident	72.2	Confident	156 Å²	156	114.9 Å²	114.9	68%	0.678	58%	0.58	S	S	*	*	H	α-helix	trans	-69	-42.4	174.1	-74.2	-161.8	176.1	-170.3	0	112	R16 L17 L18 Q22 R23 L24	R16-K20 WeakPolarHBondContact O-CG 3.38Å; R16-K20 PolarHBondContact O-N 3.5Å; L17-K20 PolarHBondContact O-N 3.43Å; L18-K20 VanDerWaalsContact C-N 3.34Å; L18-K20 PolarHBondContact O-N 3.49Å; K20-Q22 VanDerWaalsContact C-N 3.27Å; K20-Q22 PolarHBondContact O-N 2.91Å; K20-R23 PolarHBondContact O-N 3.33Å; K20-L24 WeakPolarHBondContact O-CD1 3.39Å; K20-L24 WeakPolarHBondContact O-CG 3.31Å; K20-L24 PolarHBondContact O-N 2.82Å; K20-L24 VanDerWaalsContact O-N 3.16Å
21	L	69.1	Low	71.4	Confident	114 Å²	114	114.5 Å²	114.5	60%	0.597	58%	0.576	S	S	*	*	H	α-helix	trans	-70	-17.2	175.5	-90.6	153.8	0	0	0	113.7	L17 L18 P25	L17-L21 VanDerWaalsContact O-CB 3.26Å; L17-L21 WeakPolarHBondContact O-CB 3.44Å; L17-L21 PolarHBondContact O-N 2.88Å; L18-L21 CarbonylContact O-C 3.42Å; L18-L21 PolarHBondContact O-N 3.41Å; L21-P25 VanDerWaalsContact C-CD 3.49Å; L21-P25 WeakPolarHBondContact O-CD 3.26Å; L21-P25 WeakPolarHBondContact O-CG 3.4Å
22	Q	68.4	Low	71	Confident	122 Å²	122	110.1 Å²	110.1	57%	0.57	57%	0.566	S	S	*	*	H	α-helix	trans	-92.2	-24.6	174.6	-168.9	179.4	-11.6	0	0	111.1	L18 L19 K20 P25	L18-Q22 WeakPolarHBondContact O-CB 3.48Å; L18-Q22 PolarHBondContact O-N 2.93Å; L19-Q22 PolarHBondContact O-N 2.75Å; K20-Q22 VanDerWaalsContact C-N 3.27Å; K20-Q22 PolarHBondContact O-N 2.91Å; Q22-P25 VanDerWaalsContact C-CD 3.47Å; Q22-P25 WeakPolarHBondContact O-CD 3.2Å; Q22-P25 WeakPolarHBondContact O-CG 3.21Å
23	R	66.3	Low	70.7	Confident	206 Å²	206	112.1 Å²	112.1	78%	0.777	57%	0.574	S	S	*	*	H	α-helix	trans	-77.7	-30.4	173.8	-147.5	-170.8	-163.3	-167.8	6.2	113.4	L19 K20	L19-R23 WeakPolarHBondContact O-CB 3.3Å; L19-R23 PolarHBondContact O-N 3.26Å; L19-R23 VanDerWaalsContact O-N 3.12Å; K20-R23 PolarHBondContact O-N 3.33Å
24	L	60.8	Low	70.5	Confident	119 Å²	119	111.2 Å²	111.2	62%	0.623	57%	0.573	S	S	*	*	S	Bend	trans	-63.9	-48.3	173.1	-76.5	156.6	0	0	0	114.2	K20 Q26	K20-L24 WeakPolarHBondContact O-CD1 3.39Å; K20-L24 WeakPolarHBondContact O-CG 3.31Å; K20-L24 PolarHBondContact O-N 2.82Å; K20-L24 VanDerWaalsContact O-N 3.16Å; L24-Q26 PolarHBondContact O-N 3.49Å
25	P	62.2	Low	70.4	Confident	49 Å²	49	116.2 Å²	116.2	32%	0.318	59%	0.586	S	S	.	*	T	Hydrogen-bonded Turn	trans	-77.7	0	-178	30.3	-38.4	0	0	0	113.6	L21 Q22 A27 I32	L21-P25 VanDerWaalsContact C-CD 3.49Å; L21-P25 WeakPolarHBondContact O-CD 3.26Å; L21-P25 WeakPolarHBondContact O-CG 3.4Å; Q22-P25 VanDerWaalsContact C-CD 3.47Å; Q22-P25 WeakPolarHBondContact O-CD 3.2Å; Q22-P25 WeakPolarHBondContact O-CG 3.21Å; P25-A27 PolarHBondContact O-N 2.87Å; P25-I32 HydrophobicContact CB-CD1 4.36Å; P25-I32 HydrophobicContact CB-CG1 4.47Å
26	Q	56.8	Low	70.5	Confident	164 Å²	164	112 Å²	112	77%	0.766	57%	0.572	S	S	*	*	T	Hydrogen-bonded Turn	trans	-70.9	-4.3	172.1	-160.6	166.4	14.3	0	0	112.2	L24	L24-Q26 PolarHBondContact O-N 3.49Å
27	A	57.5	Low	71	Confident	78 Å²	78	106.9 Å²	106.9	65%	0.645	56%	0.562	S	S	*	*	S	Bend	trans	-88.7	-45.1	-178.2	0	0	0	0	0	114.6	P25	P25-A27 PolarHBondContact O-N 2.87Å
