A0A913KVM0_SCHMA Loading...

Uncharacterized protein AlphaSync

AlphaFold DB , UniProt , Accession A0A913KVM0, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 74 aa.

						>A0A913KVM0_SCHMA|A0A913KVM0
MLWRLFSTESIYQHRLWSLLSCTNITNRSKLGHHWKPGCTGRSLRPIMRLFSRIHSTTRMRRSNLGPLASPVNA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.4	Low	48	Very low	233 Å²	233	140.5 Å²	140.5	100%	1.148	68%	0.678	S	S	*	*				0	27.7	0	-80.1	173.3	165.9	0	0	113.7
2	L	46.3	Very low	48.4	Very low	135 Å²	135	141.9 Å²	141.9	71%	0.707	67%	0.673	S	S	*	*			trans	-88.9	-14.8	-176.9	-77.8	157.6	0	0	0	114.6	R4 L5	L2-R4 VanDerWaalsContact C-N 3.26Å; L2-R4 PolarHBondContact O-N 3.33Å; L2-L5 HydrophobicContact CD2-CD1 4.47Å; L2-L5 PolarHBondContact O-N 3.24Å
3	W	40.2	Very low	48.7	Very low	226 Å²	226	140.4 Å²	140.4	86%	0.856	67%	0.665	S	S	*	*	H	α-helix	trans	-65.8	-23.9	-176.3	-74.8	76.5	0	0	0	114.3	S7	W3-S7 PolarHBondContact O-N 2.71Å; W3-S7 PolarHBondContact O-OG 3.46Å
4	R	41.1	Very low	49.3	Very low	220 Å²	220	140.6 Å²	140.6	83%	0.83	67%	0.665	S	S	*	*	H	α-helix	trans	-72.8	-31.8	178.2	-69.8	-162.9	-174.3	-124.4	4.4	112.9	L2 T8	L2-R4 VanDerWaalsContact C-N 3.26Å; L2-R4 PolarHBondContact O-N 3.33Å; R4-T8 PolarHBondContact O-N 3.12Å; R4-T8 PolarHBondContact O-OG1 3.28Å; R4-T8 VanDerWaalsContact O-OG1 3.12Å
5	L	43.2	Very low	49.9	Very low	115 Å²	115	144.3 Å²	144.3	60%	0.602	67%	0.67	S	S	*	*	H	α-helix	trans	-72.7	-38.3	179.3	-72.6	168.1	0	0	0	111.7	L2 S7 T8 E9	L2-L5 HydrophobicContact CD2-CD1 4.47Å; L2-L5 PolarHBondContact O-N 3.24Å; L5-S7 VanDerWaalsContact C-N 3.28Å; L5-S7 PolarHBondContact O-N 3.28Å; L5-T8 WeakPolarHBondContact CA-OG1 3.43Å; L5-T8 PolarHBondContact O-N 3.22Å; L5-T8 PolarHBondContact O-OG1 3.3Å; L5-E9 WeakPolarHBondContact O-CG 3.41Å; L5-E9 PolarHBondContact O-N 3.46Å; L5-E9 VanDerWaalsContact O-N 3.14Å
6	F	44.7	Very low	50.2	Low	173 Å²	173	141.6 Å²	141.6	76%	0.759	66%	0.661	S	S	*	*	H	α-helix	trans	-66.3	-31.2	177.4	-147.6	-95.7	0	0	0	112.4	S10	F6-S10 PolarHBondContact O-N 2.86Å
7	S	47.5	Very low	50.5	Low	76 Å²	76	144.2 Å²	144.2	53%	0.531	66%	0.664	S	S	.	*	H	α-helix	trans	-73	-36.4	175.4	-69.4	0	0	0	0	113	W3 L5 S10 I11	W3-S7 PolarHBondContact O-N 2.71Å; W3-S7 PolarHBondContact O-OG 3.46Å; L5-S7 VanDerWaalsContact C-N 3.28Å; L5-S7 PolarHBondContact O-N 3.28Å; S7-S10 PolarHBondContact O-N 3.11Å; S7-I11 WeakPolarHBondContact O-CG1 3.35Å; S7-I11 PolarHBondContact O-N 3.44Å
8	T	50.8	Low	51.1	Low	64 Å²	64	139.8 Å²	139.8	39%	0.393	65%	0.652	S	S	.	*	H	α-helix	trans	-68.6	-39.9	175.4	30.3	0	0	0	0	112.4	R4 L5 S10 I11 Y12	R4-T8 PolarHBondContact O-N 3.12Å; R4-T8 PolarHBondContact O-OG1 3.28Å; R4-T8 VanDerWaalsContact O-OG1 3.12Å; L5-T8 WeakPolarHBondContact CA-OG1 3.43Å; L5-T8 PolarHBondContact O-N 3.22Å; L5-T8 PolarHBondContact O-OG1 3.3Å; T8-S10 VanDerWaalsContact C-N 3.28Å; T8-S10 PolarHBondContact O-N 3.41Å; T8-I11 PolarHBondContact O-N 3.37Å; T8-Y12 WeakPolarHBondContact O-CD2 3.44Å; T8-Y12 PolarHBondContact O-N 3.42Å
