A0A913KEP0_SCHMA Loading...

Putative tiptop AlphaSync

AlphaFold DB , UniProt , Accession A0A913KEP0, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 75 aa.

						>A0A913KEP0_SCHMA|A0A913KEP0
MHSDFLFIYILIFSIPSYVHFYSVLPLLLLSLSHFYCYYYYFDLFFLFILFILSRRCTATCSNTFLQSHRPIITL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	69.5	Low	84.5	Confident	188 Å²	188	124.3 Å²	124.3	93%	0.926	61%	0.607	S	S	*	*				0	-42.9	0	-68.7	-162.6	166.8	0	0	113.1	D4 F5	M1-D4 WeakPolarHBondContact CA-OD2 3.29Å; M1-F5 VanDerWaalsContact O-CD2 3.27Å; M1-F5 WeakPolarHBondContact O-CD2 2.79Å
2	H	82.8	Confident	84.5	Confident	166 Å²	166	122.9 Å²	122.9	77%	0.769	60%	0.603	S	S	*	*	H	α-helix	trans	-70	-32.1	180	-154.6	76.6	0	0	0	114.1	D4 L6	H2-D4 PolarHBondContact O-N 3.43Å; H2-L6 PolarHBondContact O-N 2.81Å
3	S	82.6	Confident	84.3	Confident	84 Å²	84	123.9 Å²	123.9	59%	0.587	60%	0.602	S	S	*	*	H	α-helix	trans	-63.7	-36.8	177.8	48.4	0	0	0	0	113.6	L6 F7	S3-L6 PolarHBondContact O-N 3.07Å; S3-F7 PolarHBondContact O-N 3.23Å
4	D	88.6	Confident	84.2	Confident	96 Å²	96	116.9 Å²	116.9	51%	0.513	57%	0.572	S	S	.	*	H	α-helix	trans	-72.4	-37.1	-175.3	-47.6	-56	0	0	0	111.2	M1 H2 F7 I8	M1-D4 WeakPolarHBondContact CA-OD2 3.29Å; H2-D4 PolarHBondContact O-N 3.43Å; D4-F7 PolarHBondContact O-N 2.83Å; D4-I8 WeakPolarHBondContact O-CG1 3.16Å; D4-I8 PolarHBondContact O-N 2.86Å; D4-I8 VanDerWaalsContact O-N 3.12Å
5	F	86.9	Confident	84	Confident	153 Å²	153	115.3 Å²	115.3	67%	0.671	57%	0.565	S	S	*	*	H	α-helix	trans	-64.1	-40.5	173.7	-80.8	-76.6	0	0	0	112.3	M1 F7 I8 Y9	M1-F5 VanDerWaalsContact O-CD2 3.27Å; M1-F5 WeakPolarHBondContact O-CD2 2.79Å; F5-F7 VanDerWaalsContact C-N 3.34Å; F5-I8 PolarHBondContact O-N 3.02Å; F5-Y9 WeakPolarHBondContact O-CB 3.41Å; F5-Y9 PolarHBondContact O-N 2.88Å
6	L	86.7	Confident	83.6	Confident	105 Å²	105	112.1 Å²	112.1	55%	0.55	56%	0.556	S	S	.	*	H	α-helix	trans	-64.2	-40.8	177.8	-168.3	112.4	0	0	0	111.3	H2 S3 Y9 I10	H2-L6 PolarHBondContact O-N 2.81Å; S3-L6 PolarHBondContact O-N 3.07Å; L6-Y9 PolarHBondContact O-N 2.79Å; L6-I10 HydrophobicContact CD2-CD1 3.71Å; L6-I10 HydrophobicContact CG-CD1 4.13Å; L6-I10 WeakPolarHBondContact O-CG1 3.42Å; L6-I10 PolarHBondContact O-N 3.2Å
7	F	88.1	Confident	83.2	Confident	140 Å²	140	109.4 Å²	109.4	61%	0.614	55%	0.551	S	S	*	*	H	α-helix	trans	-62.3	-46.1	176.7	-176	-98.9	0	0	0	112	S3 D4 F5 Y9 I10 L11	S3-F7 PolarHBondContact O-N 3.23Å; D4-F7 PolarHBondContact O-N 2.83Å; F5-F7 VanDerWaalsContact C-N 3.34Å; F7-Y9 VanDerWaalsContact C-N 3.32Å; F7-Y9 PolarHBondContact O-N 3.36Å; F7-I10 PolarHBondContact O-N 3.36Å; F7-L11 WeakPolarHBondContact O-CB 3.31Å; F7-L11 PolarHBondContact O-N 3.06Å
8	I	87.2	Confident	82.9	Confident	92 Å²	92	111.3 Å²	111.3	47%	0.472	55%	0.552	S	S	.	*	H	α-helix	trans	-61.8	-41.1	176.7	-66.2	167.4	0	0	0	110.8	D4 F5 L11 I12	D4-I8 WeakPolarHBondContact O-CG1 3.16Å; D4-I8 PolarHBondContact O-N 2.86Å; D4-I8 VanDerWaalsContact O-N 3.12Å; F5-I8 PolarHBondContact O-N 3.02Å; I8-L11 PolarHBondContact O-N 3.18Å; I8-I12 HydrophobicContact CG2-CD1 3.74Å; I8-I12 HydrophobicContact CG2-CG1 4.4Å; I8-I12 VanDerWaalsContact O-CG1 3.26Å; I8-I12 WeakPolarHBondContact O-CG1 3.47Å; I8-I12 PolarHBondContact O-N 3.2Å
9	Y	86.4	Confident	82.8	Confident	160 Å²	160	110.4 Å²	110.4	63%	0.627	55%	0.553	S	S	*	*	H	α-helix	trans	-63.7	-45.6	177.9	-174	-96.7	0	0	0	112.6	F5 L6 F7 L11 I12 F13	F5-Y9 WeakPolarHBondContact O-CB 3.41Å; F5-Y9 PolarHBondContact O-N 2.88Å; L6-Y9 PolarHBondContact O-N 2.79Å; F7-Y9 VanDerWaalsContact C-N 3.32Å; F7-Y9 PolarHBondContact O-N 3.36Å; Y9-L11 VanDerWaalsContact C-N 3.34Å; Y9-L11 PolarHBondContact O-N 2.89Å; Y9-I12 PolarHBondContact O-N 3.31Å; Y9-F13 WeakPolarHBondContact O-CB 3.46Å; Y9-F13 PolarHBondContact O-N 2.93Å
10	I	86.4	Confident	82.5	Confident	95 Å²	95	111.3 Å²	111.3	49%	0.487	56%	0.555	S	S	.	*	H	α-helix	trans	-62.9	-42.9	176.2	-67	166.6	0	0	0	110.4	L6 F7 F13 S14	L6-I10 HydrophobicContact CD2-CD1 3.71Å; L6-I10 HydrophobicContact CG-CD1 4.13Å; L6-I10 WeakPolarHBondContact O-CG1 3.42Å; L6-I10 PolarHBondContact O-N 3.2Å; F7-I10 PolarHBondContact O-N 3.36Å; I10-F13 PolarHBondContact O-N 3.36Å; I10-S14 VanDerWaalsContact O-CB 3.26Å; I10-S14 WeakPolarHBondContact O-CB 3.4Å; I10-S14 PolarHBondContact O-N 3.36Å; I10-S14 PolarHBondContact O-OG 3.48Å