28	E	56.4	Low	71.4	Confident	109 Å²	109	107 Å²	107	51%	0.509	56%	0.562	S	S	.	*			trans	-151.6	126.6	-179	-71.3	-163.7	140.1	0	0	114.7	V30 E31	E28-V30 PolarHBondContact O-N 3.33Å; E28-V30 VanDerWaalsContact O-N 3.08Å; E28-E31 PolarHBondContact O-N 3.49Å
29	P	61.1	Low	72	Confident	102 Å²	102	106.6 Å²	106.6	66%	0.662	56%	0.564	S	S	*	*	H	α-helix	trans	-64.1	-13.2	175.8	26.6	-33.8	0	0	0	113.6	V33	P29-V33 WeakPolarHBondContact O-CG2 3.42Å; P29-V33 PolarHBondContact O-N 3.48Å
30	V	62.8	Low	72.9	Confident	98 Å²	98	106.5 Å²	106.5	59%	0.594	56%	0.563	S	S	*	*	H	α-helix	trans	-71.1	-38.1	179.4	-179.5	0	0	0	0	111.7	E28 V33 A34	E28-V30 PolarHBondContact O-N 3.33Å; E28-V30 VanDerWaalsContact O-N 3.08Å; V30-V33 PolarHBondContact O-N 3.34Å; V30-A34 PolarHBondContact O-N 2.89Å; V30-A34 VanDerWaalsContact O-N 3.08Å
31	E	65.5	Low	74	Confident	99 Å²	99	105.7 Å²	105.7	46%	0.463	56%	0.56	S	S	.	*	H	α-helix	trans	-67.8	-39.4	-179.9	-62.9	-170.5	156.8	0	0	111.4	E28 V33 A34 F35	E28-E31 PolarHBondContact O-N 3.49Å; E31-V33 VanDerWaalsContact C-N 3.27Å; E31-V33 PolarHBondContact O-N 3.15Å; E31-A34 PolarHBondContact O-N 3.49Å; E31-A34 VanDerWaalsContact O-N 3.16Å; E31-F35 VanDerWaalsContact O-CD2 3.28Å; E31-F35 WeakPolarHBondContact O-CD2 3.35Å; E31-F35 PolarHBondContact O-N 3.42Å
32	I	74.3	Confident	75.3	Confident	98 Å²	98	103.6 Å²	103.6	50%	0.503	55%	0.552	S	S	.	*	H	α-helix	trans	-59.3	-42.1	176.9	-63	172.5	0	0	0	110.5	P25 S36	P25-I32 HydrophobicContact CB-CD1 4.36Å; P25-I32 HydrophobicContact CB-CG1 4.47Å; I32-S36 VanDerWaalsContact O-CB 3.29Å; I32-S36 WeakPolarHBondContact O-CB 3.32Å; I32-S36 PolarHBondContact O-N 2.92Å; I32-S36 PolarHBondContact O-OG 3.43Å
33	V	78.7	Confident	76.6	Confident	89 Å²	89	100.3 Å²	100.3	54%	0.539	55%	0.545	S	S	.	.	H	α-helix	trans	-65	-46.1	176.9	178	0	0	0	0	110.2	P29 V30 E31 F35 S36 V37	P29-V33 WeakPolarHBondContact O-CG2 3.42Å; P29-V33 PolarHBondContact O-N 3.48Å; V30-V33 PolarHBondContact O-N 3.34Å; E31-V33 VanDerWaalsContact C-N 3.27Å; E31-V33 PolarHBondContact O-N 3.15Å; V33-F35 PolarHBondContact O-N 2.89Å; V33-S36 WeakPolarHBondContact CA-OG 3.39Å; V33-S36 PolarHBondContact O-N 2.85Å; V33-S36 PolarHBondContact O-OG 2.88Å; V33-V37 WeakPolarHBondContact O-CG2 3.44Å; V33-V37 PolarHBondContact O-N 2.96Å
34	A	81	Confident	78	Confident	50 Å²	50	93.9 Å²	93.9	41%	0.413	53%	0.529	S	S	.	.	H	α-helix	trans	-61.1	-46.2	178.4	0	0	0	0	0	112.6	V30 E31 S36 V37 I38	V30-A34 PolarHBondContact O-N 2.89Å; V30-A34 VanDerWaalsContact O-N 3.08Å; E31-A34 PolarHBondContact O-N 3.49Å; E31-A34 VanDerWaalsContact O-N 3.16Å; A34-S36 VanDerWaalsContact C-N 3.32Å; A34-S36 PolarHBondContact O-N 3.44Å; A34-V37 PolarHBondContact O-N 3.32Å; A34-I38 WeakPolarHBondContact O-CG1 3.31Å; A34-I38 PolarHBondContact O-N 3.32Å
35	F	81.6	Confident	79.7	Confident	138 Å²	138	90.8 Å²	90.8	61%	0.605	52%	0.515	S	S	*	.	H	α-helix	trans	-60.8	-41.6	174.3	-87.7	-77	0	0	0	111.8	E31 V33 V37 I38 V39	E31-F35 VanDerWaalsContact O-CD2 3.28Å; E31-F35 WeakPolarHBondContact O-CD2 3.35Å; E31-F35 PolarHBondContact O-N 3.42Å; V33-F35 PolarHBondContact O-N 2.89Å; F35-V37 VanDerWaalsContact C-N 3.33Å; F35-V37 PolarHBondContact O-N 2.83Å; F35-I38 PolarHBondContact O-N 2.84Å; F35-V39 VanDerWaalsContact O-CG2 3.31Å; F35-V39 WeakPolarHBondContact O-CG2 3.5Å; F35-V39 PolarHBondContact O-N 3.33Å
