A0A913KVL2_SCHMA Loading...

Uncharacterized protein AlphaSync

AlphaFold DB , UniProt , Accession A0A913KVL2, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 46 aa.

						>A0A913KVL2_SCHMA|A0A913KVL2
MTKLNIKSYIVPILFFSIGATIILVVSILYIYYKMESVANARDDCC
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.2	Low	72.9	Confident	241 Å²	241	134.6 Å²	134.6	100%	1.187	69%	0.685	S	S	*	*				0	107.6	0	-69	172.7	-177.6	0	0	107.5	K3	M1-K3 PolarHBondContact O-N 3.13Å; M1-K3 VanDerWaalsContact O-N 3.13Å
2	T	62.7	Low	74.3	Confident	127 Å²	127	129.4 Å²	129.4	78%	0.779	67%	0.667	S	S	*	*			trans	-62.3	114.6	-174.9	-28.9	0	0	0	0	108.3	L4	T2-L4 HydrophobicContact CG2-CD1 4.46Å; T2-L4 PolarHBondContact O-N 2.93Å
3	K	66.4	Low	75.6	Confident	190 Å²	190	128.2 Å²	128.2	83%	0.826	66%	0.66	S	S	*	*			trans	-62.9	84.9	162.9	-84.2	174.2	174.3	174.1	0	105.9	M1 N5	M1-K3 PolarHBondContact O-N 3.13Å; M1-K3 VanDerWaalsContact O-N 3.13Å; K3-N5 VanDerWaalsContact C-N 3.33Å; K3-N5 PolarHBondContact O-N 2.76Å
4	L	66	Low	76.7	Confident	105 Å²	105	126.1 Å²	126.1	55%	0.55	65%	0.65	S	S	.	*			trans	-59.4	106.9	165.8	-101.5	86.2	0	0	0	104.6	T2 I6 Y9	T2-L4 HydrophobicContact CG2-CD1 4.46Å; T2-L4 PolarHBondContact O-N 2.93Å; L4-I6 PolarHBondContact O-N 2.73Å; L4-Y9 HydrophobicContact CB-CE2 4.06Å; L4-Y9 HydrophobicContact CD2-CD2 4.17Å; L4-Y9 HydrophobicContact CD2-CE1 4.4Å; L4-Y9 HydrophobicContact CD2-CE2 3.38Å; L4-Y9 VanDerWaalsContact CD2-CZ 3.49Å; L4-Y9 WeakPolarHBondContact CD2-OH 3.26Å; L4-Y9 HydrophobicContact CG-CE2 3.72Å
5	N	72.2	Confident	77.7	Confident	123 Å²	123	128.9 Å²	128.9	66%	0.658	66%	0.656	S	S	*	*			trans	-61.3	90.3	170.9	-75.5	-24.3	0	0	0	106.6	K3 K7 S8	K3-N5 VanDerWaalsContact C-N 3.33Å; K3-N5 PolarHBondContact O-N 2.76Å; N5-K7 PolarHBondContact O-N 3.27Å; N5-S8 VanDerWaalsContact O-CB 3.29Å; N5-S8 WeakPolarHBondContact O-CB 3.42Å; N5-S8 PolarHBondContact O-N 2.8Å
6	I	72.5	Confident	78.8	Confident	126 Å²	126	130.8 Å²	130.8	65%	0.646	66%	0.658	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53.7	-30.1	-173.3	-162.7	155.6	0	0	0	111.9	L4 S8 Y9 I10	L4-I6 PolarHBondContact O-N 2.73Å; I6-S8 VanDerWaalsContact C-N 3.25Å; I6-S8 PolarHBondContact O-N 3.45Å; I6-Y9 PolarHBondContact O-N 3.25Å; I6-Y9 VanDerWaalsContact O-N 3.13Å; I6-I10 HydrophobicContact CG1-CD1 4.49Å; I6-I10 WeakPolarHBondContact O-CG1 3.44Å; I6-I10 PolarHBondContact O-N 3.13Å
7	K	76.8	Confident	79.7	Confident	172 Å²	172	126.1 Å²	126.1	75%	0.748	64%	0.641	S	S	*	*	H	α-helix	trans	-56.4	-34.7	172.8	-68	-170.8	173.7	-173.7	0	113.6	N5 Y9 I10	N5-K7 PolarHBondContact O-N 3.27Å; K7-Y9 VanDerWaalsContact C-N 3.25Å; K7-Y9 PolarHBondContact O-N 3.46Å; K7-I10 PolarHBondContact O-N 3.01Å