9	E	51.6	Low	51.4	Low	124 Å²	124	137.6 Å²	137.6	58%	0.579	65%	0.645	S	S	*	*	H	α-helix	trans	-60.4	-38.3	175.5	-71.6	-98.5	91.8	0	0	111.7	L5 I11 Y12 Q13	L5-E9 WeakPolarHBondContact O-CG 3.41Å; L5-E9 PolarHBondContact O-N 3.46Å; L5-E9 VanDerWaalsContact O-N 3.14Å; E9-I11 PolarHBondContact O-N 3.39Å; E9-Y12 PolarHBondContact O-N 3.28Å; E9-Q13 VanDerWaalsContact O-CG 3.24Å; E9-Q13 WeakPolarHBondContact O-CG 2.97Å; E9-Q13 PolarHBondContact O-N 3.25Å
10	S	52.6	Low	51.7	Low	71 Å²	71	135.7 Å²	135.7	50%	0.497	64%	0.639	S	S	.	*	H	α-helix	trans	-63.2	-37.8	176.3	-174.7	0	0	0	0	113.1	F6 S7 T8 Y12 Q13 H14	F6-S10 PolarHBondContact O-N 2.86Å; S7-S10 PolarHBondContact O-N 3.11Å; T8-S10 VanDerWaalsContact C-N 3.28Å; T8-S10 PolarHBondContact O-N 3.41Å; S10-Y12 VanDerWaalsContact C-N 3.32Å; S10-Y12 PolarHBondContact O-N 3.27Å; S10-Q13 PolarHBondContact O-N 3.2Å; S10-H14 PolarHBondContact O-N 3.14Å
11	I	57.3	Low	52	Low	109 Å²	109	131.6 Å²	131.6	56%	0.559	63%	0.625	S	S	*	*	H	α-helix	trans	-66.7	-37.1	177.3	-63.6	166.6	0	0	0	110.7	S7 T8 E9 R15	S7-I11 WeakPolarHBondContact O-CG1 3.35Å; S7-I11 PolarHBondContact O-N 3.44Å; T8-I11 PolarHBondContact O-N 3.37Å; E9-I11 PolarHBondContact O-N 3.39Å; I11-R15 PolarHBondContact O-N 3.29Å
12	Y	52.8	Low	52	Low	157 Å²	157	123.5 Å²	123.5	62%	0.616	59%	0.59	S	S	*	*	H	α-helix	trans	-69.1	-40.8	174.2	-67.3	-67.3	0	0	0	111.8	T8 E9 S10 H14 R15 L16	T8-Y12 WeakPolarHBondContact O-CD2 3.44Å; T8-Y12 PolarHBondContact O-N 3.42Å; E9-Y12 PolarHBondContact O-N 3.28Å; S10-Y12 VanDerWaalsContact C-N 3.32Å; S10-Y12 PolarHBondContact O-N 3.27Å; Y12-H14 PolarHBondContact O-N 2.9Å; Y12-R15 PolarHBondContact O-N 2.97Å; Y12-L16 WeakPolarHBondContact O-CB 3.4Å; Y12-L16 PolarHBondContact O-N 3.47Å
13	Q	53	Low	52.4	Low	122 Å²	122	121.6 Å²	121.6	57%	0.57	59%	0.585	S	S	*	*	H	α-helix	trans	-62.4	-41.9	176.7	-70.6	-77.4	-29.2	0	0	112	E9 S10 R15 L16 W17	E9-Q13 VanDerWaalsContact O-CG 3.24Å; E9-Q13 WeakPolarHBondContact O-CG 2.97Å; E9-Q13 PolarHBondContact O-N 3.25Å; S10-Q13 PolarHBondContact O-N 3.2Å; Q13-R15 PolarHBondContact O-N 3.15Å; Q13-L16 PolarHBondContact O-N 3.44Å; Q13-W17 WeakPolarHBondContact O-CB 3.39Å; Q13-W17 PolarHBondContact O-N 3.38Å
14	H	57.1	Low	53.2	Low	144 Å²	144	117 Å²	117	67%	0.667	58%	0.577	S	S	*	*	H	α-helix	trans	-68.6	-36	-178.7	-146	-95.9	0	0	0	112.7	S10 Y12 S18	S10-H14 PolarHBondContact O-N 3.14Å; Y12-H14 PolarHBondContact O-N 2.9Å; H14-S18 PolarHBondContact O-N 2.82Å; H14-S18 PolarHBondContact O-OG 3.14Å
15	R	57.1	Low	53.8	Low	196 Å²	196	111.3 Å²	111.3	74%	0.74	56%	0.562	S	S	*	*	H	α-helix	trans	-72.7	-39	172.5	-97.9	-176.6	179.2	-123.7	0.9	112.4	I11 Y12 Q13 S18 L19	I11-R15 PolarHBondContact O-N 3.29Å; Y12-R15 PolarHBondContact O-N 2.97Å; Q13-R15 PolarHBondContact O-N 3.15Å; R15-S18 PolarHBondContact O-N 3.23Å; R15-L19 WeakPolarHBondContact O-CG 3.47Å; R15-L19 PolarHBondContact O-N 3.47Å; R15-L19 VanDerWaalsContact O-N 3.17Å
16	L	56	Low	54.1	Low	101 Å²	101	110 Å²	110	53%	0.529	56%	0.559	S	S	.	*	H	α-helix	trans	-64.8	-42.4	177.5	-123	93.3	0	0	0	111.4	Y12 Q13 S18 L19 L20	Y12-L16 WeakPolarHBondContact O-CB 3.4Å; Y12-L16 PolarHBondContact O-N 3.47Å; Q13-L16 PolarHBondContact O-N 3.44Å; L16-S18 VanDerWaalsContact C-N 3.3Å; L16-S18 PolarHBondContact O-N 3.1Å; L16-L19 PolarHBondContact O-N 3.27Å; L16-L20 WeakPolarHBondContact O-CB 3.2Å; L16-L20 PolarHBondContact O-N 3.38Å
