A0A913KUS8_SCHMA Loading...

Uncharacterized protein AlphaSync

AlphaFold DB , UniProt , Accession A0A913KUS8, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 65 aa.

						>A0A913KUS8_SCHMA|A0A913KUS8
MNLSCLLLVNLFHLLLPVSICHSIDLTKLSLSRRLYEIKNSLMNFDEQIFYQKSQFVKVLSKLST
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	61.1	Low	80.5	Confident	206 Å²	206	108.4 Å²	108.4	100%	1.015	59%	0.593	S	S	*	*				0	120.7	0	-76	170.6	76.1	0	0	107.9	L3 L6	M1-L3 PolarHBondContact O-N 3.14Å; M1-L6 HydrophobicContact CB-CD1 4.44Å; M1-L6 HydrophobicContact CE-CD1 4.02Å; M1-L6 HydrophobicContact CE-CD2 4.43Å; M1-L6 HydrophobicContact CE-CG 4.18Å
2	N	76.9	Confident	80.4	Confident	122 Å²	122	110.8 Å²	110.8	65%	0.652	59%	0.593	S	S	*	*			trans	-66.9	124	177.6	-93.8	-9.9	0	0	0	109.4	S4 C5 L6	N2-S4 PolarHBondContact O-N 3.41Å; N2-S4 VanDerWaalsContact O-N 3.11Å; N2-C5 WeakPolarHBondContact O-CB 3.42Å; N2-C5 PolarHBondContact O-N 3.19Å; N2-L6 PolarHBondContact O-N 3.37Å
3	L	81.4	Confident	80.3	Confident	128 Å²	128	111.2 Å²	111.2	67%	0.67	59%	0.589	S	S	*	*	H	α-helix	trans	-50.3	-35.8	175.9	-169.5	75.9	0	0	0	111.6	M1 C5 L6 L7	M1-L3 PolarHBondContact O-N 3.14Å; L3-C5 VanDerWaalsContact C-N 3.32Å; L3-C5 PolarHBondContact O-N 3.18Å; L3-L6 WeakPolarHBondContact O-CB 3.41Å; L3-L6 PolarHBondContact O-N 2.93Å; L3-L7 HydrophobicContact CG-CD1 4.43Å; L3-L7 PolarHBondContact O-N 2.92Å
4	S	84.2	Confident	80.2	Confident	78 Å²	78	112.5 Å²	112.5	55%	0.545	60%	0.595	S	S	.	*	H	α-helix	trans	-58.7	-38.3	175.2	-44.6	0	0	0	0	113.2	N2 L8	N2-S4 PolarHBondContact O-N 3.41Å; N2-S4 VanDerWaalsContact O-N 3.11Å; S4-L8 WeakPolarHBondContact O-CB 3.43Å; S4-L8 PolarHBondContact O-N 3.16Å
5	C	81.6	Confident	80	Confident	78 Å²	78	111.6 Å²	111.6	53%	0.527	59%	0.59	S	S	.	*	H	α-helix	trans	-69.7	-39.7	177.2	-66.2	0	0	0	0	111.6	N2 L3 L8 V9	N2-C5 WeakPolarHBondContact O-CB 3.42Å; N2-C5 PolarHBondContact O-N 3.19Å; L3-C5 VanDerWaalsContact C-N 3.32Å; L3-C5 PolarHBondContact O-N 3.18Å; C5-L8 PolarHBondContact O-N 3.19Å; C5-V9 WeakPolarHBondContact O-CB 3.36Å; C5-V9 VanDerWaalsContact O-CG2 3.27Å; C5-V9 WeakPolarHBondContact O-CG2 3.32Å; C5-V9 PolarHBondContact O-N 3.4Å
6	L	83.2	Confident	79.5	Confident	78 Å²	78	108.6 Å²	108.6	41%	0.408	57%	0.574	S	S	.	*	H	α-helix	trans	-62.8	-42.7	175.3	-91.9	149.5	0	0	0	111.7	M1 N2 L3 N10	M1-L6 HydrophobicContact CB-CD1 4.44Å; M1-L6 HydrophobicContact CE-CD1 4.02Å; M1-L6 HydrophobicContact CE-CD2 4.43Å; M1-L6 HydrophobicContact CE-CG 4.18Å; N2-L6 PolarHBondContact O-N 3.37Å; L3-L6 WeakPolarHBondContact O-CB 3.41Å; L3-L6 PolarHBondContact O-N 2.93Å; L6-N10 WeakPolarHBondContact O-CB 3.43Å; L6-N10 PolarHBondContact O-N 2.92Å
7	L	85.5	Confident	79	Confident	110 Å²	110	106.3 Å²	106.3	58%	0.576	57%	0.567	S	S	*	*	H	α-helix	trans	-64.4	-43.2	176.3	-74	168.6	0	0	0	112.1	L3 N10 L11	L3-L7 HydrophobicContact CG-CD1 4.43Å; L3-L7 PolarHBondContact O-N 2.92Å; L7-N10 PolarHBondContact O-N 3.35Å; L7-L11 WeakPolarHBondContact O-CB 3.44Å; L7-L11 PolarHBondContact O-N 3.36Å
8	L	84.9	Confident	78.5	Confident	122 Å²	122	104.9 Å²	104.9	64%	0.639	56%	0.563	S	S	*	*	H	α-helix	trans	-62.4	-45.3	177	-103.1	151.9	0	0	0	112.4	S4 C5 L11 F12	S4-L8 WeakPolarHBondContact O-CB 3.43Å; S4-L8 PolarHBondContact O-N 3.16Å; C5-L8 PolarHBondContact O-N 3.19Å; L8-L11 PolarHBondContact O-N 3.23Å; L8-F12 WeakPolarHBondContact O-CB 3.44Å; L8-F12 PolarHBondContact O-N 3.41Å
9	V	81.5	Confident	77.8	Confident	76 Å²	76	102.9 Å²	102.9	46%	0.461	56%	0.558	S	S	.	*	H	α-helix	trans	-63	-44.4	177.8	169.9	0	0	0	0	110.5	C5 L11 F12 H13	C5-V9 WeakPolarHBondContact O-CB 3.36Å; C5-V9 VanDerWaalsContact O-CG2 3.27Å; C5-V9 WeakPolarHBondContact O-CG2 3.32Å; C5-V9 PolarHBondContact O-N 3.4Å; V9-L11 PolarHBondContact O-N 3.35Å; V9-F12 PolarHBondContact O-N 2.85Å; V9-H13 VanDerWaalsContact CG1-CD2 3.45Å; V9-H13 WeakPolarHBondContact CG1-CD2 3.48Å; V9-H13 PolarHBondContact O-CD2 3.25Å; V9-H13 PolarHBondContact O-N 3.1Å
10	N	80.7	Confident	77.1	Confident	88 Å²	88	101.9 Å²	101.9	47%	0.471	55%	0.551	S	S	.	*	H	α-helix	trans	-62.7	-41.3	175.8	-76.7	-12.6	0	0	0	112.4	L6 L7 F12 H13 L14	L6-N10 WeakPolarHBondContact O-CB 3.43Å; L6-N10 PolarHBondContact O-N 2.92Å; L7-N10 PolarHBondContact O-N 3.35Å; N10-F12 VanDerWaalsContact C-N 3.32Å; N10-F12 PolarHBondContact O-N 3.43Å; N10-H13 PolarHBondContact O-N 3.35Å; N10-L14 PolarHBondContact O-N 3.44Å