8	S	78.5	Confident	80.6	Confident	81 Å²	81	124 Å²	124	57%	0.566	63%	0.63	S	S	*	*	H	α-helix	trans	-69.5	-23.3	-179.5	-164.7	0	0	0	0	112.9	N5 I6 P12	N5-S8 VanDerWaalsContact O-CB 3.29Å; N5-S8 WeakPolarHBondContact O-CB 3.42Å; N5-S8 PolarHBondContact O-N 2.8Å; I6-S8 VanDerWaalsContact C-N 3.25Å; I6-S8 PolarHBondContact O-N 3.45Å; S8-P12 WeakPolarHBondContact O-CD 3.3Å; S8-P12 WeakPolarHBondContact O-CG 3.25Å
9	Y	81.1	Confident	81.4	Confident	120 Å²	120	118.8 Å²	118.8	47%	0.471	61%	0.611	S	S	.	*	H	α-helix	trans	-93.2	-26.9	179.1	-61.6	-84.5	0	0	0	112.2	L4 I6 K7 V11 P12 I13	L4-Y9 HydrophobicContact CB-CE2 4.06Å; L4-Y9 HydrophobicContact CD2-CD2 4.17Å; L4-Y9 HydrophobicContact CD2-CE1 4.4Å; L4-Y9 HydrophobicContact CD2-CE2 3.38Å; L4-Y9 VanDerWaalsContact CD2-CZ 3.49Å; L4-Y9 WeakPolarHBondContact CD2-OH 3.26Å; L4-Y9 HydrophobicContact CG-CE2 3.72Å; I6-Y9 PolarHBondContact O-N 3.25Å; I6-Y9 VanDerWaalsContact O-N 3.13Å; K7-Y9 VanDerWaalsContact C-N 3.25Å; K7-Y9 PolarHBondContact O-N 3.46Å; Y9-V11 VanDerWaalsContact C-N 3.35Å; Y9-V11 PolarHBondContact O-N 3.22Å; Y9-P12 VanDerWaalsContact O-CD 3.27Å; Y9-P12 WeakPolarHBondContact O-CD 3.5Å; Y9-P12 VanDerWaalsContact O-CG 3.3Å; Y9-P12 WeakPolarHBondContact O-CG 3.27Å; Y9-I13 WeakPolarHBondContact O-CB 3.05Å; Y9-I13 VanDerWaalsContact O-CD1 3.26Å; Y9-I13 WeakPolarHBondContact O-CD1 3.28Å; Y9-I13 WeakPolarHBondContact O-CG1 3.29Å; Y9-I13 PolarHBondContact O-N 3.37Å
10	I	85.6	Confident	82.2	Confident	93 Å²	93	115.2 Å²	115.2	48%	0.477	60%	0.599	S	S	.	*	H	α-helix	trans	-63	-42	178.7	-70.5	164.6	0	0	0	111.3	I6 K7 I13 L14	I6-I10 HydrophobicContact CG1-CD1 4.49Å; I6-I10 WeakPolarHBondContact O-CG1 3.44Å; I6-I10 PolarHBondContact O-N 3.13Å; K7-I10 PolarHBondContact O-N 3.01Å; I10-I13 PolarHBondContact O-N 2.91Å; I10-L14 VanDerWaalsContact O-CB 3.28Å; I10-L14 WeakPolarHBondContact O-CB 3.14Å; I10-L14 PolarHBondContact O-N 3.45Å
11	V	87.9	Confident	82.9	Confident	103 Å²	103	113.6 Å²	113.6	62%	0.624	60%	0.595	S	S	*	*	H	α-helix	trans	-61.2	-53.2	-179.1	-179.6	0	0	0	0	112.9	Y9 I13 L14 F15	Y9-V11 VanDerWaalsContact C-N 3.35Å; Y9-V11 PolarHBondContact O-N 3.22Å; V11-I13 VanDerWaalsContact C-N 3.34Å; V11-I13 PolarHBondContact O-N 2.89Å; V11-L14 PolarHBondContact O-N 3.44Å; V11-F15 WeakPolarHBondContact O-CB 3.44Å; V11-F15 PolarHBondContact O-N 2.93Å
12	P	89.3	Confident	85	Confident	72 Å²	72	107 Å²	107	47%	0.468	56%	0.563	S	S	.	*	H	α-helix	trans	-65.9	-35.1	178.8	23.7	-33.3	0	0	0	112.6	S8 Y9 L14 F15 F16	S8-P12 WeakPolarHBondContact O-CD 3.3Å; S8-P12 WeakPolarHBondContact O-CG 3.25Å; Y9-P12 VanDerWaalsContact O-CD 3.27Å; Y9-P12 WeakPolarHBondContact O-CD 3.5Å; Y9-P12 VanDerWaalsContact O-CG 3.3Å; Y9-P12 WeakPolarHBondContact O-CG 3.27Å; P12-L14 VanDerWaalsContact C-N 3.35Å; P12-F15 PolarHBondContact O-N 3.3Å; P12-F16 VanDerWaalsContact O-CB 3.25Å; P12-F16 WeakPolarHBondContact O-CB 3.44Å; P12-F16 PolarHBondContact O-N 3.45Å