17	W	55.2	Low	54.5	Low	185 Å²	185	109.5 Å²	109.5	70%	0.701	56%	0.564	S	S	*	*	H	α-helix	trans	-62.3	-39.1	179	-166.7	-82.5	0	0	0	112.2	Q13 L19 L20 S21	Q13-W17 WeakPolarHBondContact O-CB 3.39Å; Q13-W17 PolarHBondContact O-N 3.38Å; W17-L19 VanDerWaalsContact C-N 3.33Å; W17-L19 PolarHBondContact O-N 2.85Å; W17-L20 PolarHBondContact O-N 3.07Å; W17-S21 WeakPolarHBondContact O-CB 3.44Å; W17-S21 PolarHBondContact O-N 3.37Å; W17-S21 PolarHBondContact O-OG 2.84Å
18	S	60.1	Low	54.5	Low	66 Å²	66	114.6 Å²	114.6	46%	0.462	57%	0.572	S	S	.	*	H	α-helix	trans	-66.9	-35.3	177.5	-58.4	0	0	0	0	112.2	H14 R15 L16 C22	H14-S18 PolarHBondContact O-N 2.82Å; H14-S18 PolarHBondContact O-OG 3.14Å; R15-S18 PolarHBondContact O-N 3.23Å; L16-S18 VanDerWaalsContact C-N 3.3Å; L16-S18 PolarHBondContact O-N 3.1Å; S18-C22 PolarHBondContact O-SG 3.17Å
19	L	57.5	Low	54.5	Low	98 Å²	98	116 Å²	116	51%	0.513	58%	0.584	S	S	.	*	H	α-helix	trans	-75.3	-43.2	174.7	-68.6	169.4	0	0	0	111.6	R15 L16 W17 S21 C22 T23	R15-L19 WeakPolarHBondContact O-CG 3.47Å; R15-L19 PolarHBondContact O-N 3.47Å; R15-L19 VanDerWaalsContact O-N 3.17Å; L16-L19 PolarHBondContact O-N 3.27Å; W17-L19 VanDerWaalsContact C-N 3.33Å; W17-L19 PolarHBondContact O-N 2.85Å; L19-S21 VanDerWaalsContact C-N 3.25Å; L19-S21 PolarHBondContact O-N 3.4Å; L19-C22 WeakPolarHBondContact O-CA 3.43Å; L19-C22 WeakPolarHBondContact O-CB 3.44Å; L19-C22 PolarHBondContact O-N 2.96Å; L19-T23 PolarHBondContact O-N 3.33Å; L19-T23 PolarHBondContact O-OG1 3.44Å
20	L	58.3	Low	54.4	Low	98 Å²	98	120.2 Å²	120.2	51%	0.513	60%	0.6	S	S	.	*	H	α-helix	trans	-60.9	-35.6	174.7	-116.6	74.2	0	0	0	112	L16 W17 C22 T23 N24	L16-L20 WeakPolarHBondContact O-CB 3.2Å; L16-L20 PolarHBondContact O-N 3.38Å; W17-L20 PolarHBondContact O-N 3.07Å; L20-C22 PolarHBondContact O-N 3.01Å; L20-T23 PolarHBondContact O-N 3.44Å; L20-N24 WeakPolarHBondContact O-CB 3.42Å; L20-N24 PolarHBondContact O-N 2.79Å
21	S	56.9	Low	54.2	Low	50 Å²	50	123.2 Å²	123.2	35%	0.35	61%	0.61	S	S	.	*	H	α-helix	trans	-63.6	-28.7	174.6	-62.4	0	0	0	0	111.7	W17 L19 I25	W17-S21 WeakPolarHBondContact O-CB 3.44Å; W17-S21 PolarHBondContact O-N 3.37Å; W17-S21 PolarHBondContact O-OG 2.84Å; L19-S21 VanDerWaalsContact C-N 3.25Å; L19-S21 PolarHBondContact O-N 3.4Å; S21-I25 WeakPolarHBondContact O-CD1 3.32Å; S21-I25 WeakPolarHBondContact O-CG1 3.33Å
22	C	52.1	Low	53.5	Low	63 Å²	63	120.4 Å²	120.4	43%	0.426	61%	0.608	S	S	.	*	H	α-helix	trans	-81.8	-37.6	173.1	-64.9	0	0	0	0	112.1	S18 L19 L20 T26	S18-C22 PolarHBondContact O-SG 3.17Å; L19-C22 WeakPolarHBondContact O-CA 3.43Å; L19-C22 WeakPolarHBondContact O-CB 3.44Å; L19-C22 PolarHBondContact O-N 2.96Å; L20-C22 PolarHBondContact O-N 3.01Å; C22-T26 PolarHBondContact O-OG1 3.36Å