11	L	84.4	Confident	76.5	Confident	106 Å²	106	100.9 Å²	100.9	56%	0.555	55%	0.551	S	S	*	*	H	α-helix	trans	-62.2	-42.6	176.3	-154.7	104.2	0	0	0	110.9	L7 L8 V9 L14 L15	L7-L11 WeakPolarHBondContact O-CB 3.44Å; L7-L11 PolarHBondContact O-N 3.36Å; L8-L11 PolarHBondContact O-N 3.23Å; V9-L11 PolarHBondContact O-N 3.35Å; L11-L14 PolarHBondContact O-N 2.85Å; L11-L15 HydrophobicContact CD2-CD1 3.84Å; L11-L15 HydrophobicContact CG-CD1 4.27Å; L11-L15 WeakPolarHBondContact O-CB 3.38Å; L11-L15 VanDerWaalsContact O-CG 3.27Å; L11-L15 WeakPolarHBondContact O-CG 3.33Å; L11-L15 PolarHBondContact O-N 3.34Å
12	F	79.6	Confident	76.5	Confident	137 Å²	137	97 Å²	97	60%	0.601	53%	0.53	S	S	*	.	H	α-helix	trans	-64.6	-41.5	177.6	-158.4	-103.1	0	0	0	111.8	L8 V9 N10 L14 L15 L16	L8-F12 WeakPolarHBondContact O-CB 3.44Å; L8-F12 PolarHBondContact O-N 3.41Å; V9-F12 PolarHBondContact O-N 2.85Å; N10-F12 VanDerWaalsContact C-N 3.32Å; N10-F12 PolarHBondContact O-N 3.43Å; F12-L14 VanDerWaalsContact C-N 3.3Å; F12-L14 PolarHBondContact O-N 2.97Å; F12-L15 PolarHBondContact O-N 3.18Å; F12-L16 HydrophobicContact CD1-CD1 3.43Å; F12-L16 VanDerWaalsContact CD1-CD1 3.43Å; F12-L16 HydrophobicContact CD1-CG 4.16Å; F12-L16 HydrophobicContact CE1-CD1 3.45Å; F12-L16 VanDerWaalsContact CE1-CD1 3.45Å; F12-L16 HydrophobicContact CE1-CG 3.98Å; F12-L16 HydrophobicContact CG-CD1 4.46Å; F12-L16 HydrophobicContact CZ-CD1 4.48Å; F12-L16 WeakPolarHBondContact O-CB 3.42Å; F12-L16 PolarHBondContact O-N 2.93Å
13	H	78.9	Confident	75.8	Confident	117 Å²	117	94 Å²	94	54%	0.542	52%	0.519	S	S	.	.	H	α-helix	trans	-66.1	-28.7	174.3	-75.9	-60.1	0	0	0	113.8	V9 N10 P17	V9-H13 VanDerWaalsContact CG1-CD2 3.45Å; V9-H13 WeakPolarHBondContact CG1-CD2 3.48Å; V9-H13 PolarHBondContact O-CD2 3.25Å; V9-H13 PolarHBondContact O-N 3.1Å; N10-H13 PolarHBondContact O-N 3.35Å; H13-P17 WeakPolarHBondContact O-CD 3.48Å; H13-P17 WeakPolarHBondContact O-CG 3.26Å
14	L	78.6	Confident	75	Confident	129 Å²	129	91.7 Å²	91.7	68%	0.675	51%	0.506	S	S	*	.	H	α-helix	trans	-75.7	-37.2	173.2	-98.1	139.6	0	0	0	112.3	N10 L11 F12	N10-L14 PolarHBondContact O-N 3.44Å; L11-L14 PolarHBondContact O-N 2.85Å; F12-L14 VanDerWaalsContact C-N 3.3Å; F12-L14 PolarHBondContact O-N 2.97Å
15	L	77	Confident	74.5	Confident	99 Å²	99	93.2 Å²	93.2	52%	0.518	51%	0.508	S	S	.	.	H	α-helix	trans	-79.4	-33.1	-177.8	-68.7	172.7	0	0	0	113.1	L11 F12 V18 S19	L11-L15 HydrophobicContact CD2-CD1 3.84Å; L11-L15 HydrophobicContact CG-CD1 4.27Å; L11-L15 WeakPolarHBondContact O-CB 3.38Å; L11-L15 VanDerWaalsContact O-CG 3.27Å; L11-L15 WeakPolarHBondContact O-CG 3.33Å; L11-L15 PolarHBondContact O-N 3.34Å; F12-L15 PolarHBondContact O-N 3.18Å; L15-V18 PolarHBondContact O-N 3.43Å; L15-S19 PolarHBondContact O-N 2.88Å; L15-S19 PolarHBondContact O-OG 2.99Å
16	L	72	Confident	73.9	Confident	63 Å²	63	95.1 Å²	95.1	33%	0.33	51%	0.513	S	S	.	.	H	α-helix	trans	-53.5	-54.8	-179.9	-102	158.5	0	0	0	112.6	F12 V18 S19 I20	F12-L16 HydrophobicContact CD1-CD1 3.43Å; F12-L16 VanDerWaalsContact CD1-CD1 3.43Å; F12-L16 HydrophobicContact CD1-CG 4.16Å; F12-L16 HydrophobicContact CE1-CD1 3.45Å; F12-L16 VanDerWaalsContact CE1-CD1 3.45Å; F12-L16 HydrophobicContact CE1-CG 3.98Å; F12-L16 HydrophobicContact CG-CD1 4.46Å; F12-L16 HydrophobicContact CZ-CD1 4.48Å; F12-L16 WeakPolarHBondContact O-CB 3.42Å; F12-L16 PolarHBondContact O-N 2.93Å; L16-V18 VanDerWaalsContact C-N 3.31Å; L16-V18 PolarHBondContact O-N 3.39Å; L16-S19 PolarHBondContact O-N 2.96Å; L16-S19 PolarHBondContact O-OG 3.49Å; L16-I20 HydrophobicContact CD2-CD1 4.07Å; L16-I20 VanDerWaalsContact O-CG1 3.28Å; L16-I20 WeakPolarHBondContact O-CG1 3.34Å; L16-I20 PolarHBondContact O-N 3.2Å
17	P	71.8	Confident	73.5	Confident	70 Å²	70	95.4 Å²	95.4	46%	0.455	52%	0.518	S	S	.	.	H	α-helix	trans	-60.2	-39.3	179.4	-23.4	32.9	0	0	0	112.9	H13 I20 C21	H13-P17 WeakPolarHBondContact O-CD 3.48Å; H13-P17 WeakPolarHBondContact O-CG 3.26Å; P17-I20 PolarHBondContact O-N 3.26Å; P17-C21 WeakPolarHBondContact O-CB 3.44Å; P17-C21 PolarHBondContact O-N 2.95Å; P17-C21 PolarHBondContact O-SG 3.35Å