13	I	91.2	Very high	86.7	Confident	114 Å²	114	106.4 Å²	106.4	59%	0.585	55%	0.554	S	S	*	*	H	α-helix	trans	-62.8	-44.4	175.3	-67.7	167.1	0	0	0	110.5	Y9 I10 V11 F16 S17	Y9-I13 WeakPolarHBondContact O-CB 3.05Å; Y9-I13 VanDerWaalsContact O-CD1 3.26Å; Y9-I13 WeakPolarHBondContact O-CD1 3.28Å; Y9-I13 WeakPolarHBondContact O-CG1 3.29Å; Y9-I13 PolarHBondContact O-N 3.37Å; I10-I13 PolarHBondContact O-N 2.91Å; V11-I13 VanDerWaalsContact C-N 3.34Å; V11-I13 PolarHBondContact O-N 2.89Å; I13-F16 PolarHBondContact O-N 3.28Å; I13-S17 WeakPolarHBondContact O-CB 3.47Å; I13-S17 PolarHBondContact O-N 2.9Å; I13-S17 PolarHBondContact O-OG 3.39Å
14	L	91.7	Very high	88.1	Confident	99 Å²	99	102.5 Å²	102.5	52%	0.518	54%	0.542	S	S	.	.	H	α-helix	trans	-65.8	-43.3	178.6	-173.9	65.8	0	0	0	111.6	I10 V11 P12 F16 S17 I18	I10-L14 VanDerWaalsContact O-CB 3.28Å; I10-L14 WeakPolarHBondContact O-CB 3.14Å; I10-L14 PolarHBondContact O-N 3.45Å; V11-L14 PolarHBondContact O-N 3.44Å; P12-L14 VanDerWaalsContact C-N 3.35Å; L14-F16 VanDerWaalsContact C-N 3.32Å; L14-F16 PolarHBondContact O-N 2.85Å; L14-S17 PolarHBondContact O-N 3.45Å; L14-S17 PolarHBondContact O-OG 2.7Å; L14-I18 HydrophobicContact CD1-CD1 4.18Å; L14-I18 HydrophobicContact CG-CD1 3.91Å; L14-I18 WeakPolarHBondContact O-CB 3.27Å; L14-I18 WeakPolarHBondContact O-CD1 3.4Å; L14-I18 WeakPolarHBondContact O-CG1 3.36Å; L14-I18 PolarHBondContact O-N 3.05Å
15	F	91.9	Very high	89.6	Confident	167 Å²	167	101 Å²	101	73%	0.732	54%	0.537	S	S	*	.	H	α-helix	trans	-62.3	-42.6	176.2	-172.9	-94.3	0	0	0	111.5	V11 P12 G19	V11-F15 WeakPolarHBondContact O-CB 3.44Å; V11-F15 PolarHBondContact O-N 2.93Å; P12-F15 PolarHBondContact O-N 3.3Å; F15-G19 PolarHBondContact O-N 2.94Å
16	F	94.1	Very high	90.9	Very high	159 Å²	159	99.4 Å²	99.4	70%	0.697	53%	0.532	S	S	*	.	H	α-helix	trans	-65.1	-43.2	177.8	-174	-97.3	0	0	0	112.2	P12 I13 L14 G19 A20	P12-F16 VanDerWaalsContact O-CB 3.25Å; P12-F16 WeakPolarHBondContact O-CB 3.44Å; P12-F16 PolarHBondContact O-N 3.45Å; I13-F16 PolarHBondContact O-N 3.28Å; L14-F16 VanDerWaalsContact C-N 3.32Å; L14-F16 PolarHBondContact O-N 2.85Å; F16-G19 PolarHBondContact O-N 2.95Å; F16-A20 VanDerWaalsContact O-CB 3.27Å; F16-A20 WeakPolarHBondContact O-CB 3.3Å; F16-A20 PolarHBondContact O-N 3.42Å
17	S	94.7	Very high	92.1	Very high	52 Å²	52	96 Å²	96	36%	0.364	52%	0.519	S	S	.	.	H	α-helix	trans	-66.3	-40.9	179.5	64.3	0	0	0	0	112.2	I13 L14 T21	I13-S17 WeakPolarHBondContact O-CB 3.47Å; I13-S17 PolarHBondContact O-N 2.9Å; I13-S17 PolarHBondContact O-OG 3.39Å; L14-S17 PolarHBondContact O-N 3.45Å; L14-S17 PolarHBondContact O-OG 2.7Å; S17-T21 WeakPolarHBondContact O-CB 3.22Å; S17-T21 PolarHBondContact O-N 3.39Å; S17-T21 PolarHBondContact O-OG1 2.94Å