23	T	55.3	Low	53.3	Low	96 Å²	96	121.3 Å²	121.3	59%	0.589	62%	0.617	S	S	*	*	H	α-helix	trans	-79.7	-34.1	-175.9	-28.7	0	0	0	0	113.4	L19 L20 I25 T26	L19-T23 PolarHBondContact O-N 3.33Å; L19-T23 PolarHBondContact O-OG1 3.44Å; L20-T23 PolarHBondContact O-N 3.44Å; T23-I25 VanDerWaalsContact C-N 3.3Å; T23-T26 WeakPolarHBondContact CA-OG1 3.24Å; T23-T26 WeakPolarHBondContact O-CB 3.4Å; T23-T26 PolarHBondContact O-N 3.2Å; T23-T26 PolarHBondContact O-OG1 3.47Å
24	N	57.1	Low	53.2	Low	130 Å²	130	123 Å²	123	70%	0.695	63%	0.625	S	S	*	*	S	Bend	trans	-78.8	-15	179.3	-153.5	3.6	0	0	0	112.4	L20	L20-N24 WeakPolarHBondContact O-CB 3.42Å; L20-N24 PolarHBondContact O-N 2.79Å
25	I	52.7	Low	52.8	Low	99 Å²	99	126.6 Å²	126.6	51%	0.508	63%	0.633	S	S	.	*	S	Bend	trans	-83.3	-17.5	171.2	-64.5	176.4	0	0	0	111.6	S21 T23 N27 R28	S21-I25 WeakPolarHBondContact O-CD1 3.32Å; S21-I25 WeakPolarHBondContact O-CG1 3.33Å; T23-I25 VanDerWaalsContact C-N 3.3Å; I25-N27 PolarHBondContact O-N 3.45Å; I25-N27 VanDerWaalsContact O-N 3.15Å; I25-R28 PolarHBondContact O-N 3.31Å
26	T	51.3	Low	52.2	Low	89 Å²	89	125.5 Å²	125.5	55%	0.546	63%	0.634	S	S	.	*	G	3₁₀ helix	trans	-64	-20.6	179.1	-22.9	0	0	0	0	113.6	C22 T23 S29	C22-T26 PolarHBondContact O-OG1 3.36Å; T23-T26 WeakPolarHBondContact CA-OG1 3.24Å; T23-T26 WeakPolarHBondContact O-CB 3.4Å; T23-T26 PolarHBondContact O-N 3.2Å; T23-T26 PolarHBondContact O-OG1 3.47Å; T26-S29 PolarHBondContact O-OG 2.94Å
27	N	51.3	Low	52	Low	161 Å²	161	126.9 Å²	126.9	86%	0.861	65%	0.648	S	S	*	*	G	3₁₀ helix	trans	-90.4	2.4	175.1	-145.7	2.7	0	0	0	113.6	I25	I25-N27 PolarHBondContact O-N 3.45Å; I25-N27 VanDerWaalsContact O-N 3.15Å
28	R	49.1	Very low	52	Low	183 Å²	183	121.6 Å²	121.6	69%	0.691	65%	0.651	S	S	*	*	G	3₁₀ helix	trans	-100.3	7.6	169.9	-101.1	-177.5	-177.8	175.3	1.2	113.3	I25 K30 L31	I25-R28 PolarHBondContact O-N 3.31Å; R28-K30 PolarHBondContact O-N 3.5Å; R28-L31 HydrophobicContact CB-CD1 4.47Å; R28-L31 HydrophobicContact CG-CD1 4.36Å; R28-L31 PolarHBondContact O-N 3.29Å
29	S	49.8	Very low	51.3	Low	93 Å²	93	122.6 Å²	122.6	65%	0.65	66%	0.657	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64	13.9	-179.8	-50	0	0	0	0	115.5	T26 L31	T26-S29 PolarHBondContact O-OG 2.94Å; S29-L31 VanDerWaalsContact C-N 3.32Å
30	K	49.4	Very low	50.8	Low	213 Å²	213	122.5 Å²	122.5	93%	0.926	66%	0.661	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.4	-5.8	158.4	-95.6	-177	175.6	178.5	0	113.4	R28	R28-K30 PolarHBondContact O-N 3.5Å
31	L	48.2	Very low	50.6	Low	135 Å²	135	120.1 Å²	120.1	71%	0.707	66%	0.661	S	S	*	*	S	Bend	trans	-93.8	102.8	173.8	-70.3	161.9	0	0	0	108.7	R28 S29	R28-L31 HydrophobicContact CB-CD1 4.47Å; R28-L31 HydrophobicContact CG-CD1 4.36Å; R28-L31 PolarHBondContact O-N 3.29Å; S29-L31 VanDerWaalsContact C-N 3.32Å
32	G	43.6	Very low	50.2	Low	50 Å²	50	128.3 Å²	128.3	52%	0.515	68%	0.684	S	S	.	*			trans	-52.3	146.5	-169	0	0	0	0	0	116	H34	G32-H34 PolarHBondContact O-N 2.94Å
33	H	48.1	Very low	50.1	Low	175 Å²	175	129.4 Å²	129.4	81%	0.81	69%	0.692	S	S	*	*	S	Bend	trans	31.9	19.6	143.8	-55.7	-38.1	0	0	0	122.2	W35	H33-W35 PolarHBondContact O-NE1 2.91Å
34	H	50.1	Low	49.9	Very low	159 Å²	159	129.4 Å²	129.4	74%	0.736	69%	0.688	S	S	*	*			trans	-134.3	67.9	-177.5	-69.6	-69.4	0	0	0	113.4	G32	G32-H34 PolarHBondContact O-N 2.94Å
