A0A913KVN3_SCHMA Loading...

Uncharacterized protein AlphaSync

AlphaFold DB , UniProt , Accession A0A913KVN3, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 63 aa.

						>A0A913KVN3_SCHMA|A0A913KVN3
MHHSVLFEVILISFLFHKSIQTDINSEYLLKAKRELIIRENDLLKYQIEDIIYYDELISNYVL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	63.2	Low	82	Confident	219 Å²	219	118.7 Å²	118.7	100%	1.079	60%	0.604	S	S	*	*				0	-44.2	0	-80.7	-177.9	153.2	0	0	113.4	H3 S4	M1-H3 VanDerWaalsContact C-N 3.35Å; M1-H3 PolarHBondContact O-N 3.34Å; M1-S4 WeakPolarHBondContact O-CB 3.3Å; M1-S4 PolarHBondContact O-N 3.09Å; M1-S4 VanDerWaalsContact O-N 3.17Å
2	H	64	Low	82.9	Confident	162 Å²	162	116.4 Å²	116.4	75%	0.75	59%	0.593	S	S	*	*	H	α-helix	trans	-57.8	-34.7	-179.5	-72.7	-55.4	0	0	0	116.2	S4 V5 L6	H2-S4 VanDerWaalsContact C-N 3.28Å; H2-S4 PolarHBondContact O-N 3.22Å; H2-V5 PolarHBondContact O-N 3.46Å; H2-L6 PolarHBondContact O-N 3.25Å
3	H	68.5	Low	83.6	Confident	166 Å²	166	112.7 Å²	112.7	77%	0.769	58%	0.584	S	S	*	*	H	α-helix	trans	-64.1	-28.9	177.9	-72.4	-65	0	0	0	114	M1 F7	M1-H3 VanDerWaalsContact C-N 3.35Å; M1-H3 PolarHBondContact O-N 3.34Å; H3-F7 WeakPolarHBondContact O-CB 3.37Å; H3-F7 PolarHBondContact O-N 3.38Å
4	S	81.8	Confident	84.1	Confident	71 Å²	71	112.6 Å²	112.6	50%	0.497	58%	0.577	S	S	.	*	H	α-helix	trans	-66.1	-45.5	175.7	-166.3	0	0	0	0	110.9	M1 H2 F7 E8	M1-S4 WeakPolarHBondContact O-CB 3.3Å; M1-S4 PolarHBondContact O-N 3.09Å; M1-S4 VanDerWaalsContact O-N 3.17Å; H2-S4 VanDerWaalsContact C-N 3.28Å; H2-S4 PolarHBondContact O-N 3.22Å; S4-F7 PolarHBondContact O-N 2.96Å; S4-E8 WeakPolarHBondContact O-CG 3.36Å; S4-E8 PolarHBondContact O-N 2.9Å
5	V	86.3	Confident	84.5	Confident	80 Å²	80	111.9 Å²	111.9	49%	0.485	57%	0.574	S	S	.	*	H	α-helix	trans	-66.2	-41.4	179.1	-175.9	0	0	0	0	110.9	H2 F7 E8 V9	H2-V5 PolarHBondContact O-N 3.46Å; V5-F7 VanDerWaalsContact C-N 3.31Å; V5-F7 PolarHBondContact O-N 3.03Å; V5-E8 PolarHBondContact O-N 3.39Å; V5-V9 WeakPolarHBondContact O-CG2 3.37Å; V5-V9 PolarHBondContact O-N 3.49Å
6	L	85.3	Confident	85	Confident	101 Å²	101	113.4 Å²	113.4	53%	0.529	58%	0.575	S	S	.	*	H	α-helix	trans	-60.1	-41.7	175	-111	150.8	0	0	0	111.8	H2 V9 I10	H2-L6 PolarHBondContact O-N 3.25Å; L6-V9 PolarHBondContact O-N 3.24Å; L6-I10 VanDerWaalsContact O-CG1 3.3Å; L6-I10 WeakPolarHBondContact O-CG1 3.2Å; L6-I10 PolarHBondContact O-N 2.96Å; L6-I10 VanDerWaalsContact O-N 3.12Å