18	I	95.9	Very high	93	Very high	88 Å²	88	92.5 Å²	92.5	45%	0.451	51%	0.507	S	S	.	.	H	α-helix	trans	-63.7	-48.2	174.5	-65.7	164.9	0	0	0	110.1	L14 A20 T21 I22	L14-I18 HydrophobicContact CD1-CD1 4.18Å; L14-I18 HydrophobicContact CG-CD1 3.91Å; L14-I18 WeakPolarHBondContact O-CB 3.27Å; L14-I18 WeakPolarHBondContact O-CD1 3.4Å; L14-I18 WeakPolarHBondContact O-CG1 3.36Å; L14-I18 PolarHBondContact O-N 3.05Å; I18-A20 PolarHBondContact O-N 3.47Å; I18-T21 WeakPolarHBondContact O-CB 3.5Å; I18-T21 PolarHBondContact O-N 2.75Å; I18-I22 HydrophobicContact CG2-CD1 3.89Å; I18-I22 WeakPolarHBondContact O-CG1 3.35Å; I18-I22 PolarHBondContact O-N 2.96Å
19	G	96.4	Very high	93.9	Very high	26 Å²	26	93.8 Å²	93.8	27%	0.268	51%	0.507	S	S	.	.	H	α-helix	trans	-58.8	-46.3	177.9	0	0	0	0	0	112.6	F15 F16 T21 I22 I23	F15-G19 PolarHBondContact O-N 2.94Å; F16-G19 PolarHBondContact O-N 2.95Å; G19-T21 VanDerWaalsContact C-N 3.33Å; G19-T21 PolarHBondContact O-N 3.28Å; G19-I22 PolarHBondContact O-N 2.93Å; G19-I23 VanDerWaalsContact O-CG1 3.3Å; G19-I23 WeakPolarHBondContact O-CG1 3.3Å; G19-I23 PolarHBondContact O-N 3.38Å
20	A	96.7	Very high	94.6	Very high	45 Å²	45	95.6 Å²	95.6	37%	0.372	51%	0.514	S	S	.	.	H	α-helix	trans	-61.5	-40.6	175.9	0	0	0	0	0	112.1	F16 I18 I23 L24	F16-A20 VanDerWaalsContact O-CB 3.27Å; F16-A20 WeakPolarHBondContact O-CB 3.3Å; F16-A20 PolarHBondContact O-N 3.42Å; I18-A20 PolarHBondContact O-N 3.47Å; A20-I23 PolarHBondContact O-N 3.33Å; A20-L24 WeakPolarHBondContact O-CB 3.36Å; A20-L24 PolarHBondContact O-N 3.41Å
21	T	96.8	Very high	95.1	Very high	83 Å²	83	96 Å²	96	51%	0.509	52%	0.516	S	S	.	.	H	α-helix	trans	-63.1	-44.8	177.5	-57.5	0	0	0	0	111.2	S17 I18 G19 L24 V25	S17-T21 WeakPolarHBondContact O-CB 3.22Å; S17-T21 PolarHBondContact O-N 3.39Å; S17-T21 PolarHBondContact O-OG1 2.94Å; I18-T21 WeakPolarHBondContact O-CB 3.5Å; I18-T21 PolarHBondContact O-N 2.75Å; G19-T21 VanDerWaalsContact C-N 3.33Å; G19-T21 PolarHBondContact O-N 3.28Å; T21-L24 PolarHBondContact O-N 3.02Å; T21-V25 VanDerWaalsContact O-CG2 3.3Å; T21-V25 WeakPolarHBondContact O-CG2 3.36Å; T21-V25 PolarHBondContact O-N 3.44Å
22	I	97.3	Very high	95.5	Very high	101 Å²	101	98.2 Å²	98.2	52%	0.518	51%	0.514	S	S	.	.	H	α-helix	trans	-61.5	-47.8	177.3	-66.9	166.1	0	0	0	110.5	I18 G19 L24 V25 V26	I18-I22 HydrophobicContact CG2-CD1 3.89Å; I18-I22 WeakPolarHBondContact O-CG1 3.35Å; I18-I22 PolarHBondContact O-N 2.96Å; G19-I22 PolarHBondContact O-N 2.93Å; I22-L24 VanDerWaalsContact C-N 3.29Å; I22-L24 PolarHBondContact O-N 3.32Å; I22-V25 PolarHBondContact O-N 3.19Å; I22-V26 HydrophobicContact CG2-CG2 4.39Å; I22-V26 VanDerWaalsContact O-CG2 3.31Å; I22-V26 WeakPolarHBondContact O-CG2 3.35Å; I22-V26 PolarHBondContact O-N 3.01Å