11	L	83.9	Confident	82.3	Confident	88 Å²	88	112.2 Å²	112.2	46%	0.461	56%	0.555	S	S	.	*	H	α-helix	trans	-59.3	-50.2	177.8	-172.3	69.9	0	0	0	110.6	F7 I8 Y9 F13 S14 I15	F7-L11 WeakPolarHBondContact O-CB 3.31Å; F7-L11 PolarHBondContact O-N 3.06Å; I8-L11 PolarHBondContact O-N 3.18Å; Y9-L11 VanDerWaalsContact C-N 3.34Å; Y9-L11 PolarHBondContact O-N 2.89Å; L11-F13 VanDerWaalsContact C-N 3.32Å; L11-F13 PolarHBondContact O-N 2.97Å; L11-S14 PolarHBondContact O-N 2.96Å; L11-S14 PolarHBondContact O-OG 2.87Å; L11-I15 HydrophobicContact CG-CD1 4.38Å; L11-I15 VanDerWaalsContact O-CG1 3.28Å; L11-I15 WeakPolarHBondContact O-CG1 3.32Å; L11-I15 PolarHBondContact O-N 3.45Å; L11-I15 VanDerWaalsContact O-N 3.12Å
12	I	84.9	Confident	82.8	Confident	108 Å²	108	111 Å²	111	55%	0.554	54%	0.542	S	S	*	.	H	α-helix	trans	-59.5	-42	177.9	-68.1	167.9	0	0	0	111.6	I8 Y9 P16	I8-I12 HydrophobicContact CG2-CD1 3.74Å; I8-I12 HydrophobicContact CG2-CG1 4.4Å; I8-I12 VanDerWaalsContact O-CG1 3.26Å; I8-I12 WeakPolarHBondContact O-CG1 3.47Å; I8-I12 PolarHBondContact O-N 3.2Å; Y9-I12 PolarHBondContact O-N 3.31Å; I12-P16 WeakPolarHBondContact O-CD 3.48Å
13	F	82.1	Confident	82.8	Confident	136 Å²	136	105.8 Å²	105.8	60%	0.596	52%	0.524	S	S	*	.	H	α-helix	trans	-71.2	-31.7	179.6	-164.6	-96.4	0	0	0	112.6	Y9 I10 L11 P16 S17	Y9-F13 WeakPolarHBondContact O-CB 3.46Å; Y9-F13 PolarHBondContact O-N 2.93Å; I10-F13 PolarHBondContact O-N 3.36Å; L11-F13 VanDerWaalsContact C-N 3.32Å; L11-F13 PolarHBondContact O-N 2.97Å; F13-P16 WeakPolarHBondContact O-CD 3.41Å; F13-P16 WeakPolarHBondContact O-CG 3.4Å; F13-S17 PolarHBondContact O-OG 3.23Å
14	S	82.6	Confident	82.8	Confident	26 Å²	26	105.9 Å²	105.9	18%	0.182	52%	0.52	C	S	.	.	H	α-helix	trans	-76.6	-33.4	-178.6	71.3	0	0	0	0	113.4	I10 L11 S17 Y18	I10-S14 VanDerWaalsContact O-CB 3.26Å; I10-S14 WeakPolarHBondContact O-CB 3.4Å; I10-S14 PolarHBondContact O-N 3.36Å; I10-S14 PolarHBondContact O-OG 3.48Å; L11-S14 PolarHBondContact O-N 2.96Å; L11-S14 PolarHBondContact O-OG 2.87Å; S14-S17 WeakPolarHBondContact O-CB 3.47Å; S14-S17 PolarHBondContact O-N 2.97Å; S14-S17 VanDerWaalsContact O-N 3.11Å; S14-Y18 WeakPolarHBondContact O-CD2 3.44Å; S14-Y18 PolarHBondContact O-N 2.93Å
15	I	80.7	Confident	82.5	Confident	92 Å²	92	104.7 Å²	104.7	47%	0.472	51%	0.514	S	S	.	.	H	α-helix	trans	-52.4	-53.3	-179.8	-69.1	160.9	0	0	0	112.7	L11 S17 Y18 V19	L11-I15 HydrophobicContact CG-CD1 4.38Å; L11-I15 VanDerWaalsContact O-CG1 3.28Å; L11-I15 WeakPolarHBondContact O-CG1 3.32Å; L11-I15 PolarHBondContact O-N 3.45Å; L11-I15 VanDerWaalsContact O-N 3.12Å; I15-S17 VanDerWaalsContact C-N 3.31Å; I15-S17 PolarHBondContact O-N 3.46Å; I15-Y18 PolarHBondContact O-N 3.3Å; I15-V19 WeakPolarHBondContact O-CG2 3.21Å; I15-V19 PolarHBondContact O-N 2.88Å
16	P	78	Confident	82.3	Confident	64 Å²	64	100.7 Å²	100.7	42%	0.416	50%	0.503	S	S	.	.	H	α-helix	trans	-64	-36.2	178.7	24.7	-33.4	0	0	0	111.9	I12 F13 Y18 V19 H20	I12-P16 WeakPolarHBondContact O-CD 3.48Å; F13-P16 WeakPolarHBondContact O-CD 3.41Å; F13-P16 WeakPolarHBondContact O-CG 3.4Å; P16-Y18 PolarHBondContact O-N 2.94Å; P16-V19 PolarHBondContact O-N 2.85Å; P16-H20 WeakPolarHBondContact O-CB 3.39Å; P16-H20 PolarHBondContact O-CD2 3.22Å; P16-H20 VanDerWaalsContact O-CD2 3.27Å; P16-H20 PolarHBondContact O-N 2.91Å
17	S	76.5	Confident	82.2	Confident	67 Å²	67	101.3 Å²	101.3	47%	0.469	51%	0.507	S	S	.	.	H	α-helix	trans	-62.9	-40.5	175.4	-55.6	0	0	0	0	112.2	F13 S14 I15 H20 F21	F13-S17 PolarHBondContact O-OG 3.23Å; S14-S17 WeakPolarHBondContact O-CB 3.47Å; S14-S17 PolarHBondContact O-N 2.97Å; S14-S17 VanDerWaalsContact O-N 3.11Å; I15-S17 VanDerWaalsContact C-N 3.31Å; I15-S17 PolarHBondContact O-N 3.46Å; S17-H20 PolarHBondContact O-N 3.27Å; S17-F21 WeakPolarHBondContact O-CB 3.45Å; S17-F21 PolarHBondContact O-N 3.4Å
18	Y	79.1	Confident	82	Confident	144 Å²	144	99.2 Å²	99.2	57%	0.565	50%	0.501	S	S	*	.	H	α-helix	trans	-64	-45.5	173.8	-77.9	-70.2	0	0	0	111.4	S14 I15 P16 H20 F21 Y22	S14-Y18 WeakPolarHBondContact O-CD2 3.44Å; S14-Y18 PolarHBondContact O-N 2.93Å; I15-Y18 PolarHBondContact O-N 3.3Å; P16-Y18 PolarHBondContact O-N 2.94Å; Y18-H20 VanDerWaalsContact C-N 3.32Å; Y18-H20 PolarHBondContact O-N 2.93Å; Y18-F21 WeakPolarHBondContact O-CB 3.49Å; Y18-F21 PolarHBondContact O-N 3.44Å; Y18-F21 VanDerWaalsContact O-N 3.14Å; Y18-Y22 WeakPolarHBondContact O-CD2 3.39Å; Y18-Y22 PolarHBondContact O-N 3.33Å
19	V	80.5	Confident	82	Confident	94 Å²	94	99.9 Å²	99.9	57%	0.57	51%	0.505	S	S	*	.	H	α-helix	trans	-62.3	-39.3	177.5	175.9	0	0	0	0	111.5	I15 P16 Y22 S23	I15-V19 WeakPolarHBondContact O-CG2 3.21Å; I15-V19 PolarHBondContact O-N 2.88Å; P16-V19 PolarHBondContact O-N 2.85Å; V19-Y22 PolarHBondContact O-N 2.87Å; V19-S23 WeakPolarHBondContact O-CB 3.47Å; V19-S23 PolarHBondContact O-N 2.91Å; V19-S23 PolarHBondContact O-OG 3.22Å