35	W	49.7	Very low	49.8	Very low	218 Å²	218	132.4 Å²	132.4	83%	0.826	69%	0.69	S	S	*	*				62.8	99.4	126.3	-42.2	3.1	0	0	0	116.7	H33	H33-W35 PolarHBondContact O-NE1 2.91Å
36	K	44.5	Very low	50	Low	174 Å²	174	131.4 Å²	131.4	76%	0.757	69%	0.689	S	S	*	*			trans	-106.5	115.3	139.6	-86.9	-154.1	175.8	-170.6	0	108.3	G38 C39	K36-G38 PolarHBondContact O-N 3.26Å; K36-C39 PolarHBondContact O-N 3.17Å
37	P	52.6	Low	50.3	Low	129 Å²	129	130.5 Å²	130.5	84%	0.838	68%	0.681	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71	18.3	-169.9	28.4	-34.2	0	0	0	115.3
38	G	53.5	Low	50.7	Low	74 Å²	74	128.1 Å²	128.1	76%	0.763	67%	0.666	S	S	*	*	T	Hydrogen-bonded Turn	trans	-116.6	-14	177.8	0	0	0	0	0	114.4	K36 T40	K36-G38 PolarHBondContact O-N 3.26Å; G38-T40 VanDerWaalsContact C-N 3.34Å; G38-T40 PolarHBondContact O-N 3.45Å
39	C	45.5	Very low	51.3	Low	87 Å²	87	129 Å²	129	59%	0.588	67%	0.669	S	S	*	*			trans	-100	44.4	177	-71.6	0	0	0	0	110.8	K36 G41	K36-C39 PolarHBondContact O-N 3.17Å; C39-G41 PolarHBondContact O-N 3.45Å
40	T	48.5	Very low	51.7	Low	96 Å²	96	129.8 Å²	129.8	59%	0.589	67%	0.666	S	S	*	*			trans	-74.5	114.7	176.2	-40.6	0	0	0	0	107.3	G38 R42	G38-T40 VanDerWaalsContact C-N 3.34Å; G38-T40 PolarHBondContact O-N 3.45Å; T40-R42 PolarHBondContact O-N 2.99Å
41	G	53.9	Low	52.2	Low	49 Å²	49	126.5 Å²	126.5	51%	0.505	65%	0.652	S	S	.	*	T	Hydrogen-bonded Turn	trans	-59.7	32.4	-172.7	0	0	0	0	0	117.6	C39	C39-G41 PolarHBondContact O-N 3.45Å
42	R	48.8	Very low	52.7	Low	221 Å²	221	124.2 Å²	124.2	83%	0.834	65%	0.646	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.8	-23.8	170.3	-66	-174.4	-174.6	-158.4	2	113	T40	T40-R42 PolarHBondContact O-N 2.99Å
43	S	49.8	Very low	53.4	Low	86 Å²	86	131 Å²	131	60%	0.601	66%	0.657	S	S	*	*	S	Bend	trans	-86.6	-9	174.5	-82.2	0	0	0	0	115.1	P46 I47	S43-P46 WeakPolarHBondContact O-CD 3.39Å; S43-P46 WeakPolarHBondContact O-CG 3.49Å; S43-I47 VanDerWaalsContact O-CD1 3.32Å; S43-I47 WeakPolarHBondContact O-CD1 3.32Å; S43-I47 WeakPolarHBondContact O-CG1 3.34Å
44	L	49.6	Very low	53.9	Low	97 Å²	97	126.7 Å²	126.7	51%	0.508	64%	0.639	S	S	.	*	H	α-helix	trans	-75.4	-26.1	-179.4	-93.4	159.6	0	0	0	113.8	I47 M48	L44-I47 PolarHBondContact O-N 3.31Å; L44-M48 HydrophobicContact CB-CE 4.02Å; L44-M48 WeakPolarHBondContact O-CB 3.35Å; L44-M48 WeakPolarHBondContact O-CG 3.44Å; L44-M48 PolarHBondContact O-N 3.42Å
45	R	56.4	Low	54.2	Low	193 Å²	193	125.6 Å²	125.6	73%	0.728	63%	0.634	S	S	*	*	H	α-helix	trans	-63.5	-47.5	-179.8	-68.9	-173.9	-175.5	-116.5	2.1	113.5	R49	R45-R49 PolarHBondContact O-N 3.41Å
46	P	56.6	Low	54.3	Low	77 Å²	77	118.2 Å²	118.2	50%	0.5	62%	0.616	S	S	.	*	H	α-helix	trans	-70.8	-33.3	176.3	24.5	-32.4	0	0	0	112.6	S43 R49 L50	S43-P46 WeakPolarHBondContact O-CD 3.39Å; S43-P46 WeakPolarHBondContact O-CG 3.49Å; P46-R49 PolarHBondContact O-N 3.36Å; P46-L50 PolarHBondContact O-N 3.41Å