18	V	69.2	Low	73.1	Confident	81 Å²	81	96.6 Å²	96.6	49%	0.491	52%	0.518	S	S	.	.	H	α-helix	trans	-64.6	-43.4	179.4	-179.9	0	0	0	0	110.8	L15 L16 H22	L15-V18 PolarHBondContact O-N 3.43Å; L16-V18 VanDerWaalsContact C-N 3.31Å; L16-V18 PolarHBondContact O-N 3.39Å; V18-H22 PolarHBondContact O-N 2.93Å; V18-H22 VanDerWaalsContact O-N 3.07Å; V18-H22 PolarHBondContact O-ND1 3.08Å
19	S	66.2	Low	72.7	Confident	67 Å²	67	96.2 Å²	96.2	47%	0.469	52%	0.516	S	S	.	.	H	α-helix	trans	-65.4	-42.1	177.4	73.7	0	0	0	0	112.2	L15 L16 H22 S23	L15-S19 PolarHBondContact O-N 2.88Å; L15-S19 PolarHBondContact O-OG 2.99Å; L16-S19 PolarHBondContact O-N 2.96Å; L16-S19 PolarHBondContact O-OG 3.49Å; S19-H22 PolarHBondContact O-N 3.47Å; S19-S23 WeakPolarHBondContact O-CB 3.47Å; S19-S23 PolarHBondContact O-N 3.11Å; S19-S23 PolarHBondContact O-OG 2.87Å
20	I	63.7	Low	72.6	Confident	82 Å²	82	95.5 Å²	95.5	42%	0.421	52%	0.515	S	S	.	.	H	α-helix	trans	-65.9	-46.5	179.1	-66.9	165.7	0	0	0	109.6	L16 P17 H22 S23 I24	L16-I20 HydrophobicContact CD2-CD1 4.07Å; L16-I20 VanDerWaalsContact O-CG1 3.28Å; L16-I20 WeakPolarHBondContact O-CG1 3.34Å; L16-I20 PolarHBondContact O-N 3.2Å; P17-I20 PolarHBondContact O-N 3.26Å; I20-H22 VanDerWaalsContact C-N 3.35Å; I20-H22 PolarHBondContact O-N 3.46Å; I20-S23 WeakPolarHBondContact CA-OG 3.31Å; I20-S23 PolarHBondContact O-N 3.44Å; I20-S23 PolarHBondContact O-OG 3.4Å; I20-I24 HydrophobicContact CG2-CD1 3.66Å; I20-I24 HydrophobicContact CG2-CG1 4.36Å; I20-I24 VanDerWaalsContact O-CG1 3.29Å; I20-I24 WeakPolarHBondContact O-CG1 3.38Å; I20-I24 PolarHBondContact O-N 2.98Å
21	C	64	Low	72.7	Confident	82 Å²	82	96.3 Å²	96.3	55%	0.554	52%	0.519	S	S	*	.	H	α-helix	trans	-57.6	-45.1	176.3	-75.2	0	0	0	0	112.3	P17 I24 D25	P17-C21 WeakPolarHBondContact O-CB 3.44Å; P17-C21 PolarHBondContact O-N 2.95Å; P17-C21 PolarHBondContact O-SG 3.35Å; C21-I24 PolarHBondContact O-N 3.27Å; C21-D25 PolarHBondContact O-N 3.44Å
22	H	61.8	Low	72.7	Confident	124 Å²	124	94.1 Å²	94.1	57%	0.574	51%	0.512	S	S	*	.	H	α-helix	trans	-66.7	-39.7	177.7	-80.8	72.4	0	0	0	112.5	V18 S19 I20 I24 D25 L26	V18-H22 PolarHBondContact O-N 2.93Å; V18-H22 VanDerWaalsContact O-N 3.07Å; V18-H22 PolarHBondContact O-ND1 3.08Å; S19-H22 PolarHBondContact O-N 3.47Å; I20-H22 VanDerWaalsContact C-N 3.35Å; I20-H22 PolarHBondContact O-N 3.46Å; H22-I24 VanDerWaalsContact C-N 3.35Å; H22-I24 PolarHBondContact O-N 3.21Å; H22-D25 PolarHBondContact O-N 2.9Å; H22-L26 WeakPolarHBondContact O-CG 3.1Å; H22-L26 PolarHBondContact O-N 3.4Å
23	S	62.1	Low	73	Confident	60 Å²	60	95.9 Å²	95.9	42%	0.42	52%	0.515	S	S	.	.	H	α-helix	trans	-64.6	-38.8	177.1	71.7	0	0	0	0	112.6	S19 I20 D25 T27	S19-S23 WeakPolarHBondContact O-CB 3.47Å; S19-S23 PolarHBondContact O-N 3.11Å; S19-S23 PolarHBondContact O-OG 2.87Å; I20-S23 WeakPolarHBondContact CA-OG 3.31Å; I20-S23 PolarHBondContact O-N 3.44Å; I20-S23 PolarHBondContact O-OG 3.4Å; S23-D25 VanDerWaalsContact C-N 3.33Å; S23-T27 WeakPolarHBondContact O-CG2 3.45Å; S23-T27 PolarHBondContact O-N 3.18Å; S23-T27 PolarHBondContact O-OG1 3.3Å
24	I	64.3	Low	73.5	Confident	78 Å²	78	98.8 Å²	98.8	40%	0.4	52%	0.521	S	S	.	.	H	α-helix	trans	-66.5	-38.7	176.1	-67.8	168.2	0	0	0	110.2	I20 C21 H22 T27 K28	I20-I24 HydrophobicContact CG2-CD1 3.66Å; I20-I24 HydrophobicContact CG2-CG1 4.36Å; I20-I24 VanDerWaalsContact O-CG1 3.29Å; I20-I24 WeakPolarHBondContact O-CG1 3.38Å; I20-I24 PolarHBondContact O-N 2.98Å; C21-I24 PolarHBondContact O-N 3.27Å; H22-I24 VanDerWaalsContact C-N 3.35Å; H22-I24 PolarHBondContact O-N 3.21Å; I24-T27 WeakPolarHBondContact CA-OG1 3.45Å; I24-T27 PolarHBondContact O-OG1 3.33Å; I24-K28 HydrophobicContact CG2-CD 4.13Å; I24-K28 HydrophobicContact CG2-CG 4.5Å; I24-K28 WeakPolarHBondContact O-CB 3.48Å; I24-K28 VanDerWaalsContact O-CG 3.28Å; I24-K28 WeakPolarHBondContact O-CG 3.09Å; I24-K28 PolarHBondContact O-N 3.39Å
25	D	73.1	Confident	74	Confident	111 Å²	111	97.5 Å²	97.5	59%	0.594	51%	0.514	S	S	*	.	H	α-helix	trans	-69.3	-42.4	179.4	-153.8	17.8	0	0	0	111.9	C21 H22 S23 T27 K28 L29	C21-D25 PolarHBondContact O-N 3.44Å; H22-D25 PolarHBondContact O-N 2.9Å; S23-D25 VanDerWaalsContact C-N 3.33Å; D25-T27 PolarHBondContact O-N 3.45Å; D25-K28 PolarHBondContact O-N 2.8Å; D25-L29 WeakPolarHBondContact O-CB 3.46Å; D25-L29 PolarHBondContact O-N 2.97Å