36	S	85.3	Confident	81.3	Confident	52 Å²	52	93.1 Å²	93.1	36%	0.364	53%	0.525	S	S	.	.	H	α-helix	trans	-61.9	-40.9	178.1	76.6	0	0	0	0	112	I32 V33 A34 V39 L40	I32-S36 VanDerWaalsContact O-CB 3.29Å; I32-S36 WeakPolarHBondContact O-CB 3.32Å; I32-S36 PolarHBondContact O-N 2.92Å; I32-S36 PolarHBondContact O-OG 3.43Å; V33-S36 WeakPolarHBondContact CA-OG 3.39Å; V33-S36 PolarHBondContact O-N 2.85Å; V33-S36 PolarHBondContact O-OG 2.88Å; A34-S36 VanDerWaalsContact C-N 3.32Å; A34-S36 PolarHBondContact O-N 3.44Å; S36-V39 PolarHBondContact O-N 2.92Å; S36-L40 VanDerWaalsContact O-CB 3.3Å; S36-L40 WeakPolarHBondContact O-CB 3.27Å; S36-L40 WeakPolarHBondContact O-CG 3.44Å; S36-L40 PolarHBondContact O-N 2.86Å
37	V	92.5	Very high	83.2	Confident	86 Å²	86	90.2 Å²	90.2	52%	0.521	51%	0.513	S	S	.	.	H	α-helix	trans	-64.1	-44	176.6	173.8	0	0	0	0	110.7	V33 A34 F35 V39 L40 F41	V33-V37 WeakPolarHBondContact O-CG2 3.44Å; V33-V37 PolarHBondContact O-N 2.96Å; A34-V37 PolarHBondContact O-N 3.32Å; F35-V37 VanDerWaalsContact C-N 3.33Å; F35-V37 PolarHBondContact O-N 2.83Å; V37-V39 PolarHBondContact O-N 3.24Å; V37-L40 PolarHBondContact O-N 2.84Å; V37-F41 WeakPolarHBondContact O-CB 3.28Å; V37-F41 PolarHBondContact O-N 3.5Å
38	I	90.8	Very high	84.9	Confident	102 Å²	102	91.8 Å²	91.8	52%	0.523	51%	0.511	S	S	.	.	H	α-helix	trans	-62.8	-44.3	178.5	-65.4	164.6	0	0	0	111	A34 F35 F41 T42	A34-I38 WeakPolarHBondContact O-CG1 3.31Å; A34-I38 PolarHBondContact O-N 3.32Å; F35-I38 PolarHBondContact O-N 2.84Å; I38-F41 PolarHBondContact O-N 2.89Å; I38-T42 WeakPolarHBondContact O-CB 3.34Å; I38-T42 PolarHBondContact O-N 2.97Å; I38-T42 PolarHBondContact O-OG1 3.16Å
39	V	92.3	Very high	86.7	Confident	95 Å²	95	91.7 Å²	91.7	58%	0.576	51%	0.513	S	S	*	.	H	α-helix	trans	-65.3	-46.7	178.5	172.1	0	0	0	0	110.9	F35 S36 V37 F41 T42 A43	F35-V39 VanDerWaalsContact O-CG2 3.31Å; F35-V39 WeakPolarHBondContact O-CG2 3.5Å; F35-V39 PolarHBondContact O-N 3.33Å; S36-V39 PolarHBondContact O-N 2.92Å; V37-V39 PolarHBondContact O-N 3.24Å; V39-F41 PolarHBondContact O-N 3.47Å; V39-T42 PolarHBondContact O-N 2.86Å; V39-A43 WeakPolarHBondContact O-CB 3.28Å; V39-A43 PolarHBondContact O-N 3.48Å
40	L	95.2	Very high	88.2	Confident	111 Å²	111	92.5 Å²	92.5	58%	0.581	51%	0.511	S	S	*	.	H	α-helix	trans	-62.4	-42.5	177.3	-73.4	171.2	0	0	0	111.7	S36 V37 A43 T44	S36-L40 VanDerWaalsContact O-CB 3.3Å; S36-L40 WeakPolarHBondContact O-CB 3.27Å; S36-L40 WeakPolarHBondContact O-CG 3.44Å; S36-L40 PolarHBondContact O-N 2.86Å; V37-L40 PolarHBondContact O-N 2.84Å; L40-A43 PolarHBondContact O-N 3.28Å; L40-T44 WeakPolarHBondContact O-CB 3.44Å; L40-T44 VanDerWaalsContact O-CG2 3.28Å; L40-T44 WeakPolarHBondContact O-CG2 3.33Å; L40-T44 PolarHBondContact O-N 2.88Å; L40-T44 PolarHBondContact O-OG1 3.09Å