7	F	88.6	Confident	85.3	Confident	138 Å²	138	113.1 Å²	113.1	61%	0.605	57%	0.571	S	S	*	*	H	α-helix	trans	-64.3	-44.2	175.4	179.8	-100.3	0	0	0	112.1	H3 S4 V5 V9 I10 L11	H3-F7 WeakPolarHBondContact O-CB 3.37Å; H3-F7 PolarHBondContact O-N 3.38Å; S4-F7 PolarHBondContact O-N 2.96Å; V5-F7 VanDerWaalsContact C-N 3.31Å; V5-F7 PolarHBondContact O-N 3.03Å; F7-V9 VanDerWaalsContact C-N 3.35Å; F7-V9 PolarHBondContact O-N 3.33Å; F7-I10 PolarHBondContact O-N 3.21Å; F7-L11 HydrophobicContact CE1-CD2 4.42Å; F7-L11 WeakPolarHBondContact O-CB 3.21Å; F7-L11 PolarHBondContact O-N 3.22Å
8	E	89.6	Confident	85.6	Confident	100 Å²	100	112.9 Å²	112.9	47%	0.467	57%	0.566	S	S	.	*	H	α-helix	trans	-59.4	-43	176.2	-74.9	168.1	-159.1	0	0	112.2	S4 V5 I10 L11 I12	S4-E8 WeakPolarHBondContact O-CG 3.36Å; S4-E8 PolarHBondContact O-N 2.9Å; V5-E8 PolarHBondContact O-N 3.39Å; E8-I10 PolarHBondContact O-N 3.05Å; E8-L11 PolarHBondContact O-N 3.03Å; E8-I12 WeakPolarHBondContact O-CB 3.49Å; E8-I12 WeakPolarHBondContact O-CD1 3.4Å; E8-I12 VanDerWaalsContact O-CG1 3.25Å; E8-I12 WeakPolarHBondContact O-CG1 3.26Å; E8-I12 PolarHBondContact O-N 2.95Å
9	V	92	Very high	85.8	Confident	83 Å²	83	110.1 Å²	110.1	50%	0.503	56%	0.558	S	S	.	*	H	α-helix	trans	-64.1	-42.3	177.7	172.7	0	0	0	0	111.6	V5 L6 F7 S13	V5-V9 WeakPolarHBondContact O-CG2 3.37Å; V5-V9 PolarHBondContact O-N 3.49Å; L6-V9 PolarHBondContact O-N 3.24Å; F7-V9 VanDerWaalsContact C-N 3.35Å; F7-V9 PolarHBondContact O-N 3.33Å; V9-S13 WeakPolarHBondContact O-CB 3.42Å; V9-S13 PolarHBondContact O-N 3.47Å; V9-S13 PolarHBondContact O-OG 3.43Å
10	I	91.7	Very high	86.1	Confident	107 Å²	107	109.2 Å²	109.2	55%	0.549	55%	0.554	S	S	.	*	H	α-helix	trans	-63.8	-44	176.4	-68.4	166.5	0	0	0	110.3	L6 F7 E8 S13 F14	L6-I10 VanDerWaalsContact O-CG1 3.3Å; L6-I10 WeakPolarHBondContact O-CG1 3.2Å; L6-I10 PolarHBondContact O-N 2.96Å; L6-I10 VanDerWaalsContact O-N 3.12Å; F7-I10 PolarHBondContact O-N 3.21Å; E8-I10 PolarHBondContact O-N 3.05Å; I10-S13 PolarHBondContact O-N 3.49Å; I10-F14 WeakPolarHBondContact O-CB 3.34Å; I10-F14 PolarHBondContact O-N 2.96Å
11	L	91	Very high	86.2	Confident	79 Å²	79	108.3 Å²	108.3	41%	0.414	55%	0.547	S	S	.	.	H	α-helix	trans	-62.6	-46.9	179.3	-176.7	64.8	0	0	0	111.6	F7 E8 S13 F14 L15	F7-L11 HydrophobicContact CE1-CD2 4.42Å; F7-L11 WeakPolarHBondContact O-CB 3.21Å; F7-L11 PolarHBondContact O-N 3.22Å; E8-L11 PolarHBondContact O-N 3.03Å; L11-S13 VanDerWaalsContact C-N 3.33Å; L11-S13 PolarHBondContact O-N 2.96Å; L11-F14 PolarHBondContact O-N 3.25Å; L11-L15 HydrophobicContact CG-CD1 4.34Å; L11-L15 WeakPolarHBondContact O-CG 3.44Å; L11-L15 PolarHBondContact O-N 3.39Å