26	L	70.1	Confident	74.5	Confident	117 Å²	117	99.7 Å²	99.7	61%	0.613	52%	0.516	S	S	*	.	H	α-helix	trans	-63.7	-40.9	175.2	-71	174.9	0	0	0	112.6	H22 L29 S30	H22-L26 WeakPolarHBondContact O-CG 3.1Å; H22-L26 PolarHBondContact O-N 3.4Å; L26-L29 PolarHBondContact O-N 3.48Å; L26-S30 WeakPolarHBondContact O-CB 3.43Å; L26-S30 PolarHBondContact O-N 3.11Å; L26-S30 PolarHBondContact O-OG 3.12Å
27	T	74.8	Confident	75.4	Confident	84 Å²	84	100.9 Å²	100.9	52%	0.515	52%	0.521	S	S	.	.	H	α-helix	trans	-66.4	-43.3	176.3	48.3	0	0	0	0	111.3	S23 I24 D25 L29 S30 L31	S23-T27 WeakPolarHBondContact O-CG2 3.45Å; S23-T27 PolarHBondContact O-N 3.18Å; S23-T27 PolarHBondContact O-OG1 3.3Å; I24-T27 WeakPolarHBondContact CA-OG1 3.45Å; I24-T27 PolarHBondContact O-OG1 3.33Å; D25-T27 PolarHBondContact O-N 3.45Å; T27-L29 PolarHBondContact O-N 2.9Å; T27-S30 PolarHBondContact O-N 3.38Å; T27-S30 PolarHBondContact O-OG 3.02Å; T27-L31 VanDerWaalsContact O-CB 3.32Å; T27-L31 WeakPolarHBondContact O-CB 3.4Å; T27-L31 PolarHBondContact O-N 3.48Å
28	K	75.9	Confident	76.3	Confident	136 Å²	136	102.1 Å²	102.1	59%	0.591	52%	0.522	S	S	*	.	H	α-helix	trans	-59.6	-44.1	172.9	-76.9	177.7	-179.1	179.7	0	112.5	I24 D25 L31 S32	I24-K28 HydrophobicContact CG2-CD 4.13Å; I24-K28 HydrophobicContact CG2-CG 4.5Å; I24-K28 WeakPolarHBondContact O-CB 3.48Å; I24-K28 VanDerWaalsContact O-CG 3.28Å; I24-K28 WeakPolarHBondContact O-CG 3.09Å; I24-K28 PolarHBondContact O-N 3.39Å; D25-K28 PolarHBondContact O-N 2.8Å; K28-L31 PolarHBondContact O-N 2.93Å; K28-S32 WeakPolarHBondContact O-CB 3.46Å; K28-S32 PolarHBondContact O-N 3.4Å; K28-S32 PolarHBondContact O-OG 3.46Å
29	L	77	Confident	77.3	Confident	113 Å²	113	103.9 Å²	103.9	59%	0.592	52%	0.523	S	S	*	.	H	α-helix	trans	-64.9	-41.3	177.6	-172.8	72.1	0	0	0	111.9	D25 L26 T27 L31 S32 R33	D25-L29 WeakPolarHBondContact O-CB 3.46Å; D25-L29 PolarHBondContact O-N 2.97Å; L26-L29 PolarHBondContact O-N 3.48Å; T27-L29 PolarHBondContact O-N 2.9Å; L29-L31 VanDerWaalsContact C-N 3.32Å; L29-L31 PolarHBondContact O-N 3.01Å; L29-S32 WeakPolarHBondContact CA-OG 3.35Å; L29-S32 PolarHBondContact O-OG 3.48Å; L29-R33 WeakPolarHBondContact O-CB 3.27Å; L29-R33 PolarHBondContact O-N 3.09Å
30	S	80.6	Confident	78.5	Confident	61 Å²	61	103.3 Å²	103.3	43%	0.427	52%	0.515	S	S	.	.	H	α-helix	trans	-65	-39	176.3	77.8	0	0	0	0	111.8	L26 T27 R34	L26-S30 WeakPolarHBondContact O-CB 3.43Å; L26-S30 PolarHBondContact O-N 3.11Å; L26-S30 PolarHBondContact O-OG 3.12Å; T27-S30 PolarHBondContact O-N 3.38Å; T27-S30 PolarHBondContact O-OG 3.02Å; S30-R34 WeakPolarHBondContact O-CG 3.32Å; S30-R34 PolarHBondContact O-N 3.31Å
31	L	82.5	Confident	79.8	Confident	106 Å²	106	102.3 Å²	102.3	56%	0.555	52%	0.515	S	S	*	.	H	α-helix	trans	-72.1	-41.2	-179.9	-170.2	138.7	0	0	0	111.1	T27 K28 L29 R33 R34 L35	T27-L31 VanDerWaalsContact O-CB 3.32Å; T27-L31 WeakPolarHBondContact O-CB 3.4Å; T27-L31 PolarHBondContact O-N 3.48Å; K28-L31 PolarHBondContact O-N 2.93Å; L29-L31 VanDerWaalsContact C-N 3.32Å; L29-L31 PolarHBondContact O-N 3.01Å; L31-R33 PolarHBondContact O-N 3.38Å; L31-R34 PolarHBondContact O-N 3.45Å; L31-L35 HydrophobicContact CD2-CD1 3.6Å; L31-L35 HydrophobicContact CD2-CG 4.2Å; L31-L35 WeakPolarHBondContact O-CB 3.44Å; L31-L35 VanDerWaalsContact O-CG 3.32Å; L31-L35 WeakPolarHBondContact O-CG 3.41Å; L31-L35 PolarHBondContact O-N 3.2Å
32	S	84	Confident	81	Confident	60 Å²	60	103.2 Å²	103.2	42%	0.42	51%	0.514	S	S	.	.	H	α-helix	trans	-63.4	-41	175.2	67	0	0	0	0	111.8	K28 L29 L35 Y36	K28-S32 WeakPolarHBondContact O-CB 3.46Å; K28-S32 PolarHBondContact O-N 3.4Å; K28-S32 PolarHBondContact O-OG 3.46Å; L29-S32 WeakPolarHBondContact CA-OG 3.35Å; L29-S32 PolarHBondContact O-OG 3.48Å; S32-L35 PolarHBondContact O-N 3.28Å; S32-Y36 WeakPolarHBondContact O-CB 3.48Å; S32-Y36 PolarHBondContact O-N 3.48Å
33	R	85.9	Confident	82.2	Confident	173 Å²	173	101.9 Å²	101.9	65%	0.653	51%	0.509	S	S	*	.	H	α-helix	trans	-61	-47.6	173.5	-177.8	178.8	173.4	165.5	4.1	111.9	L29 L31 L35 Y36 E37	L29-R33 WeakPolarHBondContact O-CB 3.27Å; L29-R33 PolarHBondContact O-N 3.09Å; L31-R33 PolarHBondContact O-N 3.38Å; R33-L35 VanDerWaalsContact C-N 3.35Å; R33-L35 PolarHBondContact O-N 2.9Å; R33-Y36 WeakPolarHBondContact O-CB 3.32Å; R33-Y36 PolarHBondContact O-N 2.9Å; R33-E37 IonicContact CZ-OE1 3.86Å; R33-E37 IonicContact NE-OE1 3.01Å; R33-E37 PolarHBondContact NE-OE1 3.42Å; R33-E37 IonicContact NH2-OE1 3.82Å; R33-E37 WeakPolarHBondContact O-CG 3.44Å; R33-E37 PolarHBondContact O-N 2.93Å