41	F	95.9	Very high	89.4	Confident	139 Å²	139	91.7 Å²	91.7	61%	0.61	50%	0.503	S	S	*	.	H	α-helix	trans	-61.6	-47.5	175.7	-178.6	-101	0	0	0	111.3	V37 I38 V39 A43 T44 V45	V37-F41 WeakPolarHBondContact O-CB 3.28Å; V37-F41 PolarHBondContact O-N 3.5Å; I38-F41 PolarHBondContact O-N 2.89Å; V39-F41 PolarHBondContact O-N 3.47Å; F41-A43 PolarHBondContact O-N 3.37Å; F41-T44 WeakPolarHBondContact CA-OG1 3.29Å; F41-T44 PolarHBondContact O-N 3.47Å; F41-T44 PolarHBondContact O-OG1 2.82Å; F41-V45 HydrophobicContact CD1-CG2 4.23Å; F41-V45 HydrophobicContact CD2-CG2 4.41Å; F41-V45 HydrophobicContact CE1-CG2 3.83Å; F41-V45 HydrophobicContact CE2-CG2 4.02Å; F41-V45 HydrophobicContact CZ-CG2 3.72Å; F41-V45 WeakPolarHBondContact O-CB 3.4Å; F41-V45 VanDerWaalsContact O-CG2 3.31Å; F41-V45 WeakPolarHBondContact O-CG2 3.37Å; F41-V45 PolarHBondContact O-N 3.49Å
42	T	95.3	Very high	90.5	Very high	70 Å²	70	89.4 Å²	89.4	43%	0.429	50%	0.5	S	S	.	.	H	α-helix	trans	-61.5	-45.3	178.2	-53.1	0	0	0	0	111.1	I38 V39 T44 V45 L46	I38-T42 WeakPolarHBondContact O-CB 3.34Å; I38-T42 PolarHBondContact O-N 2.97Å; I38-T42 PolarHBondContact O-OG1 3.16Å; V39-T42 PolarHBondContact O-N 2.86Å; T42-T44 PolarHBondContact O-N 3.47Å; T42-V45 PolarHBondContact O-N 3.4Å; T42-L46 HydrophobicContact CG2-CD1 4.16Å; T42-L46 WeakPolarHBondContact O-CB 3.49Å; T42-L46 VanDerWaalsContact O-CG 3.27Å; T42-L46 WeakPolarHBondContact O-CG 3.44Å; T42-L46 PolarHBondContact O-N 3.32Å
43	A	95.9	Very high	90.9	Very high	52 Å²	52	88.1 Å²	88.1	43%	0.43	50%	0.499	S	S	.	.	H	α-helix	trans	-62.4	-42.9	178.2	0	0	0	0	0	112.4	V39 L40 F41 L46 L47	V39-A43 WeakPolarHBondContact O-CB 3.28Å; V39-A43 PolarHBondContact O-N 3.48Å; L40-A43 PolarHBondContact O-N 3.28Å; F41-A43 PolarHBondContact O-N 3.37Å; A43-L46 PolarHBondContact O-N 2.95Å; A43-L47 WeakPolarHBondContact O-CB 3.16Å; A43-L47 PolarHBondContact O-N 3.35Å
44	T	96.3	Very high	91.1	Very high	71 Å²	71	86.7 Å²	86.7	44%	0.436	49%	0.494	S	S	.	.	H	α-helix	trans	-67.3	-42.8	177.9	50.4	0	0	0	0	112	L40 F41 T42 L46 L47 L48	L40-T44 WeakPolarHBondContact O-CB 3.44Å; L40-T44 VanDerWaalsContact O-CG2 3.28Å; L40-T44 WeakPolarHBondContact O-CG2 3.33Å; L40-T44 PolarHBondContact O-N 2.88Å; L40-T44 PolarHBondContact O-OG1 3.09Å; F41-T44 WeakPolarHBondContact CA-OG1 3.29Å; F41-T44 PolarHBondContact O-N 3.47Å; F41-T44 PolarHBondContact O-OG1 2.82Å; T42-T44 PolarHBondContact O-N 3.47Å; T44-L46 PolarHBondContact O-N 2.87Å; T44-L47 PolarHBondContact O-N 3.13Å; T44-L48 WeakPolarHBondContact O-CB 3.29Å; T44-L48 VanDerWaalsContact O-CG 3.28Å; T44-L48 WeakPolarHBondContact O-CG 3.48Å; T44-L48 PolarHBondContact O-N 2.81Å
45	V	96.9	Very high	90.9	Very high	54 Å²	54	87.6 Å²	87.6	33%	0.327	50%	0.496	S	S	.	.	H	α-helix	trans	-60.8	-45.9	174.9	171.3	0	0	0	0	110.9	F41 T42 L47 L48 L49	F41-V45 HydrophobicContact CD1-CG2 4.23Å; F41-V45 HydrophobicContact CD2-CG2 4.41Å; F41-V45 HydrophobicContact CE1-CG2 3.83Å; F41-V45 HydrophobicContact CE2-CG2 4.02Å; F41-V45 HydrophobicContact CZ-CG2 3.72Å; F41-V45 WeakPolarHBondContact O-CB 3.4Å; F41-V45 VanDerWaalsContact O-CG2 3.31Å; F41-V45 WeakPolarHBondContact O-CG2 3.37Å; F41-V45 PolarHBondContact O-N 3.49Å; T42-V45 PolarHBondContact O-N 3.4Å; V45-L47 PolarHBondContact O-N 2.85Å; V45-L48 PolarHBondContact O-N 3.46Å; V45-L49 HydrophobicContact CG1-CD1 3.96Å; V45-L49 HydrophobicContact CG1-CG 4.39Å; V45-L49 WeakPolarHBondContact O-CB 3.25Å; V45-L49 VanDerWaalsContact O-CG 3.29Å; V45-L49 WeakPolarHBondContact O-CG 3.27Å; V45-L49 PolarHBondContact O-N 2.86Å