23	I	97.2	Very high	95.8	Very high	115 Å²	115	102.7 Å²	102.7	59%	0.59	52%	0.523	S	S	*	.	H	α-helix	trans	-59.8	-42.5	179	-67.6	164.2	0	0	0	110.8	G19 A20 V26 S27	G19-I23 VanDerWaalsContact O-CG1 3.3Å; G19-I23 WeakPolarHBondContact O-CG1 3.3Å; G19-I23 PolarHBondContact O-N 3.38Å; A20-I23 PolarHBondContact O-N 3.33Å; I23-V26 PolarHBondContact O-N 3.5Å; I23-S27 WeakPolarHBondContact O-CB 3.28Å; I23-S27 PolarHBondContact O-N 2.95Å; I23-S27 PolarHBondContact O-OG 3.43Å
24	L	97	Very high	96	Very high	108 Å²	108	103.1 Å²	103.1	57%	0.565	52%	0.521	S	S	*	.	H	α-helix	trans	-63.1	-47.5	178.2	-176.8	65.7	0	0	0	111.5	A20 T21 I22 V26 S27 I28	A20-L24 WeakPolarHBondContact O-CB 3.36Å; A20-L24 PolarHBondContact O-N 3.41Å; T21-L24 PolarHBondContact O-N 3.02Å; I22-L24 VanDerWaalsContact C-N 3.29Å; I22-L24 PolarHBondContact O-N 3.32Å; L24-V26 PolarHBondContact O-N 3.42Å; L24-S27 PolarHBondContact O-N 3.42Å; L24-I28 HydrophobicContact CD1-CD1 4.21Å; L24-I28 HydrophobicContact CG-CD1 3.97Å; L24-I28 WeakPolarHBondContact O-CG1 3.48Å; L24-I28 PolarHBondContact O-N 2.96Å
25	V	97.7	Very high	96.1	Very high	75 Å²	75	104.5 Å²	104.5	46%	0.455	53%	0.526	S	S	.	.	H	α-helix	trans	-60.8	-45.8	178.7	170.8	0	0	0	0	111.1	T21 I22 S27 I28 L29	T21-V25 VanDerWaalsContact O-CG2 3.3Å; T21-V25 WeakPolarHBondContact O-CG2 3.36Å; T21-V25 PolarHBondContact O-N 3.44Å; I22-V25 PolarHBondContact O-N 3.19Å; V25-S27 VanDerWaalsContact C-N 3.31Å; V25-S27 PolarHBondContact O-N 3.23Å; V25-I28 PolarHBondContact O-N 2.93Å; V25-L29 HydrophobicContact CG1-CD1 3.96Å; V25-L29 HydrophobicContact CG1-CG 4.47Å; V25-L29 WeakPolarHBondContact O-CB 3.32Å; V25-L29 WeakPolarHBondContact O-CG 3.31Å; V25-L29 PolarHBondContact O-N 3.27Å
26	V	97.8	Very high	96.1	Very high	89 Å²	89	100.4 Å²	100.4	54%	0.539	51%	0.51	S	S	.	.	H	α-helix	trans	-61.4	-42.1	177.2	172.4	0	0	0	0	111	I22 I23 L24 L29 Y30	I22-V26 HydrophobicContact CG2-CG2 4.39Å; I22-V26 VanDerWaalsContact O-CG2 3.31Å; I22-V26 WeakPolarHBondContact O-CG2 3.35Å; I22-V26 PolarHBondContact O-N 3.01Å; I23-V26 PolarHBondContact O-N 3.5Å; L24-V26 PolarHBondContact O-N 3.42Å; V26-L29 PolarHBondContact O-N 2.92Å; V26-Y30 WeakPolarHBondContact O-CB 3.42Å; V26-Y30 PolarHBondContact O-N 2.94Å
27	S	97.6	Very high	96	Very high	54 Å²	54	95.6 Å²	95.6	38%	0.378	50%	0.496	S	S	.	.	H	α-helix	trans	-64.2	-42.1	178.5	-58.6	0	0	0	0	111.9	I23 L24 V25 Y30 I31	I23-S27 WeakPolarHBondContact O-CB 3.28Å; I23-S27 PolarHBondContact O-N 2.95Å; I23-S27 PolarHBondContact O-OG 3.43Å; L24-S27 PolarHBondContact O-N 3.42Å; V25-S27 VanDerWaalsContact C-N 3.31Å; V25-S27 PolarHBondContact O-N 3.23Å; S27-Y30 PolarHBondContact O-N 3.3Å; S27-I31 VanDerWaalsContact O-CG1 3.28Å; S27-I31 WeakPolarHBondContact O-CG1 3.37Å; S27-I31 PolarHBondContact O-N 3.12Å