34	R	88.2	Confident	83.5	Confident	178 Å²	178	103.2 Å²	103.2	67%	0.672	51%	0.512	S	S	*	.	H	α-helix	trans	-60.9	-42.5	176.7	-76.5	-177.7	175.5	-163.6	0.2	112.2	S30 L31 Y36 E37 I38	S30-R34 WeakPolarHBondContact O-CG 3.32Å; S30-R34 PolarHBondContact O-N 3.31Å; L31-R34 PolarHBondContact O-N 3.45Å; R34-Y36 VanDerWaalsContact C-N 3.3Å; R34-Y36 PolarHBondContact O-N 3.32Å; R34-E37 PolarHBondContact O-N 3.02Å; R34-I38 VanDerWaalsContact O-CG1 3.27Å; R34-I38 WeakPolarHBondContact O-CG1 3.48Å; R34-I38 PolarHBondContact O-N 2.95Å
35	L	89.6	Confident	84.7	Confident	102 Å²	102	105.2 Å²	105.2	53%	0.534	52%	0.518	S	S	.	.	H	α-helix	trans	-62.6	-38.4	176	-73.6	176.4	0	0	0	111.9	L31 S32 R33 I38 K39	L31-L35 HydrophobicContact CD2-CD1 3.6Å; L31-L35 HydrophobicContact CD2-CG 4.2Å; L31-L35 WeakPolarHBondContact O-CB 3.44Å; L31-L35 VanDerWaalsContact O-CG 3.32Å; L31-L35 WeakPolarHBondContact O-CG 3.41Å; L31-L35 PolarHBondContact O-N 3.2Å; S32-L35 PolarHBondContact O-N 3.28Å; R33-L35 VanDerWaalsContact C-N 3.35Å; R33-L35 PolarHBondContact O-N 2.9Å; L35-I38 PolarHBondContact O-N 3.48Å; L35-K39 WeakPolarHBondContact O-CB 3.37Å; L35-K39 PolarHBondContact O-N 2.78Å
36	Y	88.5	Confident	85.4	Confident	145 Å²	145	105 Å²	105	57%	0.569	52%	0.516	S	S	*	.	H	α-helix	trans	-64.9	-44.4	174.9	-178.3	-98.7	0	0	0	112	S32 R33 R34 I38 K39 N40	S32-Y36 WeakPolarHBondContact O-CB 3.48Å; S32-Y36 PolarHBondContact O-N 3.48Å; R33-Y36 WeakPolarHBondContact O-CB 3.32Å; R33-Y36 PolarHBondContact O-N 2.9Å; R34-Y36 VanDerWaalsContact C-N 3.3Å; R34-Y36 PolarHBondContact O-N 3.32Å; Y36-I38 PolarHBondContact O-N 2.88Å; Y36-K39 PolarHBondContact O-N 3.33Å; Y36-N40 WeakPolarHBondContact CE1-ND2 3.42Å; Y36-N40 VanDerWaalsContact CZ-ND2 3.3Å; Y36-N40 PolarHBondContact O-N 3.04Å; Y36-N40 PolarHBondContact OH-ND2 2.91Å
37	E	91	Very high	86.3	Confident	89 Å²	89	106 Å²	106	42%	0.416	52%	0.518	S	S	.	.	H	α-helix	trans	-61.9	-41.5	175.6	-71.5	169.2	-173.3	0	0	112	R33 R34 N40 S41	R33-E37 IonicContact CZ-OE1 3.86Å; R33-E37 IonicContact NE-OE1 3.01Å; R33-E37 PolarHBondContact NE-OE1 3.42Å; R33-E37 IonicContact NH2-OE1 3.82Å; R33-E37 WeakPolarHBondContact O-CG 3.44Å; R33-E37 PolarHBondContact O-N 2.93Å; R34-E37 PolarHBondContact O-N 3.02Å; E37-N40 PolarHBondContact O-N 3.48Å; E37-S41 WeakPolarHBondContact O-CB 3.35Å; E37-S41 PolarHBondContact O-N 2.94Å; E37-S41 PolarHBondContact O-OG 3.31Å
38	I	90.9	Very high	87	Confident	96 Å²	96	107 Å²	107	49%	0.492	52%	0.517	S	S	.	.	H	α-helix	trans	-63.4	-46.4	174.4	-69	165.4	0	0	0	110.7	R34 L35 Y36 N40 S41 L42	R34-I38 VanDerWaalsContact O-CG1 3.27Å; R34-I38 WeakPolarHBondContact O-CG1 3.48Å; R34-I38 PolarHBondContact O-N 2.95Å; L35-I38 PolarHBondContact O-N 3.48Å; Y36-I38 PolarHBondContact O-N 2.88Å; I38-N40 PolarHBondContact O-N 3.49Å; I38-S41 WeakPolarHBondContact O-CB 3.48Å; I38-S41 PolarHBondContact O-N 2.93Å; I38-L42 HydrophobicContact CG2-CD1 4Å; I38-L42 HydrophobicContact CG2-CG 4.47Å; I38-L42 WeakPolarHBondContact O-CG 3.39Å; I38-L42 PolarHBondContact O-N 3.33Å
39	K	90.1	Very high	87.8	Confident	118 Å²	118	105.3 Å²	105.3	51%	0.513	51%	0.513	S	S	.	.	H	α-helix	trans	-59.3	-45.4	178.3	179.8	-179.5	174.7	-178	0	111.6	L35 Y36 S41 L42 M43	L35-K39 WeakPolarHBondContact O-CB 3.37Å; L35-K39 PolarHBondContact O-N 2.78Å; Y36-K39 PolarHBondContact O-N 3.33Å; K39-S41 VanDerWaalsContact C-N 3.32Å; K39-S41 PolarHBondContact O-N 3.49Å; K39-L42 PolarHBondContact O-N 2.86Å; K39-M43 HydrophobicContact CG-CE 4.4Å; K39-M43 WeakPolarHBondContact O-CG 3.37Å; K39-M43 PolarHBondContact O-N 3.39Å
40	N	89.7	Confident	88.5	Confident	55 Å²	55	107.5 Å²	107.5	29%	0.294	52%	0.518	S	S	.	.	H	α-helix	trans	-64.3	-39	177	-75.5	-0.3	0	0	0	111.6	Y36 E37 I38 L42 M43 N44	Y36-N40 WeakPolarHBondContact CE1-ND2 3.42Å; Y36-N40 VanDerWaalsContact CZ-ND2 3.3Å; Y36-N40 PolarHBondContact O-N 3.04Å; Y36-N40 PolarHBondContact OH-ND2 2.91Å; E37-N40 PolarHBondContact O-N 3.48Å; I38-N40 PolarHBondContact O-N 3.49Å; N40-L42 VanDerWaalsContact C-N 3.35Å; N40-M43 PolarHBondContact O-N 3.23Å; N40-N44 PolarHBondContact O-N 2.92Å; N40-N44 VanDerWaalsContact O-N 3.09Å