46	L	96.3	Very high	90.5	Very high	99 Å²	99	84.7 Å²	84.7	52%	0.518	49%	0.492	S	S	.	.	H	α-helix	trans	-61.8	-43.1	176.2	-71.6	175	0	0	0	111.8	T42 A43 T44 L49 L50	T42-L46 HydrophobicContact CG2-CD1 4.16Å; T42-L46 WeakPolarHBondContact O-CB 3.49Å; T42-L46 VanDerWaalsContact O-CG 3.27Å; T42-L46 WeakPolarHBondContact O-CG 3.44Å; T42-L46 PolarHBondContact O-N 3.32Å; A43-L46 PolarHBondContact O-N 2.95Å; T44-L46 PolarHBondContact O-N 2.87Å; L46-L49 PolarHBondContact O-N 3.2Å; L46-L50 WeakPolarHBondContact O-CB 3.12Å; L46-L50 VanDerWaalsContact O-CG 3.28Å; L46-L50 WeakPolarHBondContact O-CG 3.28Å; L46-L50 PolarHBondContact O-N 3.44Å
47	L	95.7	Very high	89.6	Confident	102 Å²	102	85.2 Å²	85.2	53%	0.534	50%	0.495	S	S	.	.	H	α-helix	trans	-61.2	-46.5	176.5	-174.1	72.5	0	0	0	111.3	A43 T44 V45 L49 L50 I51	A43-L47 WeakPolarHBondContact O-CB 3.16Å; A43-L47 PolarHBondContact O-N 3.35Å; T44-L47 PolarHBondContact O-N 3.13Å; V45-L47 PolarHBondContact O-N 2.85Å; L47-L49 VanDerWaalsContact C-N 3.34Å; L47-L49 PolarHBondContact O-N 3.26Å; L47-L50 PolarHBondContact O-N 3.48Å; L47-I51 HydrophobicContact CD2-CD1 4.46Å; L47-I51 HydrophobicContact CG-CD1 3.96Å; L47-I51 VanDerWaalsContact O-CG1 3.25Å; L47-I51 WeakPolarHBondContact O-CG1 3.27Å; L47-I51 PolarHBondContact O-N 3.46Å
48	L	94.1	Very high	88.1	Confident	112 Å²	112	85.3 Å²	85.3	59%	0.586	50%	0.496	S	S	*	.	H	α-helix	trans	-63	-40.1	177.2	-71	173.7	0	0	0	111.8	T44 V45 I51 A52	T44-L48 WeakPolarHBondContact O-CB 3.29Å; T44-L48 VanDerWaalsContact O-CG 3.28Å; T44-L48 WeakPolarHBondContact O-CG 3.48Å; T44-L48 PolarHBondContact O-N 2.81Å; V45-L48 PolarHBondContact O-N 3.46Å; L48-I51 PolarHBondContact O-N 3.46Å; L48-A52 VanDerWaalsContact O-CB 3.27Å; L48-A52 WeakPolarHBondContact O-CB 3.29Å; L48-A52 PolarHBondContact O-N 3.49Å
49	L	93.5	Very high	86.5	Confident	107 Å²	107	86.8 Å²	86.8	56%	0.56	50%	0.5	S	S	*	.	H	α-helix	trans	-63.6	-42.4	174.3	-76.2	171.8	0	0	0	111.8	V45 L46 L47 A52 C53	V45-L49 HydrophobicContact CG1-CD1 3.96Å; V45-L49 HydrophobicContact CG1-CG 4.39Å; V45-L49 WeakPolarHBondContact O-CB 3.25Å; V45-L49 VanDerWaalsContact O-CG 3.29Å; V45-L49 WeakPolarHBondContact O-CG 3.27Å; V45-L49 PolarHBondContact O-N 2.86Å; L46-L49 PolarHBondContact O-N 3.2Å; L47-L49 VanDerWaalsContact C-N 3.34Å; L47-L49 PolarHBondContact O-N 3.26Å; L49-A52 PolarHBondContact O-N 3.28Å; L49-C53 WeakPolarHBondContact O-CB 3.42Å; L49-C53 PolarHBondContact O-N 3.21Å
50	L	91.6	Very high	84.7	Confident	119 Å²	119	87.3 Å²	87.3	62%	0.623	51%	0.507	S	S	*	.	H	α-helix	trans	-65	-42.7	175.7	-72.7	174.5	0	0	0	111.5	L46 L47 C53 S54	L46-L50 WeakPolarHBondContact O-CB 3.12Å; L46-L50 VanDerWaalsContact O-CG 3.28Å; L46-L50 WeakPolarHBondContact O-CG 3.28Å; L46-L50 PolarHBondContact O-N 3.44Å; L47-L50 PolarHBondContact O-N 3.48Å; L50-C53 PolarHBondContact O-N 2.79Å; L50-S54 VanDerWaalsContact O-CB 3.26Å; L50-S54 WeakPolarHBondContact O-CB 3.47Å; L50-S54 PolarHBondContact O-N 3.33Å; L50-S54 PolarHBondContact O-OG 3.08Å