28	I	97.1	Very high	95.8	Very high	98 Å²	98	96.4 Å²	96.4	50%	0.503	50%	0.498	S	S	.	.	H	α-helix	trans	-64.7	-46	176.8	-68.9	168.9	0	0	0	110.7	L24 V25 Y30 I31 Y32	L24-I28 HydrophobicContact CD1-CD1 4.21Å; L24-I28 HydrophobicContact CG-CD1 3.97Å; L24-I28 WeakPolarHBondContact O-CG1 3.48Å; L24-I28 PolarHBondContact O-N 2.96Å; V25-I28 PolarHBondContact O-N 2.93Å; I28-Y30 VanDerWaalsContact C-N 3.31Å; I28-Y30 PolarHBondContact O-N 2.88Å; I28-I31 PolarHBondContact O-N 3.02Å; I28-Y32 WeakPolarHBondContact O-CB 3.5Å; I28-Y32 PolarHBondContact O-N 3.4Å
29	L	96.7	Very high	95.5	Very high	108 Å²	108	94.3 Å²	94.3	57%	0.565	49%	0.494	S	S	*	.	H	α-helix	trans	-60.7	-41.5	177.3	-74.5	170.8	0	0	0	111.8	V25 V26 Y32 Y33	V25-L29 HydrophobicContact CG1-CD1 3.96Å; V25-L29 HydrophobicContact CG1-CG 4.47Å; V25-L29 WeakPolarHBondContact O-CB 3.32Å; V25-L29 WeakPolarHBondContact O-CG 3.31Å; V25-L29 PolarHBondContact O-N 3.27Å; V26-L29 PolarHBondContact O-N 2.92Å; L29-Y32 PolarHBondContact O-N 2.95Å; L29-Y33 WeakPolarHBondContact O-CB 3.22Å; L29-Y33 PolarHBondContact O-N 3.48Å
30	Y	96.7	Very high	95.2	Very high	159 Å²	159	97.4 Å²	97.4	62%	0.624	50%	0.504	S	S	*	.	H	α-helix	trans	-62.4	-45.3	176.4	179.7	-98.3	0	0	0	112.2	V26 S27 I28 Y33 K34	V26-Y30 WeakPolarHBondContact O-CB 3.42Å; V26-Y30 PolarHBondContact O-N 2.94Å; S27-Y30 PolarHBondContact O-N 3.3Å; I28-Y30 VanDerWaalsContact C-N 3.31Å; I28-Y30 PolarHBondContact O-N 2.88Å; Y30-Y33 PolarHBondContact O-N 3.03Å; Y30-K34 WeakPolarHBondContact O-CB 3.49Å; Y30-K34 PolarHBondContact O-N 3.46Å
31	I	96.6	Very high	94.7	Very high	101 Å²	101	98.4 Å²	98.4	52%	0.518	51%	0.512	S	S	.	.	H	α-helix	trans	-63.5	-44.9	177	-67.9	164.7	0	0	0	110.5	S27 I28 Y33 K34 M35	S27-I31 VanDerWaalsContact O-CG1 3.28Å; S27-I31 WeakPolarHBondContact O-CG1 3.37Å; S27-I31 PolarHBondContact O-N 3.12Å; I28-I31 PolarHBondContact O-N 3.02Å; I31-Y33 PolarHBondContact O-N 3.21Å; I31-K34 PolarHBondContact O-N 2.95Å; I31-M35 HydrophobicContact CG2-CG 4.3Å; I31-M35 VanDerWaalsContact O-CG 3.3Å; I31-M35 WeakPolarHBondContact O-CG 3.3Å; I31-M35 PolarHBondContact O-N 3.11Å
32	Y	96.1	Very high	94.2	Very high	149 Å²	149	103.3 Å²	103.3	58%	0.584	52%	0.522	S	S	*	.	H	α-helix	trans	-57.6	-49.3	177.8	179.1	-89.5	0	0	0	111.4	I28 L29 K34 M35 E36	I28-Y32 WeakPolarHBondContact O-CB 3.5Å; I28-Y32 PolarHBondContact O-N 3.4Å; L29-Y32 PolarHBondContact O-N 2.95Å; Y32-K34 VanDerWaalsContact C-N 3.28Å; Y32-K34 PolarHBondContact O-N 3.4Å; Y32-M35 PolarHBondContact O-N 2.9Å; Y32-M35 VanDerWaalsContact O-N 3.11Å; Y32-E36 WeakPolarHBondContact CE1-OE2 3.41Å; Y32-E36 PolarHBondContact O-N 3.33Å; Y32-E36 PolarHBondContact OH-OE2 2.96Å; Y32-E36 VanDerWaalsContact OH-OE2 3.12Å