47	I	57.9	Low	54.7	Low	71 Å²	71	113.9 Å²	113.9	36%	0.364	60%	0.603	S	S	.	*	H	α-helix	trans	-69.2	-43	-178.6	-64	171	0	0	0	111.5	S43 L44 R49 L50 F51	S43-I47 VanDerWaalsContact O-CD1 3.32Å; S43-I47 WeakPolarHBondContact O-CD1 3.32Å; S43-I47 WeakPolarHBondContact O-CG1 3.34Å; L44-I47 PolarHBondContact O-N 3.31Å; I47-R49 VanDerWaalsContact C-N 3.31Å; I47-R49 PolarHBondContact O-N 2.87Å; I47-L50 WeakPolarHBondContact O-CB 3.26Å; I47-L50 PolarHBondContact O-N 3.43Å; I47-L50 VanDerWaalsContact O-N 3.15Å; I47-F51 HydrophobicContact CG2-CD2 3.89Å; I47-F51 HydrophobicContact CG2-CE2 4.09Å; I47-F51 PolarHBondContact O-N 3.48Å
48	M	59.8	Low	54.6	Low	111 Å²	111	111.7 Å²	111.7	55%	0.547	59%	0.588	S	S	.	*	H	α-helix	trans	-61.4	-39.8	174.8	-76.7	-169.8	-93.2	0	0	111.9	L44 L50 F51 S52	L44-M48 HydrophobicContact CB-CE 4.02Å; L44-M48 WeakPolarHBondContact O-CB 3.35Å; L44-M48 WeakPolarHBondContact O-CG 3.44Å; L44-M48 PolarHBondContact O-N 3.42Å; M48-L50 VanDerWaalsContact C-N 3.33Å; M48-L50 PolarHBondContact O-N 2.9Å; M48-F51 PolarHBondContact O-N 3.44Å; M48-S52 PolarHBondContact O-N 2.98Å; M48-S52 PolarHBondContact O-OG 3.35Å
49	R	60.9	Low	54.2	Low	201 Å²	201	117 Å²	117	76%	0.758	59%	0.585	S	S	*	*	H	α-helix	trans	-64.3	-37.9	174.5	-73.6	-175.5	-179	-178.6	0.6	112.2	R45 P46 I47 R53	R45-R49 PolarHBondContact O-N 3.41Å; P46-R49 PolarHBondContact O-N 3.36Å; I47-R49 VanDerWaalsContact C-N 3.31Å; I47-R49 PolarHBondContact O-N 2.87Å; R49-R53 VanDerWaalsContact O-CB 3.32Å; R49-R53 WeakPolarHBondContact O-CB 3.4Å; R49-R53 PolarHBondContact O-N 3.36Å; R49-R53 VanDerWaalsContact O-N 3.1Å
50	L	59.1	Low	54.1	Low	110 Å²	110	119.6 Å²	119.6	58%	0.576	59%	0.59	S	S	*	*	H	α-helix	trans	-64.7	-44.4	174.9	-133.4	84.2	0	0	0	110.9	P46 I47 M48 R53 I54	P46-L50 PolarHBondContact O-N 3.41Å; I47-L50 WeakPolarHBondContact O-CB 3.26Å; I47-L50 PolarHBondContact O-N 3.43Å; I47-L50 VanDerWaalsContact O-N 3.15Å; M48-L50 VanDerWaalsContact C-N 3.33Å; M48-L50 PolarHBondContact O-N 2.9Å; L50-R53 PolarHBondContact O-N 3.31Å; L50-I54 HydrophobicContact CD2-CD1 4.17Å; L50-I54 HydrophobicContact CG-CD1 4.24Å; L50-I54 WeakPolarHBondContact O-CB 3.42Å; L50-I54 WeakPolarHBondContact O-CD1 3.48Å; L50-I54 WeakPolarHBondContact O-CG1 3.45Å; L50-I54 PolarHBondContact O-N 3.47Å
51	F	59.4	Low	54	Low	144 Å²	144	124.4 Å²	124.4	63%	0.632	60%	0.597	S	S	*	*	H	α-helix	trans	-63.2	-42.8	178.1	-98.3	-87.5	0	0	0	112.8	I47 M48 R53 I54 H55	I47-F51 HydrophobicContact CG2-CD2 3.89Å; I47-F51 HydrophobicContact CG2-CE2 4.09Å; I47-F51 PolarHBondContact O-N 3.48Å; M48-F51 PolarHBondContact O-N 3.44Å; F51-R53 VanDerWaalsContact C-N 3.3Å; F51-R53 PolarHBondContact O-N 2.84Å; F51-I54 PolarHBondContact O-N 3.49Å; F51-H55 VanDerWaalsContact O-CB 3.26Å; F51-H55 WeakPolarHBondContact O-CB 3.33Å; F51-H55 PolarHBondContact O-N 3.2Å
52	S	58.8	Low	53.5	Low	86 Å²	86	132.5 Å²	132.5	60%	0.601	61%	0.613	S	S	*	*	H	α-helix	trans	-63.4	-38.1	174.8	-63	0	0	0	0	112.3	M48 S56	M48-S52 PolarHBondContact O-N 2.98Å; M48-S52 PolarHBondContact O-OG 3.35Å; S52-S56 PolarHBondContact O-N 2.87Å; S52-S56 VanDerWaalsContact O-N 3.14Å; S52-S56 PolarHBondContact O-OG 2.8Å