12	I	92.5	Very high	87.4	Confident	91 Å²	91	102 Å²	102	47%	0.467	52%	0.522	S	S	.	.	H	α-helix	trans	-60.2	-45.8	177	-70.7	164.4	0	0	0	110.3	E8 F14 L15 F16	E8-I12 WeakPolarHBondContact O-CB 3.49Å; E8-I12 WeakPolarHBondContact O-CD1 3.4Å; E8-I12 VanDerWaalsContact O-CG1 3.25Å; E8-I12 WeakPolarHBondContact O-CG1 3.26Å; E8-I12 PolarHBondContact O-N 2.95Å; I12-F14 VanDerWaalsContact C-N 3.31Å; I12-F14 PolarHBondContact O-N 3.44Å; I12-L15 PolarHBondContact O-N 2.98Å; I12-F16 HydrophobicContact CG2-CD2 3.64Å; I12-F16 HydrophobicContact CG2-CE2 3.59Å; I12-F16 VanDerWaalsContact O-CD2 3.31Å; I12-F16 WeakPolarHBondContact O-CD2 3.05Å; I12-F16 PolarHBondContact O-N 2.99Å
13	S	91.9	Very high	88.6	Confident	68 Å²	68	98.8 Å²	98.8	48%	0.476	51%	0.51	S	S	.	.	H	α-helix	trans	-60	-41.5	177.9	-58.1	0	0	0	0	112	V9 I10 L11 H17	V9-S13 WeakPolarHBondContact O-CB 3.42Å; V9-S13 PolarHBondContact O-N 3.47Å; V9-S13 PolarHBondContact O-OG 3.43Å; I10-S13 PolarHBondContact O-N 3.49Å; L11-S13 VanDerWaalsContact C-N 3.33Å; L11-S13 PolarHBondContact O-N 2.96Å; S13-H17 PolarHBondContact O-N 3.37Å; S13-H17 VanDerWaalsContact O-N 3.08Å
14	F	91	Very high	89.5	Confident	111 Å²	111	94.4 Å²	94.4	49%	0.487	49%	0.491	S	S	.	.	H	α-helix	trans	-65.1	-42.7	176.3	179.2	-98.7	0	0	0	112.5	I10 L11 I12 H17 K18	I10-F14 WeakPolarHBondContact O-CB 3.34Å; I10-F14 PolarHBondContact O-N 2.96Å; L11-F14 PolarHBondContact O-N 3.25Å; I12-F14 VanDerWaalsContact C-N 3.31Å; I12-F14 PolarHBondContact O-N 3.44Å; F14-H17 PolarHBondContact O-N 3.45Å; F14-K18 HydrophobicContact CD1-CG 4.28Å; F14-K18 HydrophobicContact CE1-CG 3.86Å; F14-K18 HydrophobicContact CE2-CG 4.42Å; F14-K18 HydrophobicContact CZ-CD 4.31Å; F14-K18 HydrophobicContact CZ-CG 3.95Å; F14-K18 WeakPolarHBondContact O-CG 3.44Å; F14-K18 PolarHBondContact O-N 2.96Å
15	L	90.7	Very high	89.9	Confident	103 Å²	103	95.6 Å²	95.6	54%	0.539	49%	0.492	S	S	.	.	H	α-helix	trans	-64.6	-41.9	177.8	-69.9	173.6	0	0	0	111.8	L11 I12 H17 K18 S19	L11-L15 HydrophobicContact CG-CD1 4.34Å; L11-L15 WeakPolarHBondContact O-CG 3.44Å; L11-L15 PolarHBondContact O-N 3.39Å; I12-L15 PolarHBondContact O-N 2.98Å; L15-H17 PolarHBondContact O-N 3.4Å; L15-K18 PolarHBondContact O-N 3.35Å; L15-S19 PolarHBondContact O-N 2.93Å