33	Y	95.2	Very high	93.6	Very high	166 Å²	166	104 Å²	104	65%	0.651	53%	0.527	S	S	*	.	H	α-helix	trans	-61.6	-37	178.3	-170.6	-98.7	0	0	0	112.5	L29 Y30 I31 S37	L29-Y33 WeakPolarHBondContact O-CB 3.22Å; L29-Y33 PolarHBondContact O-N 3.48Å; Y30-Y33 PolarHBondContact O-N 3.03Å; I31-Y33 PolarHBondContact O-N 3.21Å; Y33-S37 PolarHBondContact O-N 3.34Å; Y33-S37 PolarHBondContact O-OG 3Å
34	K	94.5	Very high	92.9	Very high	123 Å²	123	105.7 Å²	105.7	54%	0.535	54%	0.537	S	S	.	.	H	α-helix	trans	-67.8	-37.6	174.8	-173.5	176.8	-179.6	179.6	0	112.4	Y30 I31 Y32 S37 V38	Y30-K34 WeakPolarHBondContact O-CB 3.49Å; Y30-K34 PolarHBondContact O-N 3.46Å; I31-K34 PolarHBondContact O-N 2.95Å; Y32-K34 VanDerWaalsContact C-N 3.28Å; Y32-K34 PolarHBondContact O-N 3.4Å; K34-S37 PolarHBondContact O-OG 2.86Å; K34-V38 WeakPolarHBondContact O-CB 3.45Å; K34-V38 VanDerWaalsContact O-CG2 3.22Å; K34-V38 WeakPolarHBondContact O-CG2 3.31Å; K34-V38 PolarHBondContact O-N 3.36Å; K34-V38 VanDerWaalsContact O-N 3.12Å
35	M	93.5	Very high	92.1	Very high	129 Å²	129	105.7 Å²	105.7	64%	0.635	55%	0.545	S	S	*	.	H	α-helix	trans	-68.1	-41.5	176.5	-69.3	-69.6	-70.7	0	0	111	I31 Y32 V38 A39	I31-M35 HydrophobicContact CG2-CG 4.3Å; I31-M35 VanDerWaalsContact O-CG 3.3Å; I31-M35 WeakPolarHBondContact O-CG 3.3Å; I31-M35 PolarHBondContact O-N 3.11Å; Y32-M35 PolarHBondContact O-N 2.9Å; Y32-M35 VanDerWaalsContact O-N 3.11Å; M35-V38 PolarHBondContact O-N 3.47Å; M35-A39 WeakPolarHBondContact O-CB 3.44Å; M35-A39 PolarHBondContact O-N 2.93Å
36	E	92.7	Very high	90.8	Very high	81 Å²	81	110.5 Å²	110.5	38%	0.379	58%	0.58	S	S	.	*	H	α-helix	trans	-63.5	-44.1	176.6	-169.7	173.2	111	0	0	111.7	Y32 V38 A39 N40	Y32-E36 WeakPolarHBondContact CE1-OE2 3.41Å; Y32-E36 PolarHBondContact O-N 3.33Å; Y32-E36 PolarHBondContact OH-OE2 2.96Å; Y32-E36 VanDerWaalsContact OH-OE2 3.12Å; E36-V38 VanDerWaalsContact C-N 3.34Å; E36-V38 PolarHBondContact O-N 3.33Å; E36-A39 PolarHBondContact O-N 3.31Å; E36-N40 PolarHBondContact O-N 2.9Å; E36-N40 PolarHBondContact O-OD1 3.04Å
37	S	90.9	Very high	90.4	Very high	58 Å²	58	111.6 Å²	111.6	41%	0.406	58%	0.582	S	S	.	*	H	α-helix	trans	-65.2	-36.3	176.4	67	0	0	0	0	113	Y33 K34 A41	Y33-S37 PolarHBondContact O-N 3.34Å; Y33-S37 PolarHBondContact O-OG 3Å; K34-S37 PolarHBondContact O-OG 2.86Å; S37-A41 VanDerWaalsContact O-CB 3.31Å; S37-A41 WeakPolarHBondContact O-CB 3.42Å; S37-A41 PolarHBondContact O-N 3.2Å
38	V	90.7	Very high	90	Very high	68 Å²	68	114.6 Å²	114.6	41%	0.412	59%	0.592	S	S	.	*	H	α-helix	trans	-68.9	-36.4	173.4	171.2	0	0	0	0	111.8	K34 M35 E36 R42	K34-V38 WeakPolarHBondContact O-CB 3.45Å; K34-V38 VanDerWaalsContact O-CG2 3.22Å; K34-V38 WeakPolarHBondContact O-CG2 3.31Å; K34-V38 PolarHBondContact O-N 3.36Å; K34-V38 VanDerWaalsContact O-N 3.12Å; M35-V38 PolarHBondContact O-N 3.47Å; E36-V38 VanDerWaalsContact C-N 3.34Å; E36-V38 PolarHBondContact O-N 3.33Å; V38-R42 WeakPolarHBondContact O-CG 3.2Å; V38-R42 PolarHBondContact O-N 3.42Å
