A0A913KVJ7_SCHMA Loading...

Uncharacterized protein AlphaSync

AlphaFold DB , UniProt , Accession A0A913KVJ7, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 36 aa.

>A0A913KVJ7_SCHMA|A0A913KVJ7
MTEENFCLLFITGVAKLKPGYDVNESCHGTTWRTYV
Structure Viewer
Loading PAE data...
(Predicted Aligned Error values between residue pairs)
Error loading PAE data: please refresh the page.

 

Download Structure   AlphaSync Parameters   PDB   PAE   Table  
Site Residue pLDDT pLDDT confidence pLDDT10 pLDDT10 confidence SASA SASA [Ų] SASA10 SASA10 [Ų] RSA RSA unformatted RSA10 RSA10 unformatted Surface Surface10 (not used) Disorder (not used) Disorder Sec. str. Secondary structure Isomer Phi (φ) Psi (ψ) Omega (ω) Chi 1 (χ1) Chi 2 (χ2) Chi 3 (χ3) Chi 4 (χ4) Chi 5 (χ5) Tau (τ) Contacts (colored by PAE) Contact details
1M63.4Low81.6Confident238 Ų238106.5 Ų106.5100%1.17253%0.529SS*.  0131.40-64.5179.1-8300106.9
2T81.1Confident81.7Confident91 Ų91103 Ų10356%0.55852%0.519SS*.  trans-90.4147.2-177.745.40000110.5E4 N5 F6T2-E4 PolarHBondContact O-N 2.97Å; T2-N5 WeakPolarHBondContact O-CB 3.3Å; T2-N5 PolarHBondContact O-N 3.35Å; T2-F6 PolarHBondContact O-N 2.95Å
3E81.9Confident82Confident133 Ų13397.4 Ų97.462%0.62150%0.502SS*.Hα-helixtrans-56.7-35-179.4-77.8-17783.500112.7N5 F6 C7 H28E3-N5 VanDerWaalsContact C-N 3.3Å; E3-N5 PolarHBondContact O-N 3.47Å; E3-F6 WeakPolarHBondContact O-CB 3.29Å; E3-F6 PolarHBondContact O-N 3.48Å; E3-C7 PolarHBondContact O-N 2.79Å; E3-H28 IonicContact OE1-CD2 3.85Å; E3-H28 IonicContact OE1-CE1 3.59Å; E3-H28 IonicContact OE1-NE2 2.79Å; E3-H28 PolarHBondContact OE1-NE2 2.88Å; E3-H28 IonicContact OE2-CE1 3.98Å; E3-H28 IonicContact OE2-NE2 3.75Å
4E80.4Confident81.9Confident119 Ų11993.2 Ų93.256%0.55648%0.483SS*.Hα-helixtrans-58.3-41174.8-69-159.798.300112.6T2 F6 C7 L8T2-E4 PolarHBondContact O-N 2.97Å; E4-F6 VanDerWaalsContact C-N 3.3Å; E4-F6 PolarHBondContact O-N 2.81Å; E4-C7 PolarHBondContact O-N 2.71Å; E4-L8 PolarHBondContact O-N 2.87Å
5N84Confident81.8Confident99 Ų9987.2 Ų87.253%0.52945%0.453SS..Hα-helixtrans-65.6-35.7176.2-98.710.8000111.6T2 E3 L8 L9T2-N5 WeakPolarHBondContact O-CB 3.3Å; T2-N5 PolarHBondContact O-N 3.35Å; E3-N5 VanDerWaalsContact C-N 3.3Å; E3-N5 PolarHBondContact O-N 3.47Å; N5-L8 PolarHBondContact O-N 3.23Å; N5-L9 WeakPolarHBondContact O-CB 3.34Å; N5-L9 VanDerWaalsContact O-CG 3.24Å; N5-L9 WeakPolarHBondContact O-CG 3.34Å; N5-L9 PolarHBondContact O-N 3.43Å