20	H	76.1	Confident	82	Confident	128 Å²	128	96.8 Å²	96.8	59%	0.593	50%	0.499	S	S	*	.	H	α-helix	trans	-63.6	-42.8	172.4	-90.1	-77.2	0	0	0	112	P16 S17 Y18 Y22 S23 V24	P16-H20 WeakPolarHBondContact O-CB 3.39Å; P16-H20 PolarHBondContact O-CD2 3.22Å; P16-H20 VanDerWaalsContact O-CD2 3.27Å; P16-H20 PolarHBondContact O-N 2.91Å; S17-H20 PolarHBondContact O-N 3.27Å; Y18-H20 VanDerWaalsContact C-N 3.32Å; Y18-H20 PolarHBondContact O-N 2.93Å; H20-Y22 PolarHBondContact O-N 3.36Å; H20-S23 WeakPolarHBondContact CA-OG 3.42Å; H20-S23 PolarHBondContact O-N 3.4Å; H20-S23 PolarHBondContact O-OG 2.74Å; H20-V24 VanDerWaalsContact O-CG2 3.3Å; H20-V24 WeakPolarHBondContact O-CG2 3.49Å; H20-V24 PolarHBondContact O-N 3.47Å
21	F	78.7	Confident	82	Confident	130 Å²	130	95.3 Å²	95.3	57%	0.57	50%	0.497	S	S	*	.	H	α-helix	trans	-62.4	-44.9	177.6	-172.2	-97.7	0	0	0	112	S17 Y18 S23 V24 L25	S17-F21 WeakPolarHBondContact O-CB 3.45Å; S17-F21 PolarHBondContact O-N 3.4Å; Y18-F21 WeakPolarHBondContact O-CB 3.49Å; Y18-F21 PolarHBondContact O-N 3.44Å; Y18-F21 VanDerWaalsContact O-N 3.14Å; F21-S23 VanDerWaalsContact C-N 3.3Å; F21-S23 PolarHBondContact O-N 3.43Å; F21-V24 PolarHBondContact O-N 3.32Å; F21-L25 HydrophobicContact CE1-CD2 4.18Å; F21-L25 VanDerWaalsContact O-CB 3.25Å; F21-L25 WeakPolarHBondContact O-CB 3.42Å; F21-L25 PolarHBondContact O-N 3.03Å
22	Y	80.4	Confident	82.2	Confident	164 Å²	164	94.7 Å²	94.7	64%	0.643	49%	0.494	S	S	*	.	H	α-helix	trans	-69.7	-22.8	177.6	-78.5	-71.7	0	0	0	114.2	Y18 V19 H20 P26	Y18-Y22 WeakPolarHBondContact O-CD2 3.39Å; Y18-Y22 PolarHBondContact O-N 3.33Å; V19-Y22 PolarHBondContact O-N 2.87Å; H20-Y22 PolarHBondContact O-N 3.36Å; Y22-P26 WeakPolarHBondContact O-CD 3.13Å; Y22-P26 VanDerWaalsContact O-CG 3.31Å; Y22-P26 WeakPolarHBondContact O-CG 3.49Å
23	S	81.5	Confident	82.3	Confident	56 Å²	56	92.3 Å²	92.3	39%	0.392	49%	0.487	S	S	.	.	H	α-helix	trans	-84	-38.7	174.3	55.9	0	0	0	0	112.2	V19 H20 F21 P26 L27	V19-S23 WeakPolarHBondContact O-CB 3.47Å; V19-S23 PolarHBondContact O-N 2.91Å; V19-S23 PolarHBondContact O-OG 3.22Å; H20-S23 WeakPolarHBondContact CA-OG 3.42Å; H20-S23 PolarHBondContact O-N 3.4Å; H20-S23 PolarHBondContact O-OG 2.74Å; F21-S23 VanDerWaalsContact C-N 3.3Å; F21-S23 PolarHBondContact O-N 3.43Å; S23-P26 WeakPolarHBondContact O-CD 3.32Å; S23-P26 VanDerWaalsContact O-CG 3.3Å; S23-P26 WeakPolarHBondContact O-CG 3.46Å; S23-L27 WeakPolarHBondContact O-CD1 3.43Å
24	V	83	Confident	82.7	Confident	85 Å²	85	91.6 Å²	91.6	52%	0.515	49%	0.485	S	S	.	.	H	α-helix	trans	-75.5	-35.6	-179.4	177	0	0	0	0	112.4	H20 F21 L27 L28	H20-V24 VanDerWaalsContact O-CG2 3.3Å; H20-V24 WeakPolarHBondContact O-CG2 3.49Å; H20-V24 PolarHBondContact O-N 3.47Å; F21-V24 PolarHBondContact O-N 3.32Å; V24-L27 WeakPolarHBondContact O-CB 3.47Å; V24-L27 PolarHBondContact O-N 3.22Å; V24-L28 PolarHBondContact O-N 2.88Å
25	L	83.7	Confident	83	Confident	72 Å²	72	97 Å²	97	38%	0.377	51%	0.505	S	S	.	.	H	α-helix	trans	-56.2	-49.7	-179.6	-173.6	64.6	0	0	0	114.3	F21 L27 L28 L29	F21-L25 HydrophobicContact CE1-CD2 4.18Å; F21-L25 VanDerWaalsContact O-CB 3.25Å; F21-L25 WeakPolarHBondContact O-CB 3.42Å; F21-L25 PolarHBondContact O-N 3.03Å; L25-L27 VanDerWaalsContact C-N 3.33Å; L25-L27 PolarHBondContact O-N 2.93Å; L25-L28 WeakPolarHBondContact O-CB 3.41Å; L25-L28 PolarHBondContact O-N 3.38Å; L25-L29 HydrophobicContact CG-CD1 4.4Å; L25-L29 WeakPolarHBondContact O-CG 3.47Å; L25-L29 PolarHBondContact O-N 3.38Å
26	P	81	Confident	83.4	Confident	68 Å²	68	100.4 Å²	100.4	44%	0.442	51%	0.514	S	S	.	.	H	α-helix	trans	-66.9	-32.7	177.7	25.9	-35.1	0	0	0	112.8	Y22 S23 L28 L29 L30	Y22-P26 WeakPolarHBondContact O-CD 3.13Å; Y22-P26 VanDerWaalsContact O-CG 3.31Å; Y22-P26 WeakPolarHBondContact O-CG 3.49Å; S23-P26 WeakPolarHBondContact O-CD 3.32Å; S23-P26 VanDerWaalsContact O-CG 3.3Å; S23-P26 WeakPolarHBondContact O-CG 3.46Å; P26-L28 VanDerWaalsContact C-N 3.32Å; P26-L28 PolarHBondContact O-N 2.94Å; P26-L29 PolarHBondContact O-N 3.38Å; P26-L30 VanDerWaalsContact O-CB 3.31Å; P26-L30 WeakPolarHBondContact O-CB 3.43Å; P26-L30 PolarHBondContact O-N 3.28Å
27	L	85.1	Confident	84	Confident	119 Å²	119	101.4 Å²	101.4	62%	0.623	52%	0.521	S	S	*	.	H	α-helix	trans	-61.7	-40.7	173.3	-93.2	141.8	0	0	0	111.5	S23 V24 L25 L30 S31	S23-L27 WeakPolarHBondContact O-CD1 3.43Å; V24-L27 WeakPolarHBondContact O-CB 3.47Å; V24-L27 PolarHBondContact O-N 3.22Å; L25-L27 VanDerWaalsContact C-N 3.33Å; L25-L27 PolarHBondContact O-N 2.93Å; L27-L30 PolarHBondContact O-N 3.02Å; L27-S31 PolarHBondContact O-N 3.47Å; L27-S31 VanDerWaalsContact O-N 3.08Å; L27-S31 PolarHBondContact O-OG 3.24Å