39	A	90	Very high	89.6	Confident	44 Å²	44	115.6 Å²	115.6	36%	0.364	60%	0.597	S	S	.	*	H	α-helix	trans	-65.4	-51	175.8	0	0	0	0	0	110.8	M35 E36 A41 R42 D43	M35-A39 WeakPolarHBondContact O-CB 3.44Å; M35-A39 PolarHBondContact O-N 2.93Å; E36-A39 PolarHBondContact O-N 3.31Å; A39-A41 VanDerWaalsContact C-N 3.3Å; A39-A41 PolarHBondContact O-N 3.19Å; A39-R42 WeakPolarHBondContact O-CA 3.39Å; A39-R42 WeakPolarHBondContact O-CB 3.49Å; A39-R42 PolarHBondContact O-N 3.42Å; A39-D43 PolarHBondContact O-N 3.06Å
40	N	89.5	Confident	89.2	Confident	91 Å²	91	116 Å²	116	49%	0.487	60%	0.599	S	S	.	*	H	α-helix	trans	-59.9	-39.9	178.1	-71.5	11.3	0	0	0	112	E36 R42 D43 D44	E36-N40 PolarHBondContact O-N 2.9Å; E36-N40 PolarHBondContact O-OD1 3.04Å; N40-R42 PolarHBondContact O-N 3.12Å; N40-D43 PolarHBondContact O-N 3.47Å; N40-D44 PolarHBondContact O-N 3.32Å
41	A	87.6	Confident	88.8	Confident	66 Å²	66	113.3 Å²	113.3	55%	0.545	60%	0.598	S	S	.	*	H	α-helix	trans	-66.1	-24.6	176.1	0	0	0	0	0	113.5	S37 A39	S37-A41 VanDerWaalsContact O-CB 3.31Å; S37-A41 WeakPolarHBondContact O-CB 3.42Å; S37-A41 PolarHBondContact O-N 3.2Å; A39-A41 VanDerWaalsContact C-N 3.3Å; A39-A41 PolarHBondContact O-N 3.19Å
42	R	85.6	Confident	88.2	Confident	186 Å²	186	114.1 Å²	114.1	70%	0.702	60%	0.603	S	S	*	*	H	α-helix	trans	-77.5	-39.1	172.5	-75.1	-178.7	-176.5	-150.1	1.3	111.7	V38 A39 N40 C45	V38-R42 WeakPolarHBondContact O-CG 3.2Å; V38-R42 PolarHBondContact O-N 3.42Å; A39-R42 WeakPolarHBondContact O-CA 3.39Å; A39-R42 WeakPolarHBondContact O-CB 3.49Å; A39-R42 PolarHBondContact O-N 3.42Å; N40-R42 PolarHBondContact O-N 3.12Å; R42-C45 PolarHBondContact O-N 3.22Å
43	D	84.1	Confident	87.7	Confident	117 Å²	117	111.6 Å²	111.6	63%	0.626	61%	0.605	S	S	*	*	H	α-helix	trans	-69.4	-36.3	-179.3	-65.5	-35.7	0	0	0	111.9	A39 N40 C45 C46	A39-D43 PolarHBondContact O-N 3.06Å; N40-D43 PolarHBondContact O-N 3.47Å; D43-C45 PolarHBondContact O-N 3.04Å; D43-C46 PolarHBondContact O-N 3.23Å
44	D	83.3	Confident	87.1	Confident	149 Å²	149	107.5 Å²	107.5	80%	0.797	60%	0.601	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.9	-14	175	-90.2	-34.8	0	0	0	114.1	N40	N40-D44 PolarHBondContact O-N 3.32Å
45	C	80.9	Confident	86.5	Confident	109 Å²	109	106.2 Å²	106.2	74%	0.736	61%	0.606	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.1	-1.5	-177	-165.4	0	0	0	0	113.8	R42 D43	R42-C45 PolarHBondContact O-N 3.22Å; D43-C45 PolarHBondContact O-N 3.04Å
46	C	68.9	Low	85.8	Confident	176 Å²	176	104.1 Å²	104.1	100%	1.189	60%	0.604	S	S	*	*			trans	-120	0	-178.9	-75.5	0	0	0	0	112.2	D43	D43-C46 PolarHBondContact O-N 3.23Å

Retrieved 46 of 46 residues in 16 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).