51	I	89.6	Confident	82.6	Confident	81 Å²	81	87 Å²	87	42%	0.415	51%	0.513	S	S	.	.	H	α-helix	trans	-62.4	-51.3	175.6	-68.1	164.7	0	0	0	109.6	L47 L48 C53 S54 C55	L47-I51 HydrophobicContact CD2-CD1 4.46Å; L47-I51 HydrophobicContact CG-CD1 3.96Å; L47-I51 VanDerWaalsContact O-CG1 3.25Å; L47-I51 WeakPolarHBondContact O-CG1 3.27Å; L47-I51 PolarHBondContact O-N 3.46Å; L48-I51 PolarHBondContact O-N 3.46Å; I51-C53 VanDerWaalsContact C-N 3.33Å; I51-C53 PolarHBondContact O-N 3.23Å; I51-S54 WeakPolarHBondContact CA-OG 3.45Å; I51-S54 CarbonylContact O-C 3.55Å; I51-S54 PolarHBondContact O-N 2.85Å; I51-S54 VanDerWaalsContact O-N 3.08Å; I51-S54 PolarHBondContact O-OG 3.38Å; I51-C55 PolarHBondContact O-N 3.19Å; I51-C55 PolarHBondContact O-SG 2.78Å
52	A	87.1	Confident	80.6	Confident	50 Å²	50	84.2 Å²	84.2	41%	0.413	51%	0.51	S	S	.	.	H	α-helix	trans	-58.2	-45.3	178.2	0	0	0	0	0	111.7	L48 L49 S54 C55 C56	L48-A52 VanDerWaalsContact O-CB 3.27Å; L48-A52 WeakPolarHBondContact O-CB 3.29Å; L48-A52 PolarHBondContact O-N 3.49Å; L49-A52 PolarHBondContact O-N 3.28Å; A52-S54 VanDerWaalsContact C-N 3.35Å; A52-S54 PolarHBondContact O-N 2.96Å; A52-C55 PolarHBondContact O-N 3.48Å; A52-C56 VanDerWaalsContact O-CB 3.31Å; A52-C56 WeakPolarHBondContact O-CB 3.11Å; A52-C56 PolarHBondContact O-N 2.79Å; A52-C56 PolarHBondContact O-SG 3.49Å
53	C	84	Confident	78.3	Confident	71 Å²	71	86.5 Å²	86.5	48%	0.48	53%	0.526	S	S	.	.	H	α-helix	trans	-61.6	-42.9	174.8	-172.8	0	0	0	0	111.2	L49 L50 I51 C56 C57	L49-C53 WeakPolarHBondContact O-CB 3.42Å; L49-C53 PolarHBondContact O-N 3.21Å; L50-C53 PolarHBondContact O-N 2.79Å; I51-C53 VanDerWaalsContact C-N 3.33Å; I51-C53 PolarHBondContact O-N 3.23Å; C53-C56 PolarHBondContact O-N 3.4Å; C53-C57 WeakPolarHBondContact O-CB 3.12Å; C53-C57 PolarHBondContact O-N 3.35Å; C53-C57 PolarHBondContact O-SG 2.69Å
54	S	82.6	Confident	76	Confident	60 Å²	60	89.6 Å²	89.6	42%	0.42	53%	0.531	S	S	.	.	H	α-helix	trans	-65.4	-41.3	176.9	75.5	0	0	0	0	112.1	L50 I51 A52 T58	L50-S54 VanDerWaalsContact O-CB 3.26Å; L50-S54 WeakPolarHBondContact O-CB 3.47Å; L50-S54 PolarHBondContact O-N 3.33Å; L50-S54 PolarHBondContact O-OG 3.08Å; I51-S54 WeakPolarHBondContact CA-OG 3.45Å; I51-S54 CarbonylContact O-C 3.55Å; I51-S54 PolarHBondContact O-N 2.85Å; I51-S54 VanDerWaalsContact O-N 3.08Å; I51-S54 PolarHBondContact O-OG 3.38Å; A52-S54 VanDerWaalsContact C-N 3.35Å; A52-S54 PolarHBondContact O-N 2.96Å; S54-T58 VanDerWaalsContact O-CB 3.22Å; S54-T58 WeakPolarHBondContact O-CB 3.22Å; S54-T58 WeakPolarHBondContact O-CG2 3.06Å; S54-T58 PolarHBondContact O-N 3.34Å; S54-T58 PolarHBondContact O-OG1 3.17Å
55	C	77.4	Confident	73.8	Confident	69 Å²	69	96.1 Å²	96.1	47%	0.466	56%	0.557	S	S	.	*	H	α-helix	trans	-66.4	-45.6	176.1	-66.1	0	0	0	0	111.4	I51 A52 T58 H59	I51-C55 PolarHBondContact O-N 3.19Å; I51-C55 PolarHBondContact O-SG 2.78Å; A52-C55 PolarHBondContact O-N 3.48Å; C55-T58 WeakPolarHBondContact CA-OG1 3.26Å; C55-T58 PolarHBondContact O-OG1 2.76Å; C55-H59 WeakPolarHBondContact O-CB 3.31Å; C55-H59 PolarHBondContact O-N 3.12Å