28	L	83.9	Confident	84.7	Confident	96 Å²	96	106.1 Å²	106.1	50%	0.503	53%	0.53	S	S	.	.	H	α-helix	trans	-68.6	-41.9	175.4	-162.8	97.7	0	0	0	112.1	V24 L25 P26 L30 S31 L32	V24-L28 PolarHBondContact O-N 2.88Å; L25-L28 WeakPolarHBondContact O-CB 3.41Å; L25-L28 PolarHBondContact O-N 3.38Å; P26-L28 VanDerWaalsContact C-N 3.32Å; P26-L28 PolarHBondContact O-N 2.94Å; L28-L30 VanDerWaalsContact C-N 3.29Å; L28-L30 PolarHBondContact O-N 3.21Å; L28-S31 PolarHBondContact O-N 2.9Å; L28-S31 PolarHBondContact O-OG 2.99Å; L28-L32 HydrophobicContact CD2-CD1 4.18Å; L28-L32 HydrophobicContact CG-CD1 4.39Å; L28-L32 WeakPolarHBondContact O-CB 3.49Å; L28-L32 WeakPolarHBondContact O-CG 3.45Å; L28-L32 PolarHBondContact O-N 3.4Å
29	L	86.9	Confident	85.2	Confident	106 Å²	106	106.7 Å²	106.7	56%	0.555	53%	0.532	S	S	*	.	H	α-helix	trans	-64	-37	176.3	-70.6	172.2	0	0	0	111.8	L25 P26 S33	L25-L29 HydrophobicContact CG-CD1 4.4Å; L25-L29 WeakPolarHBondContact O-CG 3.47Å; L25-L29 PolarHBondContact O-N 3.38Å; P26-L29 PolarHBondContact O-N 3.38Å; L29-S33 WeakPolarHBondContact O-CB 3.42Å; L29-S33 PolarHBondContact O-N 3.03Å
30	L	85.9	Confident	85.7	Confident	94 Å²	94	109.3 Å²	109.3	49%	0.492	53%	0.533	S	S	.	.	H	α-helix	trans	-67.9	-40.7	176.4	-173.4	67.7	0	0	0	112.1	P26 L27 L28 S33 H34	P26-L30 VanDerWaalsContact O-CB 3.31Å; P26-L30 WeakPolarHBondContact O-CB 3.43Å; P26-L30 PolarHBondContact O-N 3.28Å; L27-L30 PolarHBondContact O-N 3.02Å; L28-L30 VanDerWaalsContact C-N 3.29Å; L28-L30 PolarHBondContact O-N 3.21Å; L30-S33 PolarHBondContact O-N 3.2Å; L30-S33 PolarHBondContact O-OG 3Å; L30-H34 PolarHBondContact O-N 2.93Å; L30-H34 VanDerWaalsContact O-N 3.11Å
31	S	87.7	Confident	86.4	Confident	65 Å²	65	110.9 Å²	110.9	46%	0.455	54%	0.535	S	S	.	.	H	α-helix	trans	-69	-38.1	176.6	65.2	0	0	0	0	112	L27 L28 H34 F35	L27-S31 PolarHBondContact O-N 3.47Å; L27-S31 VanDerWaalsContact O-N 3.08Å; L27-S31 PolarHBondContact O-OG 3.24Å; L28-S31 PolarHBondContact O-N 2.9Å; L28-S31 PolarHBondContact O-OG 2.99Å; S31-H34 PolarHBondContact O-N 2.92Å; S31-F35 PolarHBondContact O-N 3.48Å
32	L	86.7	Confident	86.9	Confident	75 Å²	75	110.2 Å²	110.2	39%	0.393	53%	0.532	S	S	.	.	H	α-helix	trans	-61.4	-44.9	172.7	-78.6	164.8	0	0	0	111.6	L28 H34 F35 Y36	L28-L32 HydrophobicContact CD2-CD1 4.18Å; L28-L32 HydrophobicContact CG-CD1 4.39Å; L28-L32 WeakPolarHBondContact O-CB 3.49Å; L28-L32 WeakPolarHBondContact O-CG 3.45Å; L28-L32 PolarHBondContact O-N 3.4Å; L32-H34 VanDerWaalsContact C-N 3.33Å; L32-H34 PolarHBondContact O-N 2.97Å; L32-F35 WeakPolarHBondContact O-CB 3.4Å; L32-F35 PolarHBondContact O-N 3.31Å; L32-F35 VanDerWaalsContact O-N 3.16Å; L32-Y36 WeakPolarHBondContact O-CD2 3.25Å; L32-Y36 PolarHBondContact O-N 2.98Å
33	S	88.6	Confident	87.3	Confident	57 Å²	57	105.9 Å²	105.9	40%	0.399	52%	0.52	S	S	.	.	H	α-helix	trans	-63.6	-38.8	179	72.3	0	0	0	0	112.1	L29 L30 Y36 C37	L29-S33 WeakPolarHBondContact O-CB 3.42Å; L29-S33 PolarHBondContact O-N 3.03Å; L30-S33 PolarHBondContact O-N 3.2Å; L30-S33 PolarHBondContact O-OG 3Å; S33-Y36 PolarHBondContact O-N 3.35Å; S33-C37 VanDerWaalsContact O-CB 3.32Å; S33-C37 WeakPolarHBondContact O-CB 3.31Å; S33-C37 PolarHBondContact O-N 2.95Å
34	H	89.7	Confident	87.7	Confident	121 Å²	121	107.1 Å²	107.1	56%	0.56	52%	0.521	S	S	*	.	H	α-helix	trans	-63.8	-41.3	172.5	-70.1	175.3	0	0	0	112.2	L30 S31 L32 C37 Y38	L30-H34 PolarHBondContact O-N 2.93Å; L30-H34 VanDerWaalsContact O-N 3.11Å; S31-H34 PolarHBondContact O-N 2.92Å; L32-H34 VanDerWaalsContact C-N 3.33Å; L32-H34 PolarHBondContact O-N 2.97Å; H34-C37 PolarHBondContact O-N 3.28Å; H34-Y38 WeakPolarHBondContact O-CB 3.49Å; H34-Y38 PolarHBondContact O-N 3.34Å
35	F	88.9	Confident	88.1	Confident	140 Å²	140	108.4 Å²	108.4	61%	0.614	52%	0.52	S	S	*	.	H	α-helix	trans	-62.6	-45.2	176.8	-172.1	-95.8	0	0	0	111.9	S31 L32 Y38 Y39	S31-F35 PolarHBondContact O-N 3.48Å; L32-F35 WeakPolarHBondContact O-CB 3.4Å; L32-F35 PolarHBondContact O-N 3.31Å; L32-F35 VanDerWaalsContact O-N 3.16Å; F35-Y38 PolarHBondContact O-N 3.34Å; F35-Y39 PolarHBondContact O-N 2.97Å
36	Y	89.2	Confident	88.4	Confident	164 Å²	164	110.5 Å²	110.5	64%	0.643	53%	0.527	S	S	*	.	H	α-helix	trans	-63.2	-41.5	174.7	-79.3	-67.1	0	0	0	112.4	L32 S33 Y39 Y40	L32-Y36 WeakPolarHBondContact O-CD2 3.25Å; L32-Y36 PolarHBondContact O-N 2.98Å; S33-Y36 PolarHBondContact O-N 3.35Å; Y36-Y39 PolarHBondContact O-N 3.49Å; Y36-Y40 WeakPolarHBondContact O-CB 3.39Å; Y36-Y40 PolarHBondContact O-N 3.01Å