6F83.8Confident81.7Confident150 Ų15092.7 Ų92.766%0.65847%0.472SS*.Hα-helixtrans-65.9-42.7176.7-172.8-95.7000111.2T2 E3 E4 L9 F10T2-F6 PolarHBondContact O-N 2.95Å; E3-F6 WeakPolarHBondContact O-CB 3.29Å; E3-F6 PolarHBondContact O-N 3.48Å; E4-F6 VanDerWaalsContact C-N 3.3Å; E4-F6 PolarHBondContact O-N 2.81Å; F6-L9 PolarHBondContact O-N 3.24Å; F6-F10 WeakPolarHBondContact O-CB 2.99Å; F6-F10 PolarHBondContact O-N 2.83Å
7C85Confident81.6Confident26 Ų2695.7 Ų95.718%0.17649%0.489CS..Hα-helixtrans-65.3-41.5175.6-77.30000112.9E3 E4 L9 F10 I11 C27E3-C7 PolarHBondContact O-N 2.79Å; E4-C7 PolarHBondContact O-N 2.71Å; C7-L9 VanDerWaalsContact C-N 3.3Å; C7-L9 PolarHBondContact O-N 2.95Å; C7-F10 WeakPolarHBondContact O-CB 3.46Å; C7-F10 PolarHBondContact O-N 2.91Å; C7-F10 VanDerWaalsContact O-N 3.15Å; C7-I11 VanDerWaalsContact O-CG1 3.22Å; C7-I11 WeakPolarHBondContact O-CG1 3.42Å; C7-I11 PolarHBondContact O-N 3.42Å; C7-C27 HydrophobicContact CB-CB 3.33Å; C7-C27 WeakPolarHBondContact CB-SG 3.47Å; C7-C27 WeakPolarHBondContact SG-CB 3.47Å; C7-C27 CovalentContact SG-SG 2Å; C7-C27 PolarHBondContact SG-SG 3.15Å
8L83.5Confident81.3Confident73 Ų7397.3 Ų97.338%0.38249%0.492SS..Hα-helixtrans-61.4-42.1176-147.899.2000111.4E4 N5 F10 I11 T12 W32E4-L8 PolarHBondContact O-N 2.87Å; N5-L8 PolarHBondContact O-N 3.23Å; L8-F10 VanDerWaalsContact C-N 3.34Å; L8-I11 PolarHBondContact O-N 3.27Å; L8-T12 WeakPolarHBondContact O-CB 3.29Å; L8-T12 WeakPolarHBondContact O-CG2 3.37Å; L8-T12 PolarHBondContact O-N 3.27Å; L8-T12 PolarHBondContact O-OG1 3.09Å; L8-W32 HydrophobicContact CD1-CD2 4.16Å; L8-W32 HydrophobicContact CD1-CE3 4.14Å; L8-W32 HydrophobicContact CD1-CH2 3.69Å; L8-W32 HydrophobicContact CD1-CZ2 3.7Å; L8-W32 HydrophobicContact CD1-CZ3 3.91Å
9L85.3Confident81.1Confident121 Ų12197.1 Ų97.163%0.63450%0.497SS*.Hα-helixtrans-63.3-39.2174.2-73.5169000112N5 F6 C7 T12 G13N5-L9 WeakPolarHBondContact O-CB 3.34Å; N5-L9 VanDerWaalsContact O-CG 3.24Å; N5-L9 WeakPolarHBondContact O-CG 3.34Å; N5-L9 PolarHBondContact O-N 3.43Å; F6-L9 PolarHBondContact O-N 3.24Å; C7-L9 VanDerWaalsContact C-N 3.3Å; C7-L9 PolarHBondContact O-N 2.95Å; L9-T12 WeakPolarHBondContact CA-OG1 3.44Å; L9-T12 PolarHBondContact O-OG1 2.84Å; L9-G13 PolarHBondContact O-N 3.45Å