53	R	58.8	Low	53.6	Low	193 Å²	193	126.7 Å²	126.7	73%	0.728	61%	0.606	S	S	*	*	H	α-helix	trans	-73.3	-35	179.9	-157.1	178.4	-88.7	-142.1	-3.8	111.8	R49 L50 F51 S56 T57	R49-R53 VanDerWaalsContact O-CB 3.32Å; R49-R53 WeakPolarHBondContact O-CB 3.4Å; R49-R53 PolarHBondContact O-N 3.36Å; R49-R53 VanDerWaalsContact O-N 3.1Å; L50-R53 PolarHBondContact O-N 3.31Å; F51-R53 VanDerWaalsContact C-N 3.3Å; F51-R53 PolarHBondContact O-N 2.84Å; R53-S56 PolarHBondContact O-OG 2.98Å; R53-T57 WeakPolarHBondContact O-CG2 3.08Å; R53-T57 PolarHBondContact O-N 2.98Å; R53-T57 PolarHBondContact O-OG1 3.32Å
54	I	58.2	Low	53.5	Low	85 Å²	85	129.4 Å²	129.4	44%	0.436	61%	0.614	S	S	.	*	H	α-helix	trans	-70.8	-46.6	174	-67	163.8	0	0	0	109.4	L50 F51 S56 T57 T58	L50-I54 HydrophobicContact CD2-CD1 4.17Å; L50-I54 HydrophobicContact CG-CD1 4.24Å; L50-I54 WeakPolarHBondContact O-CB 3.42Å; L50-I54 WeakPolarHBondContact O-CD1 3.48Å; L50-I54 WeakPolarHBondContact O-CG1 3.45Å; L50-I54 PolarHBondContact O-N 3.47Å; F51-I54 PolarHBondContact O-N 3.49Å; I54-S56 VanDerWaalsContact C-N 3.3Å; I54-S56 PolarHBondContact O-N 2.66Å; I54-T57 WeakPolarHBondContact CA-OG1 3.16Å; I54-T57 CarbonylContact O-C 3.58Å; I54-T57 PolarHBondContact O-N 2.84Å; I54-T57 PolarHBondContact O-OG1 3.33Å; I54-T58 PolarHBondContact O-N 2.8Å; I54-T58 PolarHBondContact O-OG1 3.23Å
55	H	55.5	Low	53.2	Low	135 Å²	135	130.7 Å²	130.7	63%	0.625	62%	0.62	S	S	*	*	H	α-helix	trans	-62.6	-32.9	-178.6	-165.7	-109	0	0	0	113.3	F51 R59	F51-H55 VanDerWaalsContact O-CB 3.26Å; F51-H55 WeakPolarHBondContact O-CB 3.33Å; F51-H55 PolarHBondContact O-N 3.2Å; H55-R59 WeakPolarHBondContact O-CB 3.01Å; H55-R59 PolarHBondContact O-N 3.24Å
56	S	51.2	Low	52.6	Low	64 Å²	64	124.4 Å²	124.4	45%	0.448	62%	0.616	S	S	.	*	H	α-helix	trans	-69.4	-38.6	171.7	63.5	0	0	0	0	112.6	S52 R53 I54 R59 M60	S52-S56 PolarHBondContact O-N 2.87Å; S52-S56 VanDerWaalsContact O-N 3.14Å; S52-S56 PolarHBondContact O-OG 2.8Å; R53-S56 PolarHBondContact O-OG 2.98Å; I54-S56 VanDerWaalsContact C-N 3.3Å; I54-S56 PolarHBondContact O-N 2.66Å; S56-R59 PolarHBondContact O-N 2.72Å; S56-M60 WeakPolarHBondContact O-CG 3.42Å; S56-M60 PolarHBondContact O-N 3.23Å
57	T	52.7	Low	51.9	Low	82 Å²	82	126.9 Å²	126.9	50%	0.503	63%	0.632	S	S	.	*	H	α-helix	trans	-70.9	-31.8	175.5	58.5	0	0	0	0	113.2	R53 I54 R61	R53-T57 WeakPolarHBondContact O-CG2 3.08Å; R53-T57 PolarHBondContact O-N 2.98Å; R53-T57 PolarHBondContact O-OG1 3.32Å; I54-T57 WeakPolarHBondContact CA-OG1 3.16Å; I54-T57 CarbonylContact O-C 3.58Å; I54-T57 PolarHBondContact O-N 2.84Å; I54-T57 PolarHBondContact O-OG1 3.33Å; T57-R61 PolarHBondContact O-N 2.75Å; T57-R61 VanDerWaalsContact O-N 3.11Å
58	T	50.7	Low	51.3	Low	83 Å²	83	131.3 Å²	131.3	51%	0.509	66%	0.656	S	S	.	*	H	α-helix	trans	-74.6	-31	175.5	-33.2	0	0	0	0	111.7	I54 R62	I54-T58 PolarHBondContact O-N 2.8Å; I54-T58 PolarHBondContact O-OG1 3.23Å; T58-R62 PolarHBondContact O-N 2.96Å
59	R	45.3	Very low	50.7	Low	187 Å²	187	130.2 Å²	130.2	71%	0.706	66%	0.664	S	S	*	*	H	α-helix	trans	-69.7	-35.6	174.1	-155.3	177.5	-138.4	-169.6	4.1	112.2	H55 S56 S63	H55-R59 WeakPolarHBondContact O-CB 3.01Å; H55-R59 PolarHBondContact O-N 3.24Å; S56-R59 PolarHBondContact O-N 2.72Å; R59-S63 PolarHBondContact O-OG 3.15Å