37	C	90.4	Very high	88.9	Confident	85 Å²	85	111.4 Å²	111.4	57%	0.574	53%	0.527	S	S	*	.	H	α-helix	trans	-62.5	-44.1	177	-172.7	0	0	0	0	111.6	S33 H34 Y40 Y41	S33-C37 VanDerWaalsContact O-CB 3.32Å; S33-C37 WeakPolarHBondContact O-CB 3.31Å; S33-C37 PolarHBondContact O-N 2.95Å; H34-C37 PolarHBondContact O-N 3.28Å; C37-Y40 PolarHBondContact O-N 3.37Å; C37-Y41 WeakPolarHBondContact O-CB 2.92Å; C37-Y41 PolarHBondContact O-N 3.34Å
38	Y	91	Very high	89.2	Confident	166 Å²	166	111.4 Å²	111.4	65%	0.651	52%	0.522	S	S	*	.	H	α-helix	trans	-61.9	-44.6	176.7	-175.7	-95.2	0	0	0	111.9	H34 F35 Y40 Y41 F42	H34-Y38 WeakPolarHBondContact O-CB 3.49Å; H34-Y38 PolarHBondContact O-N 3.34Å; F35-Y38 PolarHBondContact O-N 3.34Å; Y38-Y40 PolarHBondContact O-N 3.43Å; Y38-Y41 PolarHBondContact O-N 2.93Å; Y38-F42 WeakPolarHBondContact O-CB 3.31Å; Y38-F42 PolarHBondContact O-N 3.46Å
39	Y	90.5	Very high	89.5	Confident	155 Å²	155	110 Å²	110	61%	0.608	51%	0.514	S	S	*	.	H	α-helix	trans	-62.2	-43.4	177.4	-168.3	-94.6	0	0	0	111.9	F35 Y36 F42 D43	F35-Y39 PolarHBondContact O-N 2.97Å; Y36-Y39 PolarHBondContact O-N 3.49Å; Y39-F42 PolarHBondContact O-N 3.39Å; Y39-D43 PolarHBondContact O-N 2.97Å
40	Y	91.7	Very high	89.6	Confident	149 Å²	149	109.6 Å²	109.6	58%	0.584	51%	0.512	S	S	*	.	H	α-helix	trans	-64	-41.4	177	-173.8	-104.2	0	0	0	112.4	Y36 C37 Y38 F42 D43 L44	Y36-Y40 WeakPolarHBondContact O-CB 3.39Å; Y36-Y40 PolarHBondContact O-N 3.01Å; C37-Y40 PolarHBondContact O-N 3.37Å; Y38-Y40 PolarHBondContact O-N 3.43Å; Y40-F42 VanDerWaalsContact C-N 3.32Å; Y40-F42 PolarHBondContact O-N 2.92Å; Y40-D43 PolarHBondContact O-N 3.16Å; Y40-L44 HydrophobicContact CD1-CD1 3.86Å; Y40-L44 HydrophobicContact CD1-CG 4.37Å; Y40-L44 HydrophobicContact CE1-CD1 3.38Å; Y40-L44 HydrophobicContact CE1-CG 4.01Å; Y40-L44 WeakPolarHBondContact O-CG 3.13Å; Y40-L44 PolarHBondContact O-N 2.96Å
41	Y	89.2	Confident	89.7	Confident	162 Å²	162	109.8 Å²	109.8	64%	0.635	51%	0.51	S	S	*	.	H	α-helix	trans	-63.2	-40.1	175.4	-172.6	-96.1	0	0	0	111.9	C37 Y38 F45	C37-Y41 WeakPolarHBondContact O-CB 2.92Å; C37-Y41 PolarHBondContact O-N 3.34Å; Y38-Y41 PolarHBondContact O-N 2.93Å; Y41-F45 WeakPolarHBondContact O-CB 3.32Å; Y41-F45 PolarHBondContact O-N 3Å
42	F	89.1	Confident	89.7	Confident	116 Å²	116	109.5 Å²	109.5	51%	0.509	50%	0.502	S	S	.	.	H	α-helix	trans	-63	-43.3	175.8	-176.3	-97.2	0	0	0	112.1	Y38 Y39 Y40 F45 F46	Y38-F42 WeakPolarHBondContact O-CB 3.31Å; Y38-F42 PolarHBondContact O-N 3.46Å; Y39-F42 PolarHBondContact O-N 3.39Å; Y40-F42 VanDerWaalsContact C-N 3.32Å; Y40-F42 PolarHBondContact O-N 2.92Å; F42-F45 PolarHBondContact O-N 3.37Å; F42-F46 PolarHBondContact O-N 2.93Å
43	D	89.6	Confident	89.6	Confident	73 Å²	73	110.3 Å²	110.3	39%	0.39	51%	0.507	S	S	.	.	H	α-helix	trans	-63.3	-45.7	177.6	-169.9	40.3	0	0	0	111.9	Y39 Y40 F45 F46 L47	Y39-D43 PolarHBondContact O-N 2.97Å; Y40-D43 PolarHBondContact O-N 3.16Å; D43-F45 VanDerWaalsContact C-N 3.33Å; D43-F45 PolarHBondContact O-N 3.08Å; D43-F46 PolarHBondContact O-N 2.9Å; D43-L47 WeakPolarHBondContact O-CG 3.49Å; D43-L47 PolarHBondContact O-N 3.48Å
44	L	90.1	Very high	89.2	Confident	81 Å²	81	110.5 Å²	110.5	42%	0.424	51%	0.508	S	S	.	.	H	α-helix	trans	-60.1	-41.9	174.4	-73.6	179.7	0	0	0	112.6	Y40 L47 F48	Y40-L44 HydrophobicContact CD1-CD1 3.86Å; Y40-L44 HydrophobicContact CD1-CG 4.37Å; Y40-L44 HydrophobicContact CE1-CD1 3.38Å; Y40-L44 HydrophobicContact CE1-CG 4.01Å; Y40-L44 WeakPolarHBondContact O-CG 3.13Å; Y40-L44 PolarHBondContact O-N 2.96Å; L44-L47 PolarHBondContact O-N 3.24Å; L44-F48 WeakPolarHBondContact O-CB 3.3Å; L44-F48 PolarHBondContact O-N 3.44Å
45	F	91	Very high	88.7	Confident	112 Å²	112	112.3 Å²	112.3	49%	0.491	51%	0.51	S	S	.	.	H	α-helix	trans	-62.3	-44.4	176.2	-178.5	-100.1	0	0	0	111.1	Y41 F42 D43 F48 I49	Y41-F45 WeakPolarHBondContact O-CB 3.32Å; Y41-F45 PolarHBondContact O-N 3Å; F42-F45 PolarHBondContact O-N 3.37Å; D43-F45 VanDerWaalsContact C-N 3.33Å; D43-F45 PolarHBondContact O-N 3.08Å; F45-F48 WeakPolarHBondContact O-CB 3.45Å; F45-F48 PolarHBondContact O-N 3.45Å; F45-I49 HydrophobicContact CD1-CG1 4.3Å; F45-I49 HydrophobicContact CE1-CD1 4.39Å; F45-I49 HydrophobicContact CE1-CG1 3.92Å; F45-I49 HydrophobicContact CE2-CD1 4.43Å; F45-I49 HydrophobicContact CZ-CD1 4.03Å; F45-I49 HydrophobicContact CZ-CG1 4.05Å; F45-I49 WeakPolarHBondContact O-CG1 3.43Å; F45-I49 PolarHBondContact O-N 2.88Å