10F83.9Confident81.2Confident112 Ų11294.7 Ų94.749%0.49150%0.498SS..Hα-helixtrans-63.9-50.9176.8-176.4-99000111.2F6 C7 L8 T12 G13 V14F6-F10 WeakPolarHBondContact O-CB 2.99Å; F6-F10 PolarHBondContact O-N 2.83Å; C7-F10 WeakPolarHBondContact O-CB 3.46Å; C7-F10 PolarHBondContact O-N 2.91Å; C7-F10 VanDerWaalsContact O-N 3.15Å; L8-F10 VanDerWaalsContact C-N 3.34Å; F10-T12 PolarHBondContact O-N 3.43Å; F10-G13 WeakPolarHBondContact O-CA 3.44Å; F10-G13 PolarHBondContact O-N 3.25Å; F10-G13 VanDerWaalsContact O-N 3.11Å; F10-V14 HydrophobicContact CD1-CG2 4.07Å; F10-V14 HydrophobicContact CE1-CG2 3.7Å; F10-V14 HydrophobicContact CE2-CG2 4.27Å; F10-V14 HydrophobicContact CZ-CG2 3.81Å; F10-V14 WeakPolarHBondContact O-CG2 3.2Å; F10-V14 PolarHBondContact O-N 3.35Å
11I84.9Confident81.1Confident9 Ų997.6 Ų97.65%0.04650%0.503CS..Hα-helixtrans-63.9-44.2-176.7-61.9171.8000110.3C7 L8 G13 V14 A15 V23 E25 W32 T34C7-I11 VanDerWaalsContact O-CG1 3.22Å; C7-I11 WeakPolarHBondContact O-CG1 3.42Å; C7-I11 PolarHBondContact O-N 3.42Å; L8-I11 PolarHBondContact O-N 3.27Å; I11-G13 VanDerWaalsContact C-N 3.33Å; I11-G13 PolarHBondContact O-N 3.1Å; I11-V14 PolarHBondContact O-N 3.03Å; I11-A15 WeakPolarHBondContact O-CB 2.93Å; I11-A15 PolarHBondContact O-N 3.49Å; I11-V23 HydrophobicContact CG2-CG1 4.32Å; I11-E25 HydrophobicContact CD1-CB 3.83Å; I11-E25 HydrophobicContact CG1-CB 3.74Å; I11-E25 HydrophobicContact CG1-CG 4.43Å; I11-W32 HydrophobicContact CD1-CB 3.72Å; I11-W32 HydrophobicContact CD1-CG 3.93Å; I11-W32 HydrophobicContact CG2-CB 4.41Å; I11-T34 HydrophobicContact CG2-CG2 4.03Å
12T83.5Confident82.1Confident65 Ų6589.1 Ų89.140%0.39946%0.463SS..Hα-helixtrans-66.8-31.5174.752.10000113.2L8 L9 F10 K16L8-T12 WeakPolarHBondContact O-CB 3.29Å; L8-T12 WeakPolarHBondContact O-CG2 3.37Å; L8-T12 PolarHBondContact O-N 3.27Å; L8-T12 PolarHBondContact O-OG1 3.09Å; L9-T12 WeakPolarHBondContact CA-OG1 3.44Å; L9-T12 PolarHBondContact O-OG1 2.84Å; F10-T12 PolarHBondContact O-N 3.43Å; T12-K16 WeakPolarHBondContact O-CG 3.41Å; T12-K16 PolarHBondContact O-N 3.44Å; T12-K16 VanDerWaalsContact O-N 3.09Å
13G85.8Confident82.1Confident30 Ų3085.3 Ų85.331%0.30944%0.439SS..Hα-helixtrans-68-47173.100000112.9L9 F10 I11 A15 K16 L17L9-G13 PolarHBondContact O-N 3.45Å; F10-G13 WeakPolarHBondContact O-CA 3.44Å; F10-G13 PolarHBondContact O-N 3.25Å; F10-G13 VanDerWaalsContact O-N 3.11Å; I11-G13 VanDerWaalsContact C-N 3.33Å; I11-G13 PolarHBondContact O-N 3.1Å; G13-A15 VanDerWaalsContact C-N 3.25Å; G13-A15 PolarHBondContact O-N 2.74Å; G13-K16 PolarHBondContact O-N 2.91Å; G13-L17 PolarHBondContact O-N 2.94Å