41	S	90.9	Very high	89.1	Confident	60 Å²	60	111.6 Å²	111.6	42%	0.42	53%	0.525	S	S	.	.	H	α-helix	trans	-62.8	-42.3	175.7	-57.7	0	0	0	0	111.7	E37 I38 K39 N44 F45	E37-S41 WeakPolarHBondContact O-CB 3.35Å; E37-S41 PolarHBondContact O-N 2.94Å; E37-S41 PolarHBondContact O-OG 3.31Å; I38-S41 WeakPolarHBondContact O-CB 3.48Å; I38-S41 PolarHBondContact O-N 2.93Å; K39-S41 VanDerWaalsContact C-N 3.32Å; K39-S41 PolarHBondContact O-N 3.49Å; S41-N44 PolarHBondContact O-N 3.5Å; S41-F45 WeakPolarHBondContact O-CD2 3.39Å; S41-F45 PolarHBondContact O-N 2.91Å; S41-F45 VanDerWaalsContact O-N 3.08Å
42	L	90.1	Very high	89.6	Confident	101 Å²	101	112.7 Å²	112.7	53%	0.529	53%	0.527	S	S	.	.	H	α-helix	trans	-62.6	-44	175.9	-74.3	167.5	0	0	0	112.2	I38 K39 N40 N44 F45 D46	I38-L42 HydrophobicContact CG2-CD1 4Å; I38-L42 HydrophobicContact CG2-CG 4.47Å; I38-L42 WeakPolarHBondContact O-CG 3.39Å; I38-L42 PolarHBondContact O-N 3.33Å; K39-L42 PolarHBondContact O-N 2.86Å; N40-L42 VanDerWaalsContact C-N 3.35Å; L42-N44 VanDerWaalsContact C-N 3.3Å; L42-N44 PolarHBondContact O-N 2.76Å; L42-F45 WeakPolarHBondContact O-CB 3.28Å; L42-F45 PolarHBondContact O-N 2.93Å; L42-F45 VanDerWaalsContact O-N 3.11Å; L42-D46 PolarHBondContact O-N 3.29Å
43	M	88	Confident	90	Very high	96 Å²	96	116.7 Å²	116.7	47%	0.473	54%	0.538	S	S	.	.	H	α-helix	trans	-59.4	-41.4	175.8	-73.5	178.2	164.7	0	0	112.1	K39 N40 F45 D46 E47	K39-M43 HydrophobicContact CG-CE 4.4Å; K39-M43 WeakPolarHBondContact O-CG 3.37Å; K39-M43 PolarHBondContact O-N 3.39Å; N40-M43 PolarHBondContact O-N 3.23Å; M43-F45 VanDerWaalsContact C-N 3.32Å; M43-F45 PolarHBondContact O-N 3Å; M43-D46 PolarHBondContact O-N 3.06Å; M43-E47 PolarHBondContact O-N 3.49Å; M43-E47 VanDerWaalsContact O-N 3.12Å
44	N	88.2	Confident	90.4	Very high	89 Å²	89	110.7 Å²	110.7	48%	0.476	52%	0.522	S	S	.	.	H	α-helix	trans	-64.2	-36.7	175.6	-69.6	-13.2	0	0	0	112.3	N40 S41 L42 Q48	N40-N44 PolarHBondContact O-N 2.92Å; N40-N44 VanDerWaalsContact O-N 3.09Å; S41-N44 PolarHBondContact O-N 3.5Å; L42-N44 VanDerWaalsContact C-N 3.3Å; L42-N44 PolarHBondContact O-N 2.76Å; N44-Q48 WeakPolarHBondContact O-CG 3.28Å; N44-Q48 PolarHBondContact O-N 3.42Å; N44-Q48 VanDerWaalsContact O-N 3.11Å
45	F	89.1	Confident	90.6	Very high	120 Å²	120	105.4 Å²	105.4	53%	0.526	51%	0.505	S	S	.	.	H	α-helix	trans	-66.2	-40.7	174.5	-79.9	-63.8	0	0	0	112	S41 L42 M43 E47 Q48 I49	S41-F45 WeakPolarHBondContact O-CD2 3.39Å; S41-F45 PolarHBondContact O-N 2.91Å; S41-F45 VanDerWaalsContact O-N 3.08Å; L42-F45 WeakPolarHBondContact O-CB 3.28Å; L42-F45 PolarHBondContact O-N 2.93Å; L42-F45 VanDerWaalsContact O-N 3.11Å; M43-F45 VanDerWaalsContact C-N 3.32Å; M43-F45 PolarHBondContact O-N 3Å; F45-E47 VanDerWaalsContact C-N 3.33Å; F45-E47 PolarHBondContact O-N 3.47Å; F45-Q48 PolarHBondContact O-N 2.97Å; F45-I49 VanDerWaalsContact O-CG1 3.31Å; F45-I49 WeakPolarHBondContact O-CG1 3.29Å; F45-I49 PolarHBondContact O-N 2.84Å
46	D	88.4	Confident	90.8	Very high	106 Å²	106	107.3 Å²	107.3	57%	0.567	51%	0.509	S	S	*	.	H	α-helix	trans	-60.5	-42.6	176.8	-73.9	-23.1	0	0	0	111.5	L42 M43 I49 F50	L42-D46 PolarHBondContact O-N 3.29Å; M43-D46 PolarHBondContact O-N 3.06Å; D46-I49 PolarHBondContact O-N 3.34Å; D46-F50 WeakPolarHBondContact O-CB 3.33Å; D46-F50 PolarHBondContact O-N 2.74Å
47	E	88.1	Confident	91.1	Very high	138 Å²	138	104.4 Å²	104.4	65%	0.645	51%	0.506	S	S	*	.	H	α-helix	trans	-62.1	-43	174.6	-71.7	-174.7	175.8	0	0	112.3	M43 F45 F50 Y51	M43-E47 PolarHBondContact O-N 3.49Å; M43-E47 VanDerWaalsContact O-N 3.12Å; F45-E47 VanDerWaalsContact C-N 3.33Å; F45-E47 PolarHBondContact O-N 3.47Å; E47-F50 PolarHBondContact O-N 3.5Å; E47-Y51 WeakPolarHBondContact O-CB 3.45Å; E47-Y51 PolarHBondContact O-N 3.34Å
48	Q	90.6	Very high	91.2	Very high	106 Å²	106	105.3 Å²	105.3	50%	0.495	51%	0.509	S	S	.	.	H	α-helix	trans	-64.1	-43.7	177	-72.7	177.7	21.6	0	0	112	N44 F45 Y51 Q52	N44-Q48 WeakPolarHBondContact O-CG 3.28Å; N44-Q48 PolarHBondContact O-N 3.42Å; N44-Q48 VanDerWaalsContact O-N 3.11Å; F45-Q48 PolarHBondContact O-N 2.97Å; Q48-Y51 PolarHBondContact O-N 2.96Å; Q48-Q52 WeakPolarHBondContact O-CB 2.92Å; Q48-Q52 WeakPolarHBondContact O-CG 3.41Å; Q48-Q52 PolarHBondContact O-N 2.97Å