46	F	90.2	Very high	87.9	Confident	117 Å²	117	113.8 Å²	113.8	51%	0.513	51%	0.511	S	S	.	.	H	α-helix	trans	-62.9	-45	177.8	-173.7	-99.7	0	0	0	112.4	F42 D43 F48 I49 L50	F42-F46 PolarHBondContact O-N 2.93Å; D43-F46 PolarHBondContact O-N 2.9Å; F46-F48 VanDerWaalsContact C-N 3.28Å; F46-F48 PolarHBondContact O-N 3.4Å; F46-I49 PolarHBondContact O-N 3.11Å; F46-L50 PolarHBondContact O-N 2.87Å
47	L	91	Very high	86.9	Confident	87 Å²	87	109.7 Å²	109.7	46%	0.455	51%	0.506	S	S	.	.	H	α-helix	trans	-58.5	-40	174	-73.4	171.5	0	0	0	112.1	D43 L44 L50 F51	D43-L47 WeakPolarHBondContact O-CG 3.49Å; D43-L47 PolarHBondContact O-N 3.48Å; L44-L47 PolarHBondContact O-N 3.24Å; L47-L50 PolarHBondContact O-N 2.99Å; L47-F51 WeakPolarHBondContact O-CB 3.42Å; L47-F51 PolarHBondContact O-N 3.45Å
48	F	92.3	Very high	85.8	Confident	118 Å²	118	110.2 Å²	110.2	52%	0.518	51%	0.506	S	S	.	.	H	α-helix	trans	-65.2	-42	176.8	-175.7	-105.6	0	0	0	112.4	L44 F45 F46 F51 I52	L44-F48 WeakPolarHBondContact O-CB 3.3Å; L44-F48 PolarHBondContact O-N 3.44Å; F45-F48 WeakPolarHBondContact O-CB 3.45Å; F45-F48 PolarHBondContact O-N 3.45Å; F46-F48 VanDerWaalsContact C-N 3.28Å; F46-F48 PolarHBondContact O-N 3.4Å; F48-F51 WeakPolarHBondContact O-CB 3.33Å; F48-F51 PolarHBondContact O-N 3.5Å; F48-I52 HydrophobicContact CD1-CD1 3.83Å; F48-I52 HydrophobicContact CE1-CD1 3.35Å; F48-I52 HydrophobicContact CE1-CG1 4.28Å; F48-I52 HydrophobicContact CZ-CD1 3.79Å; F48-I52 HydrophobicContact CZ-CG1 4.38Å; F48-I52 WeakPolarHBondContact O-CG1 3.3Å; F48-I52 PolarHBondContact O-N 3.24Å
49	I	90.1	Very high	84.3	Confident	66 Å²	66	104.7 Å²	104.7	34%	0.338	50%	0.495	S	S	.	.	H	α-helix	trans	-63.8	-43	174.7	-63.6	-60.1	0	0	0	111	F45 F46 F51 I52 L53	F45-I49 HydrophobicContact CD1-CG1 4.3Å; F45-I49 HydrophobicContact CE1-CD1 4.39Å; F45-I49 HydrophobicContact CE1-CG1 3.92Å; F45-I49 HydrophobicContact CE2-CD1 4.43Å; F45-I49 HydrophobicContact CZ-CD1 4.03Å; F45-I49 HydrophobicContact CZ-CG1 4.05Å; F45-I49 WeakPolarHBondContact O-CG1 3.43Å; F45-I49 PolarHBondContact O-N 2.88Å; F46-I49 PolarHBondContact O-N 3.11Å; I49-F51 VanDerWaalsContact C-N 3.27Å; I49-F51 PolarHBondContact O-N 3.34Å; I49-I52 PolarHBondContact O-N 3.5Å; I49-L53 HydrophobicContact CG2-CD1 3.94Å; I49-L53 WeakPolarHBondContact O-CG 3.45Å; I49-L53 PolarHBondContact O-N 2.99Å
50	L	88.4	Confident	83.1	Confident	98 Å²	98	101.3 Å²	101.3	51%	0.513	49%	0.491	S	S	.	.	H	α-helix	trans	-59.5	-40	175.3	-166.8	81	0	0	0	111.4	F46 L47 L53 S54	F46-L50 PolarHBondContact O-N 2.87Å; L47-L50 PolarHBondContact O-N 2.99Å; L50-L53 PolarHBondContact O-N 3.5Å; L50-S54 PolarHBondContact O-N 3.49Å; L50-S54 PolarHBondContact O-OG 3.47Å
51	F	89.2	Confident	81.6	Confident	99 Å²	99	98 Å²	98	43%	0.434	49%	0.489	S	S	.	.	H	α-helix	trans	-65.6	-40.6	175.9	-178.1	-100.1	0	0	0	112.9	L47 F48 I49 S54 R55	L47-F51 WeakPolarHBondContact O-CB 3.42Å; L47-F51 PolarHBondContact O-N 3.45Å; F48-F51 WeakPolarHBondContact O-CB 3.33Å; F48-F51 PolarHBondContact O-N 3.5Å; I49-F51 VanDerWaalsContact C-N 3.27Å; I49-F51 PolarHBondContact O-N 3.34Å; F51-S54 PolarHBondContact O-OG 3.4Å; F51-R55 HydrophobicContact CE1-CG 4.36Å; F51-R55 HydrophobicContact CZ-CG 4.48Å; F51-R55 WeakPolarHBondContact O-CG 3.49Å; F51-R55 PolarHBondContact O-N 3.02Å
52	I	86.2	Confident	80.1	Confident	59 Å²	59	93.3 Å²	93.3	30%	0.303	48%	0.48	S	S	.	.	H	α-helix	trans	-64.9	-43.2	173.8	-68.6	171.6	0	0	0	110.5	F48 I49 R55 R56	F48-I52 HydrophobicContact CD1-CD1 3.83Å; F48-I52 HydrophobicContact CE1-CD1 3.35Å; F48-I52 HydrophobicContact CE1-CG1 4.28Å; F48-I52 HydrophobicContact CZ-CD1 3.79Å; F48-I52 HydrophobicContact CZ-CG1 4.38Å; F48-I52 WeakPolarHBondContact O-CG1 3.3Å; F48-I52 PolarHBondContact O-N 3.24Å; I49-I52 PolarHBondContact O-N 3.5Å; I52-R55 PolarHBondContact O-N 3.43Å; I52-R56 HydrophobicContact CG2-CG 4.49Å; I52-R56 WeakPolarHBondContact O-CG 3.06Å; I52-R56 PolarHBondContact O-N 2.97Å
53	L	85.4	Confident	78.4	Confident	92 Å²	92	92.7 Å²	92.7	48%	0.482	48%	0.482	S	S	.	.	H	α-helix	trans	-61	-45.8	177.4	-79.5	162.2	0	0	0	111.4	I49 L50 R55 R56 C57	I49-L53 HydrophobicContact CG2-CD1 3.94Å; I49-L53 WeakPolarHBondContact O-CG 3.45Å; I49-L53 PolarHBondContact O-N 2.99Å; L50-L53 PolarHBondContact O-N 3.5Å; L53-R55 VanDerWaalsContact C-N 3.33Å; L53-R55 PolarHBondContact O-N 2.91Å; L53-R56 PolarHBondContact O-N 2.94Å; L53-C57 PolarHBondContact O-N 3.29Å; L53-C57 PolarHBondContact O-SG 3.02Å
54	S	80	Confident	76.9	Confident	61 Å²	61	93 Å²	93	43%	0.427	49%	0.486	S	S	.	.	H	α-helix	trans	-63	-39.4	177.3	68.7	0	0	0	0	111.9	L50 F51 C57 T58	L50-S54 PolarHBondContact O-N 3.49Å; L50-S54 PolarHBondContact O-OG 3.47Å; F51-S54 PolarHBondContact O-OG 3.4Å; S54-C57 PolarHBondContact O-N 2.93Å; S54-T58 PolarHBondContact O-N 3.48Å; S54-T58 PolarHBondContact O-OG1 2.86Å