14V80.5Confident82.2Confident39 Ų3983 Ų8324%0.23643%0.431CS..Hα-helixtrans-58.8-42.9173.6172.60000110F10 I11 K16 L17 K18 V23F10-V14 HydrophobicContact CD1-CG2 4.07Å; F10-V14 HydrophobicContact CE1-CG2 3.7Å; F10-V14 HydrophobicContact CE2-CG2 4.27Å; F10-V14 HydrophobicContact CZ-CG2 3.81Å; F10-V14 WeakPolarHBondContact O-CG2 3.2Å; F10-V14 PolarHBondContact O-N 3.35Å; I11-V14 PolarHBondContact O-N 3.03Å; V14-K16 VanDerWaalsContact C-N 3.35Å; V14-K16 PolarHBondContact O-N 3.43Å; V14-L17 PolarHBondContact O-N 3.41Å; V14-L17 VanDerWaalsContact O-N 3.1Å; V14-K18 PolarHBondContact O-N 3.13Å; V14-V23 HydrophobicContact CG1-CG1 3.98Å; V14-V23 HydrophobicContact CG1-CG2 4.19Å
15A80.6Confident82.3Confident3 Ų381.4 Ų81.43%0.02542%0.424CS..Hα-helixtrans-59.2-46178.700000111.3I11 G13 L17 K18 T34 V36I11-A15 WeakPolarHBondContact O-CB 2.93Å; I11-A15 PolarHBondContact O-N 3.49Å; G13-A15 VanDerWaalsContact C-N 3.25Å; G13-A15 PolarHBondContact O-N 2.74Å; A15-L17 PolarHBondContact O-N 3.01Å; A15-K18 CarbonylContact O-C 3.58Å; A15-K18 PolarHBondContact O-N 3.16Å; A15-T34 HydrophobicContact CB-CG2 3.82Å; A15-V36 VanDerWaalsContact C-CG1 3.49Å; A15-V36 VanDerWaalsContact CA-CG2 3.4Å; A15-V36 HydrophobicContact CB-CB 3.96Å; A15-V36 HydrophobicContact CB-CG1 3.4Å; A15-V36 HydrophobicContact CB-CG2 3.46Å; A15-V36 VanDerWaalsContact CB-CG2 3.46Å; A15-V36 WeakPolarHBondContact O-CB 3.24Å; A15-V36 WeakPolarHBondContact O-CG1 3.44Å; A15-V36 VanDerWaalsContact O-CG2 3.29Å; A15-V36 WeakPolarHBondContact O-CG2 3.44Å
16K79.7Confident82.2Confident175 Ų17580.8 Ų80.876%0.76143%0.427SS*.Hα-helixtrans-62.4-26.3176.4-76.2177.3179.8177.30114.4T12 G13 V14T12-K16 WeakPolarHBondContact O-CG 3.41Å; T12-K16 PolarHBondContact O-N 3.44Å; T12-K16 VanDerWaalsContact O-N 3.09Å; G13-K16 PolarHBondContact O-N 2.91Å; V14-K16 VanDerWaalsContact C-N 3.35Å; V14-K16 PolarHBondContact O-N 3.43Å
17L79.9Confident82.1Confident144 Ų14474.6 Ų74.675%0.75440%0.402SS*.Hα-helixtrans-83.2-21.9-179-73.5163.9000113.3G13 V14 A15G13-L17 PolarHBondContact O-N 2.94Å; V14-L17 PolarHBondContact O-N 3.41Å; V14-L17 VanDerWaalsContact O-N 3.1Å; A15-L17 PolarHBondContact O-N 3.01Å
18K77Confident82Confident125 Ų12579.7 Ų79.754%0.54342%0.423SS..SBendtrans-131.573.8-179.3-69-176.5-178.1175.40111.2V14 A15 Y21V14-K18 PolarHBondContact O-N 3.13Å; A15-K18 CarbonylContact O-C 3.58Å; A15-K18 PolarHBondContact O-N 3.16Å; K18-Y21 HydrophobicContact CB-CD2 4.28Å; K18-Y21 HydrophobicContact CB-CG 4.48Å; K18-Y21 PolarHBondContact O-N 2Å