49	I	91.6	Very high	91.3	Very high	100 Å²	100	104.6 Å²	104.6	51%	0.513	51%	0.509	S	S	.	.	H	α-helix	trans	-63.5	-43.7	177.3	-70	169.1	0	0	0	110.1	F45 D46 Y51 Q52 K53	F45-I49 VanDerWaalsContact O-CG1 3.31Å; F45-I49 WeakPolarHBondContact O-CG1 3.29Å; F45-I49 PolarHBondContact O-N 2.84Å; D46-I49 PolarHBondContact O-N 3.34Å; I49-Y51 PolarHBondContact O-N 2.97Å; I49-Q52 PolarHBondContact O-N 2.9Å; I49-K53 VanDerWaalsContact O-CB 3.26Å; I49-K53 WeakPolarHBondContact O-CB 3.39Å; I49-K53 PolarHBondContact O-N 3.39Å
50	F	92.8	Very high	91.5	Very high	158 Å²	158	103.8 Å²	103.8	69%	0.693	51%	0.51	S	S	*	.	H	α-helix	trans	-60.4	-45.7	176.6	-178.9	-96.1	0	0	0	111.7	D46 E47 K53 S54	D46-F50 WeakPolarHBondContact O-CB 3.33Å; D46-F50 PolarHBondContact O-N 2.74Å; E47-F50 PolarHBondContact O-N 3.5Å; F50-K53 PolarHBondContact O-N 3.4Å; F50-S54 WeakPolarHBondContact O-CB 3.36Å; F50-S54 PolarHBondContact O-N 2.94Å
51	Y	92.9	Very high	91.6	Very high	148 Å²	148	104 Å²	104	58%	0.58	52%	0.516	S	S	*	.	H	α-helix	trans	-61	-49.3	176.4	179.4	-94.1	0	0	0	111.8	E47 Q48 I49 K53 S54 Q55	E47-Y51 WeakPolarHBondContact O-CB 3.45Å; E47-Y51 PolarHBondContact O-N 3.34Å; Q48-Y51 PolarHBondContact O-N 2.96Å; I49-Y51 PolarHBondContact O-N 2.97Å; Y51-K53 VanDerWaalsContact C-N 3.35Å; Y51-K53 PolarHBondContact O-N 3.4Å; Y51-S54 WeakPolarHBondContact O-CB 3.47Å; Y51-S54 PolarHBondContact O-N 2.96Å; Y51-Q55 HydrophobicContact CD1-CG 4.18Å; Y51-Q55 HydrophobicContact CE1-CG 3.74Å; Y51-Q55 HydrophobicContact CE2-CG 4.47Å; Y51-Q55 WeakPolarHBondContact O-CG 3.37Å; Y51-Q55 PolarHBondContact O-N 3.24Å; Y51-Q55 PolarHBondContact OH-NE2 3.25Å
52	Q	92.3	Very high	91.7	Very high	128 Å²	128	108.7 Å²	108.7	60%	0.598	53%	0.528	S	S	*	.	H	α-helix	trans	-61.8	-42.3	178.9	-74.1	-178.8	2.9	0	0	111.9	Q48 I49 S54 Q55 F56	Q48-Q52 WeakPolarHBondContact O-CB 2.92Å; Q48-Q52 WeakPolarHBondContact O-CG 3.41Å; Q48-Q52 PolarHBondContact O-N 2.97Å; I49-Q52 PolarHBondContact O-N 2.9Å; Q52-S54 VanDerWaalsContact C-N 3.34Å; Q52-S54 PolarHBondContact O-N 3.07Å; Q52-Q55 PolarHBondContact O-N 3.3Å; Q52-F56 WeakPolarHBondContact O-CB 3.45Å; Q52-F56 PolarHBondContact O-N 3.3Å
53	K	94.1	Very high	91.7	Very high	145 Å²	145	110.7 Å²	110.7	63%	0.63	54%	0.539	S	S	*	.	H	α-helix	trans	-60.5	-43.8	175	-174.7	178.6	-178.8	179.1	0	111.4	I49 F50 Y51 Q55 F56 V57	I49-K53 VanDerWaalsContact O-CB 3.26Å; I49-K53 WeakPolarHBondContact O-CB 3.39Å; I49-K53 PolarHBondContact O-N 3.39Å; F50-K53 PolarHBondContact O-N 3.4Å; Y51-K53 VanDerWaalsContact C-N 3.35Å; Y51-K53 PolarHBondContact O-N 3.4Å; K53-Q55 PolarHBondContact O-N 2.93Å; K53-F56 PolarHBondContact O-N 2.93Å; K53-V57 WeakPolarHBondContact O-CG2 3.27Å; K53-V57 PolarHBondContact O-N 3.3Å
54	S	93.9	Very high	91.4	Very high	46 Å²	46	110.7 Å²	110.7	32%	0.322	55%	0.548	S	S	.	.	H	α-helix	trans	-60.8	-44.1	176.1	-173.8	0	0	0	0	111.9	F50 Y51 Q52 V57 K58	F50-S54 WeakPolarHBondContact O-CB 3.36Å; F50-S54 PolarHBondContact O-N 2.94Å; Y51-S54 WeakPolarHBondContact O-CB 3.47Å; Y51-S54 PolarHBondContact O-N 2.96Å; Q52-S54 VanDerWaalsContact C-N 3.34Å; Q52-S54 PolarHBondContact O-N 3.07Å; S54-V57 PolarHBondContact O-N 2.96Å; S54-K58 WeakPolarHBondContact O-CG 3.5Å; S54-K58 PolarHBondContact O-N 3Å; S54-K58 VanDerWaalsContact O-N 3.1Å
55	Q	93	Very high	90.5	Very high	68 Å²	68	114.5 Å²	114.5	32%	0.318	58%	0.575	S	S	.	*	H	α-helix	trans	-64.6	-43.6	176.3	-66.9	-61.3	-16.6	0	0	111.9	Y51 Q52 K53 V57 K58 V59	Y51-Q55 HydrophobicContact CD1-CG 4.18Å; Y51-Q55 HydrophobicContact CE1-CG 3.74Å; Y51-Q55 HydrophobicContact CE2-CG 4.47Å; Y51-Q55 WeakPolarHBondContact O-CG 3.37Å; Y51-Q55 PolarHBondContact O-N 3.24Å; Y51-Q55 PolarHBondContact OH-NE2 3.25Å; Q52-Q55 PolarHBondContact O-N 3.3Å; K53-Q55 PolarHBondContact O-N 2.93Å; Q55-V57 PolarHBondContact O-N 3.33Å; Q55-K58 WeakPolarHBondContact O-CB 3.27Å; Q55-K58 PolarHBondContact O-N 2.92Å; Q55-V59 WeakPolarHBondContact O-CG2 3.48Å; Q55-V59 PolarHBondContact O-N 3.43Å