55	R	78.5	Confident	75.2	Confident	159 Å²	159	95.3 Å²	95.3	60%	0.6	49%	0.493	S	S	*	.	H	α-helix	trans	-63	-44.4	172.7	-78.9	-168.9	170	-164.4	-0.7	112.7	F51 I52 L53 C57 T58 A59	F51-R55 HydrophobicContact CE1-CG 4.36Å; F51-R55 HydrophobicContact CZ-CG 4.48Å; F51-R55 WeakPolarHBondContact O-CG 3.49Å; F51-R55 PolarHBondContact O-N 3.02Å; I52-R55 PolarHBondContact O-N 3.43Å; L53-R55 VanDerWaalsContact C-N 3.33Å; L53-R55 PolarHBondContact O-N 2.91Å; R55-C57 VanDerWaalsContact C-N 3.31Å; R55-C57 PolarHBondContact O-N 3.14Å; R55-T58 WeakPolarHBondContact CA-OG1 3.26Å; R55-T58 PolarHBondContact O-N 3.2Å; R55-T58 PolarHBondContact O-OG1 3.2Å; R55-A59 PolarHBondContact O-N 3.3Å
56	R	72.9	Confident	73.3	Confident	171 Å²	171	95.2 Å²	95.2	65%	0.645	50%	0.497	S	S	*	.	H	α-helix	trans	-58.4	-45	174.8	-75.9	-177.7	177.2	-170.1	0.1	110.8	I52 L53 T58 A59 T60	I52-R56 HydrophobicContact CG2-CG 4.49Å; I52-R56 WeakPolarHBondContact O-CG 3.06Å; I52-R56 PolarHBondContact O-N 2.97Å; L53-R56 PolarHBondContact O-N 2.94Å; R56-T58 PolarHBondContact O-N 2.83Å; R56-A59 PolarHBondContact O-N 3.24Å; R56-T60 PolarHBondContact O-N 2.89Å; R56-T60 PolarHBondContact O-OG1 3.48Å
57	C	67.5	Low	71.5	Confident	77 Å²	77	97.3 Å²	97.3	52%	0.52	51%	0.508	S	S	.	.	H	α-helix	trans	-59.1	-46.4	175.2	-66	0	0	0	0	112	L53 S54 R55 A59 T60 C61	L53-C57 PolarHBondContact O-N 3.29Å; L53-C57 PolarHBondContact O-SG 3.02Å; S54-C57 PolarHBondContact O-N 2.93Å; R55-C57 VanDerWaalsContact C-N 3.31Å; R55-C57 PolarHBondContact O-N 3.14Å; C57-A59 VanDerWaalsContact C-N 3.33Å; C57-A59 PolarHBondContact O-N 3.41Å; C57-T60 PolarHBondContact O-N 3.02Å; C57-C61 WeakPolarHBondContact O-CB 3.03Å; C57-C61 PolarHBondContact O-N 3.4Å; C57-C61 PolarHBondContact O-SG 3.01Å
58	T	68.1	Low	70	Confident	96 Å²	96	97.2 Å²	97.2	59%	0.589	52%	0.515	S	S	*	.	H	α-helix	trans	-62	-38.4	176.6	55.9	0	0	0	0	113	S54 R55 R56 C61 S62	S54-T58 PolarHBondContact O-N 3.48Å; S54-T58 PolarHBondContact O-OG1 2.86Å; R55-T58 WeakPolarHBondContact CA-OG1 3.26Å; R55-T58 PolarHBondContact O-N 3.2Å; R55-T58 PolarHBondContact O-OG1 3.2Å; R56-T58 PolarHBondContact O-N 2.83Å; T58-C61 PolarHBondContact O-N 3.11Å; T58-S62 WeakPolarHBondContact O-CB 3.35Å; T58-S62 PolarHBondContact O-N 3.12Å
59	A	58.9	Low	68.3	Low	51 Å²	51	97.3 Å²	97.3	42%	0.421	52%	0.517	S	S	.	.	H	α-helix	trans	-67.8	-41.8	175.8	0	0	0	0	0	111.9	R55 R56 C57 S62 N63	R55-A59 PolarHBondContact O-N 3.3Å; R56-A59 PolarHBondContact O-N 3.24Å; C57-A59 VanDerWaalsContact C-N 3.33Å; C57-A59 PolarHBondContact O-N 3.41Å; A59-S62 PolarHBondContact O-N 2.85Å; A59-N63 PolarHBondContact O-N 3.3Å
60	T	65	Low	66.3	Low	84 Å²	84	104.4 Å²	104.4	52%	0.515	54%	0.539	S	S	.	.	H	α-helix	trans	-63.4	-42.1	175.1	-52.1	0	0	0	0	111.3	R56 C57 N63 T64	R56-T60 PolarHBondContact O-N 2.89Å; R56-T60 PolarHBondContact O-OG1 3.48Å; C57-T60 PolarHBondContact O-N 3.02Å; T60-N63 PolarHBondContact O-N 3.27Å; T60-T64 PolarHBondContact O-N 3.47Å; T60-T64 PolarHBondContact O-OG1 3.19Å
61	C	60.3	Low	64.5	Low	80 Å²	80	104.2 Å²	104.2	54%	0.541	54%	0.544	S	S	.	.	H	α-helix	trans	-65.5	-38.2	176.1	-66.5	0	0	0	0	112.8	C57 T58 T64 F65	C57-C61 WeakPolarHBondContact O-CB 3.03Å; C57-C61 PolarHBondContact O-N 3.4Å; C57-C61 PolarHBondContact O-SG 3.01Å; T58-C61 PolarHBondContact O-N 3.11Å; C61-T64 WeakPolarHBondContact CA-OG1 3.35Å; C61-T64 PolarHBondContact O-OG1 3.4Å; C61-T64 VanDerWaalsContact O-OG1 3.06Å; C61-F65 WeakPolarHBondContact O-CB 3.33Å; C61-F65 PolarHBondContact O-N 2.99Å
62	S	57.6	Low	62.7	Low	63 Å²	63	106.8 Å²	106.8	44%	0.441	56%	0.56	S	S	.	*	H	α-helix	trans	-64.4	-42.6	173.8	-177.3	0	0	0	0	111.4	T58 A59 F65 L66	T58-S62 WeakPolarHBondContact O-CB 3.35Å; T58-S62 PolarHBondContact O-N 3.12Å; A59-S62 PolarHBondContact O-N 2.85Å; S62-F65 PolarHBondContact O-N 3.33Å; S62-L66 WeakPolarHBondContact O-CB 3.28Å; S62-L66 PolarHBondContact O-N 3.4Å
63	N	55.3	Low	60.9	Low	103 Å²	103	111 Å²	111	55%	0.551	58%	0.582	S	S	*	*	H	α-helix	trans	-66	-41.8	177.1	-76.5	-14.8	0	0	0	112.2	A59 T60 L66 Q67	A59-N63 PolarHBondContact O-N 3.3Å; T60-N63 PolarHBondContact O-N 3.27Å; N63-L66 PolarHBondContact O-N 3.38Å; N63-Q67 WeakPolarHBondContact O-CB 3.37Å; N63-Q67 PolarHBondContact O-N 3.49Å
64	T	56.6	Low	58.8	Low	78 Å²	78	111.9 Å²	111.9	48%	0.479	59%	0.592	S	S	.	*	H	α-helix	trans	-67.9	-36.2	175.4	52.1	0	0	0	0	111.9	T60 C61 Q67 S68	T60-T64 PolarHBondContact O-N 3.47Å; T60-T64 PolarHBondContact O-OG1 3.19Å; C61-T64 WeakPolarHBondContact CA-OG1 3.35Å; C61-T64 PolarHBondContact O-OG1 3.4Å; C61-T64 VanDerWaalsContact O-OG1 3.06Å; T64-Q67 PolarHBondContact O-N 2.96Å; T64-S68 VanDerWaalsContact O-CB 3.31Å; T64-S68 WeakPolarHBondContact O-CB 3.48Å; T64-S68 PolarHBondContact O-N 3.41Å; T64-S68 PolarHBondContact O-OG 3.44Å