19P77Confident82Confident92 Ų9280 Ų8060%0.59744%0.444SS*.THydrogen-bonded Turntrans-62.4141.3172.626.8-32.9000110.6
20G82.2Confident81.7Confident49 Ų4977.2 Ų77.251%0.50543%0.432SS..THydrogen-bonded Turntrans87.71.8-178.600000115.4V36G20-V36 VanDerWaalsContact CA-O 3.3Å; G20-V36 WeakPolarHBondContact CA-O 3.4Å; G20-V36 PolarHBondContact N-O 2.79Å
21Y79.7Confident81.7Confident157 Ų15776 Ų7662%0.61643%0.434SS*.SBendtrans-107.5144.1179.7-81.3-98.8000112.2K18 V23K18-Y21 HydrophobicContact CB-CD2 4.28Å; K18-Y21 HydrophobicContact CB-CG 4.48Å; K18-Y21 PolarHBondContact O-N 2Å; Y21-V23 PolarHBondContact O-N 2.89Å
22D84.3Confident81.4Confident59 Ų5980.9 Ų80.932%0.31645%0.452SS..EExtended strand (participates in β ladder)trans-75.7110.6167.8-165.4-96.8000108.4R33 Y35D22-R33 VanDerWaalsContact CG-NE 3.31Å; D22-R33 IonicContact OD1-CZ 3.62Å; D22-R33 IonicContact OD1-NE 2.97Å; D22-R33 PolarHBondContact OD1-NE 3.32Å; D22-R33 IonicContact OD1-NH2 3.48Å; D22-R33 PolarHBondContact OD1-NH2 3.25Å; D22-R33 IonicContact OD2-CZ 3.23Å; D22-R33 VanDerWaalsContact OD2-CZ 3.23Å; D22-R33 IonicContact OD2-NE 2.81Å; D22-R33 PolarHBondContact OD2-NE 3.43Å; D22-R33 IonicContact OD2-NH2 2.79Å; D22-R33 PolarHBondContact OD2-NH2 3Å; D22-Y35 HydrophobicContact CB-CD2 3.98Å; D22-Y35 HydrophobicContact CB-CE2 3.69Å; D22-Y35 VanDerWaalsContact OD2-CD2 3.29Å; D22-Y35 WeakPolarHBondContact OD2-CD2 3.36Å
23V80.4Confident81.4Confident11 Ų1186.1 Ų86.17%0.06746%0.464CS..EExtended strand (participates in β ladder)trans-97.5117174.7-179.40000107.7I11 V14 Y21 E25 R33 T34 V36I11-V23 HydrophobicContact CG2-CG1 4.32Å; V14-V23 HydrophobicContact CG1-CG1 3.98Å; V14-V23 HydrophobicContact CG1-CG2 4.19Å; Y21-V23 PolarHBondContact O-N 2.89Å; V23-E25 HydrophobicContact CG1-CG 3.83Å; V23-R33 CarbonylContact O-C 3.5Å; V23-R33 WeakPolarHBondContact O-CA 3.5Å; V23-T34 HydrophobicContact CB-CG2 4.14Å; V23-T34 PolarHBondContact N-O 3.35Å; V23-T34 PolarHBondContact O-N 3.05Å; V23-V36 HydrophobicContact CG2-CG2 4.07Å
24N84.4Confident81Confident84 Ų8487 Ų8745%0.44946%0.464SS..EExtended strand (participates in β ladder)trans-125.199.7178.6-171.8-29.5000108.9T31 W32 R33N24-T31 WeakPolarHBondContact OD1-CG2 3.22Å; N24-W32 WeakPolarHBondContact CA-O 2.98Å; N24-R33 HydrophobicContact CB-CG 4.42Å