60	M	43.2	Very low	50.1	Low	141 Å²	141	126 Å²	126	70%	0.695	67%	0.666	S	S	*	*	H	α-helix	trans	-76.4	-31	177	-68.2	-101.3	-87	0	0	113.3	S56 N64	S56-M60 WeakPolarHBondContact O-CG 3.42Å; S56-M60 PolarHBondContact O-N 3.23Å; M60-N64 PolarHBondContact O-ND2 2.77Å
61	R	47.6	Very low	49.5	Very low	196 Å²	196	126.5 Å²	126.5	74%	0.74	68%	0.675	S	S	*	*	H	α-helix	trans	-75.6	-29.3	174.4	-95.3	-171.7	175.1	-178.5	-0.7	113.6	T57 S63 N64	T57-R61 PolarHBondContact O-N 2.75Å; T57-R61 VanDerWaalsContact O-N 3.11Å; R61-S63 VanDerWaalsContact C-N 3.27Å; R61-S63 PolarHBondContact O-N 3.3Å; R61-N64 PolarHBondContact O-N 2.82Å
62	R	43	Very low	49.4	Very low	220 Å²	220	125.9 Å²	125.9	83%	0.83	68%	0.683	S	S	*	*	H	α-helix	trans	-72.2	-21.3	177.8	-150.3	175.9	-150.4	179.8	5.7	113.3	T58	T58-R62 PolarHBondContact O-N 2.96Å
63	S	50	Low	48.8	Very low	98 Å²	98	129.2 Å²	129.2	69%	0.685	69%	0.694	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89	-10.8	177.9	-57.7	0	0	0	0	114.2	R59 R61	R59-S63 PolarHBondContact O-OG 3.15Å; R61-S63 VanDerWaalsContact C-N 3.27Å; R61-S63 PolarHBondContact O-N 3.3Å
64	N	49	Very low	47.8	Very low	143 Å²	143	128.2 Å²	128.2	77%	0.765	73%	0.727	S	S	*	*	S	Bend	trans	-112.5	11.1	179.1	-75.1	-60.6	0	0	0	113.3	M60 R61	M60-N64 PolarHBondContact O-ND2 2.77Å; R61-N64 PolarHBondContact O-N 2.82Å
65	L	44	Very low	47.3	Very low	124 Å²	124	130.4 Å²	130.4	65%	0.649	74%	0.741	S	S	*	*			trans	-130.4	77	176.3	-86.1	149.5	0	0	0	109.2
66	G	43.9	Very low	46.9	Very low	62 Å²	62	130.1 Å²	130.1	64%	0.639	75%	0.747	S	S	*	*			trans	-91.1	169.9	148.6	0	0	0	0	0	109.5
67	P	40.4	Very low	46.7	Very low	128 Å²	128	133.8 Å²	133.8	83%	0.831	76%	0.764	S	S	*	*				-111.8	108.9	-50.1	32	-16	0	0	0	108.6
68	L	46.4	Very low	46.3	Very low	165 Å²	165	136.8 Å²	136.8	86%	0.864	78%	0.779	S	S	*	*			trans	-99.4	100.5	173.1	-100.2	83	0	0	0	110.1	S70	L68-S70 PolarHBondContact O-N 2.68Å
69	A	46.9	Very low	46	Very low	88 Å²	88	140.2 Å²	140.2	73%	0.727	80%	0.796	S	S	*	*			trans	-2	112.4	152.4	0	0	0	0	0	115	P71	A69-P71 WeakPolarHBondContact O-CD 3.41Å
70	S	47.4	Very low	46.1	Very low	113 Å²	113	137.1 Å²	137.1	79%	0.79	80%	0.802	S	S	*	*			trans	-54.9	122.4	148.7	-79.6	0	0	0	0	108	L68 V72	L68-S70 PolarHBondContact O-N 2.68Å; S70-V72 PolarHBondContact O-N 2.79Å
71	P	46.9	Very low	46.3	Very low	119 Å²	119	136.8 Å²	136.8	77%	0.773	81%	0.81	S	S	*	*			trans	-67.4	124.7	159.7	28	-27.7	0	0	0	107.5	A69 N73	A69-P71 WeakPolarHBondContact O-CD 3.41Å; P71-N73 PolarHBondContact O-N 2.94Å
72	V	58.4	Low	46.2	Very low	131 Å²	131	132.2 Å²	132.2	79%	0.794	82%	0.815	S	S	*	*			trans	-42.9	118.5	169.9	166.7	0	0	0	0	109.8	S70	S70-V72 PolarHBondContact O-N 2.79Å
73	N	45.8	Very low	46.5	Very low	157 Å²	157	124.9 Å²	124.9	84%	0.84	81%	0.814	S	S	*	*			trans	-61.2	129.4	154	-73.9	-27.6	0	0	0	106.9	P71	P71-N73 PolarHBondContact O-N 2.94Å
74	A	38.5	Very low	46.1	Very low	171 Å²	171	127.4 Å²	127.4	100%	1.413	83%	0.826	S	S	*	*			trans	13.7	0	158.6	0	0	0	0	0	118.4

Retrieved 74 of 74 residues in 91.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).