56	F	93.8	Very high	90.5	Very high	141 Å²	141	114.2 Å²	114.2	62%	0.618	58%	0.577	S	S	*	*	H	α-helix	trans	-58.5	-46.5	177.2	-178.2	-99.2	0	0	0	111.7	Q52 K53 K58 V59 L60	Q52-F56 WeakPolarHBondContact O-CB 3.45Å; Q52-F56 PolarHBondContact O-N 3.3Å; K53-F56 PolarHBondContact O-N 2.93Å; F56-K58 VanDerWaalsContact C-N 3.33Å; F56-K58 PolarHBondContact O-N 3.47Å; F56-V59 PolarHBondContact O-N 3.25Å; F56-L60 HydrophobicContact CE1-CD1 3.99Å; F56-L60 HydrophobicContact CZ-CD1 4.01Å; F56-L60 WeakPolarHBondContact O-CB 3.39Å; F56-L60 PolarHBondContact O-N 2.87Å
57	V	93.4	Very high	90.6	Very high	85 Å²	85	114.6 Å²	114.6	52%	0.515	58%	0.578	S	S	.	*	H	α-helix	trans	-60.5	-41.4	176.4	171.6	0	0	0	0	111.6	K53 S54 Q55 L60 S61	K53-V57 WeakPolarHBondContact O-CG2 3.27Å; K53-V57 PolarHBondContact O-N 3.3Å; S54-V57 PolarHBondContact O-N 2.96Å; Q55-V57 PolarHBondContact O-N 3.33Å; V57-L60 PolarHBondContact O-N 3.38Å; V57-S61 PolarHBondContact O-N 3.11Å; V57-S61 PolarHBondContact O-OG 3.07Å
58	K	93.7	Very high	90.8	Very high	108 Å²	108	113.3 Å²	113.3	47%	0.47	57%	0.574	S	S	.	*	H	α-helix	trans	-64.6	-37.2	176.6	-74.1	173.5	-178.9	176.1	0	113.2	S54 Q55 F56 S61 K62	S54-K58 WeakPolarHBondContact O-CG 3.5Å; S54-K58 PolarHBondContact O-N 3Å; S54-K58 VanDerWaalsContact O-N 3.1Å; Q55-K58 WeakPolarHBondContact O-CB 3.27Å; Q55-K58 PolarHBondContact O-N 2.92Å; F56-K58 VanDerWaalsContact C-N 3.33Å; F56-K58 PolarHBondContact O-N 3.47Å; K58-S61 PolarHBondContact O-OG 3.43Å; K58-K62 WeakPolarHBondContact O-CG 3.39Å; K58-K62 PolarHBondContact O-N 3Å
59	V	92.8	Very high	90.8	Very high	81 Å²	81	113.8 Å²	113.8	49%	0.491	58%	0.578	S	S	.	*	H	α-helix	trans	-69.5	-44.9	175.9	175.6	0	0	0	0	109.7	Q55 F56 S61 K62 L63	Q55-V59 WeakPolarHBondContact O-CG2 3.48Å; Q55-V59 PolarHBondContact O-N 3.43Å; F56-V59 PolarHBondContact O-N 3.25Å; V59-S61 VanDerWaalsContact C-N 3.34Å; V59-S61 PolarHBondContact O-N 3.22Å; V59-K62 PolarHBondContact O-N 2.99Å; V59-K62 VanDerWaalsContact O-N 3.14Å; V59-L63 HydrophobicContact CG1-CD1 4.18Å; V59-L63 PolarHBondContact O-N 3.4Å; V59-L63 VanDerWaalsContact O-N 3.16Å
60	L	93.3	Very high	90.7	Very high	101 Å²	101	114.6 Å²	114.6	53%	0.529	58%	0.583	S	S	.	*	H	α-helix	trans	-60.8	-42.7	179.5	-162.1	118.9	0	0	0	111.7	F56 V57 K62 L63 S64	F56-L60 HydrophobicContact CE1-CD1 3.99Å; F56-L60 HydrophobicContact CZ-CD1 4.01Å; F56-L60 WeakPolarHBondContact O-CB 3.39Å; F56-L60 PolarHBondContact O-N 2.87Å; V57-L60 PolarHBondContact O-N 3.38Å; L60-K62 VanDerWaalsContact C-N 3.28Å; L60-K62 PolarHBondContact O-N 3.03Å; L60-L63 PolarHBondContact O-N 2.96Å; L60-S64 PolarHBondContact O-N 3.23Å; L60-S64 PolarHBondContact O-OG 3.46Å
61	S	92.6	Very high	90.6	Very high	60 Å²	60	111.7 Å²	111.7	42%	0.42	58%	0.575	S	S	.	*	H	α-helix	trans	-63.8	-31.6	177.1	64.6	0	0	0	0	113.3	V57 K58 V59 S64 T65	V57-S61 PolarHBondContact O-N 3.11Å; V57-S61 PolarHBondContact O-OG 3.07Å; K58-S61 PolarHBondContact O-OG 3.43Å; V59-S61 VanDerWaalsContact C-N 3.34Å; V59-S61 PolarHBondContact O-N 3.22Å; S61-S64 WeakPolarHBondContact CA-OG 3.5Å; S61-S64 PolarHBondContact O-OG 2.88Å; S61-T65 PolarHBondContact O-OG1 3.34Å
62	K	92.4	Very high	90.5	Very high	158 Å²	158	109.1 Å²	109.1	69%	0.687	58%	0.575	S	S	*	*	H	α-helix	trans	-74.2	-28.4	176.2	-74.4	178	-179.8	-174.2	0	113	K58 V59 L60 T65	K58-K62 WeakPolarHBondContact O-CG 3.39Å; K58-K62 PolarHBondContact O-N 3Å; V59-K62 PolarHBondContact O-N 2.99Å; V59-K62 VanDerWaalsContact O-N 3.14Å; L60-K62 VanDerWaalsContact C-N 3.28Å; L60-K62 PolarHBondContact O-N 3.03Å; K62-T65 PolarHBondContact O-OG1 3.41Å
63	L	91.1	Very high	90.3	Very high	143 Å²	143	107.7 Å²	107.7	75%	0.749	57%	0.573	S	S	*	*	H	α-helix	trans	-80.8	-22.7	177.9	-69.7	171.3	0	0	0	112.5	V59 L60	V59-L63 HydrophobicContact CG1-CD1 4.18Å; V59-L63 PolarHBondContact O-N 3.4Å; V59-L63 VanDerWaalsContact O-N 3.16Å; L60-L63 PolarHBondContact O-N 2.96Å
64	S	81.3	Confident	90	Very high	95 Å²	95	104.6 Å²	104.6	66%	0.664	57%	0.568	S	S	*	*			trans	-83.5	-8.6	178.1	54.7	0	0	0	0	114.9	L60 S61	L60-S64 PolarHBondContact O-N 3.23Å; L60-S64 PolarHBondContact O-OG 3.46Å; S61-S64 WeakPolarHBondContact CA-OG 3.5Å; S61-S64 PolarHBondContact O-OG 2.88Å
65	T	68.6	Low	89.6	Confident	169 Å²	169	109.9 Å²	109.9	100%	1.037	59%	0.591	S	S	*	*			trans	-106.2	0	174.3	42.3	0	0	0	0	110.5	S61 K62	S61-T65 PolarHBondContact O-OG1 3.34Å; K62-T65 PolarHBondContact O-OG1 3.41Å

Retrieved 65 of 65 residues in 149.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).