65	F	55	Low	57.2	Low	130 Å²	130	120.5 Å²	120.5	57%	0.57	63%	0.631	S	S	*	*	H	α-helix	trans	-63.2	-48.8	173.2	-169.6	-96.6	0	0	0	111.3	C61 S62 Q67 S68 H69	C61-F65 WeakPolarHBondContact O-CB 3.33Å; C61-F65 PolarHBondContact O-N 2.99Å; S62-F65 PolarHBondContact O-N 3.33Å; F65-Q67 VanDerWaalsContact C-N 3.29Å; F65-Q67 PolarHBondContact O-N 3.12Å; F65-S68 WeakPolarHBondContact CA-OG 3.45Å; F65-S68 PolarHBondContact O-N 3.38Å; F65-S68 PolarHBondContact O-OG 3.39Å; F65-H69 AromaticContact CD2-CD2 3.86Å; F65-H69 AromaticContact CE1-CD2 3.64Å; F65-H69 AromaticContact CE2-CD2 3.41Å; F65-H69 VanDerWaalsContact CE2-CD2 3.41Å; F65-H69 WeakPolarHBondContact CE2-CD2 3.41Å; F65-H69 AromaticContact CE2-NE2 3.53Å; F65-H69 AromaticContact CZ-CD2 3.29Å; F65-H69 WeakPolarHBondContact CZ-CD2 3.26Å; F65-H69 AromaticContact CZ-NE2 3.5Å; F65-H69 WeakPolarHBondContact O-CB 3.48Å; F65-H69 PolarHBondContact O-N 3.38Å
66	L	50.6	Low	56.1	Low	111 Å²	111	118.6 Å²	118.6	58%	0.581	63%	0.633	S	S	*	*	H	α-helix	trans	-60	-36.6	174.6	-84.3	161	0	0	0	112.8	S62 N63 H69 R70	S62-L66 WeakPolarHBondContact O-CB 3.28Å; S62-L66 PolarHBondContact O-N 3.4Å; N63-L66 PolarHBondContact O-N 3.38Å; L66-H69 CarbonylContact O-C 3.47Å; L66-R70 PolarHBondContact O-N 2.94Å
67	Q	53.6	Low	55.2	Low	160 Å²	160	115.8 Å²	115.8	75%	0.748	63%	0.632	S	S	*	*	H	α-helix	trans	-75.2	-34.4	178.8	-156.7	167	20.1	0	0	111.8	N63 T64 F65	N63-Q67 WeakPolarHBondContact O-CB 3.37Å; N63-Q67 PolarHBondContact O-N 3.49Å; T64-Q67 PolarHBondContact O-N 2.96Å; F65-Q67 VanDerWaalsContact C-N 3.29Å; F65-Q67 PolarHBondContact O-N 3.12Å
68	S	59.5	Low	54.6	Low	85 Å²	85	117.9 Å²	117.9	59%	0.594	64%	0.638	S	S	*	*	H	α-helix	trans	-72.8	-28.5	173.1	71	0	0	0	0	113.2	T64 F65	T64-S68 VanDerWaalsContact O-CB 3.31Å; T64-S68 WeakPolarHBondContact O-CB 3.48Å; T64-S68 PolarHBondContact O-N 3.41Å; T64-S68 PolarHBondContact O-OG 3.44Å; F65-S68 WeakPolarHBondContact CA-OG 3.45Å; F65-S68 PolarHBondContact O-N 3.38Å; F65-S68 PolarHBondContact O-OG 3.39Å
69	H	55	Low	53.8	Low	120 Å²	120	119.2 Å²	119.2	56%	0.556	64%	0.641	S	S	*	*	T	Hydrogen-bonded Turn	trans	-108.5	23.9	179.7	-80.3	-73.4	0	0	0	113.7	F65 L66 P71	F65-H69 AromaticContact CD2-CD2 3.86Å; F65-H69 AromaticContact CE1-CD2 3.64Å; F65-H69 AromaticContact CE2-CD2 3.41Å; F65-H69 VanDerWaalsContact CE2-CD2 3.41Å; F65-H69 WeakPolarHBondContact CE2-CD2 3.41Å; F65-H69 AromaticContact CE2-NE2 3.53Å; F65-H69 AromaticContact CZ-CD2 3.29Å; F65-H69 WeakPolarHBondContact CZ-CD2 3.26Å; F65-H69 AromaticContact CZ-NE2 3.5Å; F65-H69 WeakPolarHBondContact O-CB 3.48Å; F65-H69 PolarHBondContact O-N 3.38Å; L66-H69 CarbonylContact O-C 3.47Å; H69-P71 WeakPolarHBondContact O-CD 3.27Å
70	R	49.1	Very low	53.4	Low	215 Å²	215	123.5 Å²	123.5	81%	0.811	66%	0.655	S	S	*	*			trans	-85.2	87.7	156.5	-158.1	-178.6	-166.2	-167	4.1	106.3	L66 I72	L66-R70 PolarHBondContact O-N 2.94Å; R70-I72 PolarHBondContact O-N 3.41Å; R70-I72 VanDerWaalsContact O-N 3.07Å
71	P	49.5	Very low	52.7	Low	94 Å²	94	126.1 Å²	126.1	61%	0.61	66%	0.664	S	S	*	*			trans	-58.5	121.9	172.7	28.2	-35.8	0	0	0	106.8	H69 I73	H69-P71 WeakPolarHBondContact O-CD 3.27Å; P71-I73 HydrophobicContact CB-CG1 4.16Å; P71-I73 HydrophobicContact CG-CD1 4.5Å; P71-I73 HydrophobicContact CG-CG1 4.46Å; P71-I73 PolarHBondContact O-N 2.96Å
72	I	52.2	Low	52.1	Low	153 Å²	153	129.4 Å²	129.4	79%	0.785	67%	0.673	S	S	*	*			trans	-62.9	81.6	165.2	-61.9	162.9	0	0	0	105.5	R70 T74	R70-I72 PolarHBondContact O-N 3.41Å; R70-I72 VanDerWaalsContact O-N 3.07Å; I72-T74 WeakPolarHBondContact CG2-OG1 3.37Å; I72-T74 PolarHBondContact O-N 2.98Å
73	I	47.8	Very low	51.7	Low	149 Å²	149	134.5 Å²	134.5	76%	0.764	69%	0.691	S	S	*	*			trans	-94.6	69	159.9	-50.7	178.1	0	0	0	105.1	P71	P71-I73 HydrophobicContact CB-CG1 4.16Å; P71-I73 HydrophobicContact CG-CD1 4.5Å; P71-I73 HydrophobicContact CG-CG1 4.46Å; P71-I73 PolarHBondContact O-N 2.96Å
74	T	41.7	Very low	51.4	Low	110 Å²	110	137.2 Å²	137.2	68%	0.675	70%	0.703	S	S	*	*			trans	-114.7	85.9	158.4	43	0	0	0	0	106	I72	I72-T74 WeakPolarHBondContact CG2-OG1 3.37Å; I72-T74 PolarHBondContact O-N 2.98Å
75	L	46.5	Very low	50.9	Low	241 Å²	241	142.5 Å²	142.5	100%	1.262	72%	0.723	S	S	*	*			trans	-167.6	0	150.4	-112.2	151	0	0	0	108.7

Retrieved 75 of 75 residues in 17.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).