25E82Confident80.7Confident86 Ų8692.9 Ų92.940%0.40248%0.483SS..EExtended strand (participates in β ladder)trans-125.2135.2-174.1-72.5-66.3130.500109.9I11 V23 W32I11-E25 HydrophobicContact CD1-CB 3.83Å; I11-E25 HydrophobicContact CG1-CB 3.74Å; I11-E25 HydrophobicContact CG1-CG 4.43Å; V23-E25 HydrophobicContact CG1-CG 3.83Å; E25-W32 PolarHBondContact N-O 3.35Å; E25-W32 PolarHBondContact O-N 3.04Å
26S83.3Confident80Confident87 Ų8796.3 Ų96.361%0.60850%0.504SS*.EExtended strand (participates in β ladder)trans-105.3129.1178.6570000111
27C81.9Confident80Confident19 Ų1992.4 Ų92.413%0.12849%0.491CS..EExtended strand (participates in β ladder)trans-132.2128.3173.6175.40000111.4C7 G29 T30C7-C27 HydrophobicContact CB-CB 3.33Å; C7-C27 WeakPolarHBondContact CB-SG 3.47Å; C7-C27 WeakPolarHBondContact SG-CB 3.47Å; C7-C27 CovalentContact SG-SG 2Å; C7-C27 PolarHBondContact SG-SG 3.15Å; C27-G29 PolarHBondContact O-N 3.48Å; C27-G29 VanDerWaalsContact O-N 3.13Å; C27-T30 PolarHBondContact N-O 2.91Å; C27-T30 PolarHBondContact O-N 2.93Å
28H81.6Confident80Confident134 Ų13489.6 Ų89.662%0.6248%0.477SS*.THydrogen-bonded Turntrans47.939.1179.7-81.7-83.1000114.1E3 T30E3-H28 IonicContact OE1-CD2 3.85Å; E3-H28 IonicContact OE1-CE1 3.59Å; E3-H28 IonicContact OE1-NE2 2.79Å; E3-H28 PolarHBondContact OE1-NE2 2.88Å; E3-H28 IonicContact OE2-CE1 3.98Å; E3-H28 IonicContact OE2-NE2 3.75Å; H28-T30 VanDerWaalsContact C-N 3.3Å; H28-T30 PolarHBondContact O-N 3.11Å
29G83.1Confident80.2Confident80 Ų8087.7 Ų87.783%0.82547%0.473SS*.THydrogen-bonded Turntrans84.6-6.4178.900000115.1C27C27-G29 PolarHBondContact O-N 3.48Å; C27-G29 VanDerWaalsContact O-N 3.13Å
30T79.2Confident80.4Confident61 Ų6187.4 Ų87.437%0.37447%0.466SS..EExtended strand (participates in β ladder)trans-100.3118.5171.9-55.90000109.9C27 H28 W32C27-T30 PolarHBondContact N-O 2.91Å; C27-T30 PolarHBondContact O-N 2.93Å; H28-T30 VanDerWaalsContact C-N 3.3Å; H28-T30 PolarHBondContact O-N 3.11Å; T30-W32 HydrophobicContact CG2-CZ2 4.06Å
31T84.3Confident80.3Confident88 Ų8889.8 Ų89.854%0.5446%0.463SS..EExtended strand (participates in β ladder)trans-89.4125.3175.5-580000110.5N24N24-T31 WeakPolarHBondContact OD1-CG2 3.22Å
32W78.5Confident80.3Confident111 Ų11185.3 Ų85.342%0.4245%0.453SS..EExtended strand (participates in β ladder)trans-110.8126175.6-60.182.2000109.2L8 I11 N24 E25 T30L8-W32 HydrophobicContact CD1-CD2 4.16Å; L8-W32 HydrophobicContact CD1-CE3 4.14Å; L8-W32 HydrophobicContact CD1-CH2 3.69Å; L8-W32 HydrophobicContact CD1-CZ2 3.7Å; L8-W32 HydrophobicContact CD1-CZ3 3.91Å; I11-W32 HydrophobicContact CD1-CB 3.72Å; I11-W32 HydrophobicContact CD1-CG 3.93Å; I11-W32 HydrophobicContact CG2-CB 4.41Å; N24-W32 WeakPolarHBondContact CA-O 2.98Å; E25-W32 PolarHBondContact N-O 3.35Å; E25-W32 PolarHBondContact O-N 3.04Å; T30-W32 HydrophobicContact CG2-CZ2 4.06Å