56	C	71.7	Confident	71.6	Confident	77 Å²	77	103.1 Å²	103.1	52%	0.52	58%	0.577	S	S	.	*	H	α-helix	trans	-64.4	-44.3	175.9	-68	0	0	0	0	111.5	A52 C53 H59 C60	A52-C56 VanDerWaalsContact O-CB 3.31Å; A52-C56 WeakPolarHBondContact O-CB 3.11Å; A52-C56 PolarHBondContact O-N 2.79Å; A52-C56 PolarHBondContact O-SG 3.49Å; C53-C56 PolarHBondContact O-N 3.4Å; C56-H59 PolarHBondContact O-N 2.79Å; C56-C60 WeakPolarHBondContact O-CB 3.47Å; C56-C60 PolarHBondContact O-N 3.27Å; C56-C60 PolarHBondContact O-SG 2.81Å
57	C	66.7	Low	69.5	Low	62 Å²	62	101.3 Å²	101.3	42%	0.419	58%	0.583	S	S	.	*	H	α-helix	trans	-74.4	-35.6	-178.9	-67.3	0	0	0	0	112.4	C53 C61	C53-C57 WeakPolarHBondContact O-CB 3.12Å; C53-C57 PolarHBondContact O-N 3.35Å; C53-C57 PolarHBondContact O-SG 2.69Å; C57-C61 WeakPolarHBondContact O-CA 3.28Å; C57-C61 WeakPolarHBondContact O-CB 3.18Å; C57-C61 PolarHBondContact O-N 3.49Å; C57-C61 PolarHBondContact O-SG 2.61Å
58	T	61	Low	67.6	Low	89 Å²	89	107.4 Å²	107.4	55%	0.546	60%	0.599	S	S	.	*	H	α-helix	trans	-68.8	-36.6	172.6	50.9	0	0	0	0	111.6	S54 C55 C62	S54-T58 VanDerWaalsContact O-CB 3.22Å; S54-T58 WeakPolarHBondContact O-CB 3.22Å; S54-T58 WeakPolarHBondContact O-CG2 3.06Å; S54-T58 PolarHBondContact O-N 3.34Å; S54-T58 PolarHBondContact O-OG1 3.17Å; C55-T58 WeakPolarHBondContact CA-OG1 3.26Å; C55-T58 PolarHBondContact O-OG1 2.76Å; T58-C62 VanDerWaalsContact O-CB 3.28Å; T58-C62 WeakPolarHBondContact O-CB 3.08Å; T58-C62 PolarHBondContact O-N 3.21Å; T58-C62 PolarHBondContact O-SG 2.79Å; T58-C62 VanDerWaalsContact O-SG 3.34Å
59	H	56.9	Low	65.6	Low	133 Å²	133	111.4 Å²	111.4	62%	0.616	61%	0.611	S	S	*	*	H	α-helix	trans	-77.9	-27.2	175.8	-165.3	-77.3	0	0	0	113.3	C55 C56	C55-H59 WeakPolarHBondContact O-CB 3.31Å; C55-H59 PolarHBondContact O-N 3.12Å; C56-H59 PolarHBondContact O-N 2.79Å
60	C	54.8	Low	63.9	Low	105 Å²	105	111 Å²	111	71%	0.709	61%	0.613	S	S	*	*	H	α-helix	trans	-89.5	-28.3	177.1	-71.7	0	0	0	0	113.5	C56	C56-C60 WeakPolarHBondContact O-CB 3.47Å; C56-C60 PolarHBondContact O-N 3.27Å; C56-C60 PolarHBondContact O-SG 2.81Å
61	C	52	Low	62.2	Low	105 Å²	105	113.6 Å²	113.6	71%	0.709	62%	0.622	S	S	*	*	H	α-helix	trans	-92.2	-11	177.9	-63.5	0	0	0	0	113.4	C57 P63	C57-C61 WeakPolarHBondContact O-CA 3.28Å; C57-C61 WeakPolarHBondContact O-CB 3.18Å; C57-C61 PolarHBondContact O-N 3.49Å; C57-C61 PolarHBondContact O-SG 2.61Å; C61-P63 WeakPolarHBondContact O-CD 3.2Å
62	C	52.5	Low	60.7	Low	81 Å²	81	116 Å²	116	55%	0.547	64%	0.64	S	S	.	*	S	Bend	trans	-89.9	110.3	162	-71	0	0	0	0	108.1	T58 E64	T58-C62 VanDerWaalsContact O-CB 3.28Å; T58-C62 WeakPolarHBondContact O-CB 3.08Å; T58-C62 PolarHBondContact O-N 3.21Å; T58-C62 PolarHBondContact O-SG 2.79Å; T58-C62 VanDerWaalsContact O-SG 3.34Å; C62-E64 PolarHBondContact O-N 2.93Å
63	P	48.6	Very low	59.4	Low	118 Å²	118	121.2 Å²	121.2	77%	0.766	66%	0.656	S	S	*	*			trans	-61	110.9	166.5	25.9	-30.6	0	0	0	106.8	C61 Q65	C61-P63 WeakPolarHBondContact O-CD 3.2Å; P63-Q65 PolarHBondContact O-N 3.44Å
64	E	46.7	Very low	58.2	Low	117 Å²	117	123.6 Å²	123.6	55%	0.547	67%	0.67	S	S	.	*			trans	-34.5	108.4	163	-94.5	-102.3	91.2	0	0	109.5	C62 R66	C62-E64 PolarHBondContact O-N 2.93Å; E64-R66 HydrophobicContact CB-CB 4.07Å; E64-R66 VanDerWaalsContact CD-CD 3.47Å; E64-R66 HydrophobicContact CG-CB 4.28Å; E64-R66 PolarHBondContact O-N 2.89Å; E64-R66 WeakPolarHBondContact OE1-CB 2.99Å; E64-R66 WeakPolarHBondContact OE1-CD 3.02Å; E64-R66 WeakPolarHBondContact OE2-CB 3.18Å; E64-R66 WeakPolarHBondContact OE2-CD 3.38Å