16	F	91.9	Very high	90.1	Very high	135 Å²	135	94.9 Å²	94.9	59%	0.592	49%	0.491	S	S	*	.	H	α-helix	trans	-60.7	-44.7	174	-88.6	-68.8	0	0	0	112	I12 K18 S19 I20	I12-F16 HydrophobicContact CG2-CD2 3.64Å; I12-F16 HydrophobicContact CG2-CE2 3.59Å; I12-F16 VanDerWaalsContact O-CD2 3.31Å; I12-F16 WeakPolarHBondContact O-CD2 3.05Å; I12-F16 PolarHBondContact O-N 2.99Å; F16-K18 VanDerWaalsContact C-N 3.33Å; F16-K18 PolarHBondContact O-N 3.45Å; F16-S19 WeakPolarHBondContact O-CB 3.48Å; F16-S19 PolarHBondContact O-N 3.31Å; F16-I20 WeakPolarHBondContact O-CG1 3.43Å; F16-I20 PolarHBondContact O-N 2.98Å
17	H	90.4	Very high	90.4	Very high	109 Å²	109	97 Å²	97	51%	0.505	50%	0.498	S	S	.	.	H	α-helix	trans	-60.7	-43.3	176.7	-175.9	62.5	0	0	0	111.9	S13 F14 L15 S19 I20 Q21	S13-H17 PolarHBondContact O-N 3.37Å; S13-H17 VanDerWaalsContact O-N 3.08Å; F14-H17 PolarHBondContact O-N 3.45Å; L15-H17 PolarHBondContact O-N 3.4Å; H17-S19 VanDerWaalsContact C-N 3.35Å; H17-S19 PolarHBondContact O-N 3.46Å; H17-I20 PolarHBondContact O-N 3.43Å; H17-Q21 PolarHBondContact NE2-OE1 2.96Å; H17-Q21 WeakPolarHBondContact O-CB 3.04Å; H17-Q21 PolarHBondContact O-N 3.27Å
18	K	90.5	Very high	90.5	Very high	109 Å²	109	97.9 Å²	97.9	47%	0.474	50%	0.498	S	S	.	.	H	α-helix	trans	-63	-38.7	175.1	-75.5	-70.4	-177.5	-176.1	0	112.7	F14 L15 F16 T22	F14-K18 HydrophobicContact CD1-CG 4.28Å; F14-K18 HydrophobicContact CE1-CG 3.86Å; F14-K18 HydrophobicContact CE2-CG 4.42Å; F14-K18 HydrophobicContact CZ-CD 4.31Å; F14-K18 HydrophobicContact CZ-CG 3.95Å; F14-K18 WeakPolarHBondContact O-CG 3.44Å; F14-K18 PolarHBondContact O-N 2.96Å; L15-K18 PolarHBondContact O-N 3.35Å; F16-K18 VanDerWaalsContact C-N 3.33Å; F16-K18 PolarHBondContact O-N 3.45Å; K18-T22 WeakPolarHBondContact O-CB 3.39Å; K18-T22 PolarHBondContact O-N 3.47Å; K18-T22 PolarHBondContact O-OG1 2.88Å
19	S	89.8	Confident	90.5	Very high	60 Å²	60	98 Å²	98	42%	0.42	50%	0.502	S	S	.	.	H	α-helix	trans	-62.4	-53.7	175.8	-168.9	0	0	0	0	110.9	L15 F16 H17 Q21 T22 D23	L15-S19 PolarHBondContact O-N 2.93Å; F16-S19 WeakPolarHBondContact O-CB 3.48Å; F16-S19 PolarHBondContact O-N 3.31Å; H17-S19 VanDerWaalsContact C-N 3.35Å; H17-S19 PolarHBondContact O-N 3.46Å; S19-Q21 VanDerWaalsContact C-N 3.26Å; S19-Q21 PolarHBondContact O-N 3.22Å; S19-T22 WeakPolarHBondContact O-CA 3.48Å; S19-T22 WeakPolarHBondContact O-CB 3.39Å; S19-T22 PolarHBondContact O-N 3.36Å; S19-D23 PolarHBondContact O-N 3Å