33R83.9Confident80Confident174 Ų17487.2 Ų87.266%0.65746%0.463SS*.EExtended strand (participates in β ladder)trans-113.5119.1173.3-173.5178.6-175.6-170.2-3.7108.1D22 V23 N24D22-R33 VanDerWaalsContact CG-NE 3.31Å; D22-R33 IonicContact OD1-CZ 3.62Å; D22-R33 IonicContact OD1-NE 2.97Å; D22-R33 PolarHBondContact OD1-NE 3.32Å; D22-R33 IonicContact OD1-NH2 3.48Å; D22-R33 PolarHBondContact OD1-NH2 3.25Å; D22-R33 IonicContact OD2-CZ 3.23Å; D22-R33 VanDerWaalsContact OD2-CZ 3.23Å; D22-R33 IonicContact OD2-NE 2.81Å; D22-R33 PolarHBondContact OD2-NE 3.43Å; D22-R33 IonicContact OD2-NH2 2.79Å; D22-R33 PolarHBondContact OD2-NH2 3Å; V23-R33 CarbonylContact O-C 3.5Å; V23-R33 WeakPolarHBondContact O-CA 3.5Å; N24-R33 HydrophobicContact CB-CG 4.42Å
34T78.4Confident80Confident50 Ų5093.1 Ų93.131%0.30749%0.494SS..EExtended strand (participates in β ladder)trans-128.7136.9174.3-166.70000109.5I11 A15 V23I11-T34 HydrophobicContact CG2-CG2 4.03Å; A15-T34 HydrophobicContact CB-CG2 3.82Å; V23-T34 HydrophobicContact CB-CG2 4.14Å; V23-T34 PolarHBondContact N-O 3.35Å; V23-T34 PolarHBondContact O-N 3.05Å
35Y73Confident79.6Confident161 Ų16193.8 Ų93.863%0.63150%0.497SS*.EExtended strand (participates in β ladder)trans-96.5131.1168.4-137-86.1000107.1D22D22-Y35 HydrophobicContact CB-CD2 3.98Å; D22-Y35 HydrophobicContact CB-CE2 3.69Å; D22-Y35 VanDerWaalsContact OD2-CD2 3.29Å; D22-Y35 WeakPolarHBondContact OD2-CD2 3.36Å
36V66.1Low79.4Confident75 Ų7594.5 Ų94.546%0.45551%0.506SS..  trans-116.80179.1-116.50000111.3A15 G20 V23A15-V36 VanDerWaalsContact C-CG1 3.49Å; A15-V36 VanDerWaalsContact CA-CG2 3.4Å; A15-V36 HydrophobicContact CB-CB 3.96Å; A15-V36 HydrophobicContact CB-CG1 3.4Å; A15-V36 HydrophobicContact CB-CG2 3.46Å; A15-V36 VanDerWaalsContact CB-CG2 3.46Å; A15-V36 WeakPolarHBondContact O-CB 3.24Å; A15-V36 WeakPolarHBondContact O-CG1 3.44Å; A15-V36 VanDerWaalsContact O-CG2 3.29Å; A15-V36 WeakPolarHBondContact O-CG2 3.44Å; G20-V36 VanDerWaalsContact CA-O 3.3Å; G20-V36 WeakPolarHBondContact CA-O 3.4Å; G20-V36 PolarHBondContact N-O 2.79Å; V23-V36 HydrophobicContact CG2-CG2 4.07Å

Retrieved 36 of 36 residues in 19.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).