65	Q	49.8	Very low	56.8	Low	208 Å²	208	127.1 Å²	127.1	97%	0.972	69%	0.69	S	S	*	*			trans	-66.4	24.7	159.8	-94	-162.2	-16.9	0	0	111.3	P63 G67	P63-Q65 PolarHBondContact O-N 3.44Å; Q65-G67 PolarHBondContact O-N 2.72Å
66	R	51.5	Low	56.1	Low	200 Å²	200	129 Å²	129	76%	0.755	70%	0.701	S	S	*	*			trans	-101.4	97.3	-173.4	-149.7	172	-168.8	-121.4	5.7	108.6	E64	E64-R66 HydrophobicContact CB-CB 4.07Å; E64-R66 VanDerWaalsContact CD-CD 3.47Å; E64-R66 HydrophobicContact CG-CB 4.28Å; E64-R66 PolarHBondContact O-N 2.89Å; E64-R66 WeakPolarHBondContact OE1-CB 2.99Å; E64-R66 WeakPolarHBondContact OE1-CD 3.02Å; E64-R66 WeakPolarHBondContact OE2-CB 3.18Å; E64-R66 WeakPolarHBondContact OE2-CD 3.38Å
67	G	51.6	Low	55.5	Low	61 Å²	61	134.9 Å²	134.9	63%	0.629	74%	0.738	S	S	*	*			trans	102.6	89.8	170.5	0	0	0	0	0	111.6	Q65 K69	Q65-G67 PolarHBondContact O-N 2.72Å; G67-K69 PolarHBondContact O-N 2.93Å
68	R	55.6	Low	54.9	Low	231 Å²	231	138.6 Å²	138.6	87%	0.872	75%	0.754	S	S	*	*			trans	-28.2	87.2	145.1	-173.8	169.8	86.3	178.2	8.6	110.7	V70	R68-V70 PolarHBondContact O-N 2.94Å
69	K	52.7	Low	54.6	Low	196 Å²	196	141.2 Å²	141.2	85%	0.852	77%	0.765	S	S	*	*			trans	-68.4	97.1	160.5	-74	-174.4	-179.5	-179	0	104.1	G67 Q71	G67-K69 PolarHBondContact O-N 2.93Å; K69-Q71 PolarHBondContact O-N 2.94Å
70	V	58.4	Low	54.4	Low	99 Å²	99	141.6 Å²	141.6	60%	0.6	77%	0.773	S	S	*	*			trans	-45	110.3	166	166.9	0	0	0	0	106	R68 V72	R68-V70 PolarHBondContact O-N 2.94Å; V70-V72 VanDerWaalsContact C-N 3.3Å; V70-V72 PolarHBondContact O-N 2.92Å
71	Q	54.8	Low	54.4	Low	173 Å²	173	143.8 Å²	143.8	81%	0.808	78%	0.777	S	S	*	*			trans	-65.4	99	168.4	-79	-161.7	40.3	0	0	106.4	K69 Q73	K69-Q71 PolarHBondContact O-N 2.94Å; Q71-Q73 VanDerWaalsContact C-N 3.31Å; Q71-Q73 PolarHBondContact O-N 3.11Å; Q71-Q73 VanDerWaalsContact O-N 3.11Å
72	V	59.6	Low	54.6	Low	130 Å²	130	146.2 Å²	146.2	79%	0.788	78%	0.781	S	S	*	*			trans	-71.2	95.8	159.1	-97.5	0	0	0	0	106.4	V70	V70-V72 VanDerWaalsContact C-N 3.3Å; V70-V72 PolarHBondContact O-N 2.92Å
73	Q	58.6	Low	54.7	Low	161 Å²	161	150.5 Å²	150.5	75%	0.752	80%	0.797	S	S	*	*	P	Polyproline II helix	trans	-62.9	128.7	163.5	-92.8	-168.9	9.8	0	0	108.3	Q71 T75	Q71-Q73 VanDerWaalsContact C-N 3.31Å; Q71-Q73 PolarHBondContact O-N 3.11Å; Q71-Q73 VanDerWaalsContact O-N 3.11Å; Q73-T75 PolarHBondContact O-N 3.31Å
74	P	59.1	Low	55.2	Low	121 Å²	121	152.9 Å²	152.9	79%	0.786	80%	0.799	S	S	*	*	P	Polyproline II helix	trans	-67.2	120.9	165.4	-11.7	26.6	0	0	0	108.7
75	T	53.5	Low	55.8	Low	134 Å²	134	155.6 Å²	155.6	82%	0.822	82%	0.819	S	S	*	*	P	Polyproline II helix	trans	-69.4	126	170.2	-33	0	0	0	0	108.3	Q73	Q73-T75 PolarHBondContact O-N 3.31Å
76	P	61.5	Low	56.3	Low	107 Å²	107	151.3 Å²	151.3	70%	0.695	81%	0.806	S	S	*	*	P	Polyproline II helix	trans	-72.7	153.4	176.2	29.3	-32.4	0	0	0	111.3
77	P	59	Low	56.8	Low	202 Å²	202	146.8 Å²	146.8	100%	1.312	81%	0.811	S	S	*	*			trans	-69	0	178.9	30.8	-35.9	0	0	0	113.5

Retrieved 77 of 77 residues in 20.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).