20	I	90.7	Very high	90.6	Very high	92 Å²	92	98.5 Å²	98.5	47%	0.472	50%	0.501	S	S	.	.	H	α-helix	trans	-56.9	-43.3	-179.7	-66.9	164.7	0	0	0	110.7	F16 H17 T22 D23 I24	F16-I20 WeakPolarHBondContact O-CG1 3.43Å; F16-I20 PolarHBondContact O-N 2.98Å; H17-I20 PolarHBondContact O-N 3.43Å; I20-T22 VanDerWaalsContact C-N 3.3Å; I20-T22 PolarHBondContact O-N 3.45Å; I20-D23 PolarHBondContact O-N 3.47Å; I20-I24 HydrophobicContact CG2-CD1 3.77Å; I20-I24 HydrophobicContact CG2-CG1 4.43Å; I20-I24 VanDerWaalsContact O-CG1 3.27Å; I20-I24 WeakPolarHBondContact O-CG1 3.36Å; I20-I24 PolarHBondContact O-N 2.96Å
21	Q	88.2	Confident	90.7	Very high	90 Å²	90	99.1 Å²	99.1	42%	0.421	50%	0.5	S	S	.	.	H	α-helix	trans	-69.1	-30.7	179.5	-164	147.2	14	0	0	112.8	H17 S19 N25	H17-Q21 PolarHBondContact NE2-OE1 2.96Å; H17-Q21 WeakPolarHBondContact O-CB 3.04Å; H17-Q21 PolarHBondContact O-N 3.27Å; S19-Q21 VanDerWaalsContact C-N 3.26Å; S19-Q21 PolarHBondContact O-N 3.22Å; Q21-N25 VanDerWaalsContact O-CB 3.29Å; Q21-N25 WeakPolarHBondContact O-CB 3.35Å; Q21-N25 PolarHBondContact O-N 2.98Å; Q21-N25 PolarHBondContact O-ND2 3.21Å
22	T	88.7	Confident	90.7	Very high	88 Å²	88	97.9 Å²	97.9	54%	0.54	50%	0.501	S	S	.	.	H	α-helix	trans	-68.6	-43.3	173.1	-55.6	0	0	0	0	110.7	K18 S19 I20 N25 S26	K18-T22 WeakPolarHBondContact O-CB 3.39Å; K18-T22 PolarHBondContact O-N 3.47Å; K18-T22 PolarHBondContact O-OG1 2.88Å; S19-T22 WeakPolarHBondContact O-CA 3.48Å; S19-T22 WeakPolarHBondContact O-CB 3.39Å; S19-T22 PolarHBondContact O-N 3.36Å; I20-T22 VanDerWaalsContact C-N 3.3Å; I20-T22 PolarHBondContact O-N 3.45Å; T22-N25 PolarHBondContact O-N 3.43Å; T22-S26 WeakPolarHBondContact O-CB 3.46Å; T22-S26 PolarHBondContact O-N 2.93Å
23	D	88.9	Confident	90.7	Very high	93 Å²	93	99.7 Å²	99.7	50%	0.497	51%	0.505	S	S	.	.	H	α-helix	trans	-61.1	-49.6	177.4	-65.9	-28.1	0	0	0	110.8	S19 I20 N25 S26 E27	S19-D23 PolarHBondContact O-N 3Å; I20-D23 PolarHBondContact O-N 3.47Å; D23-N25 PolarHBondContact O-N 2.94Å; D23-S26 WeakPolarHBondContact O-CB 3.48Å; D23-S26 PolarHBondContact O-N 3.47Å; D23-S26 VanDerWaalsContact O-N 3.13Å; D23-S26 PolarHBondContact O-OG 3.31Å; D23-E27 PolarHBondContact O-N 3.14Å
24	I	88.6	Confident	90.8	Very high	74 Å²	74	104.3 Å²	104.3	38%	0.379	51%	0.513	S	S	.	.	H	α-helix	trans	-57.2	-48.3	176.1	-69	169.1	0	0	0	111	I20 S26 E27 Y28	I20-I24 HydrophobicContact CG2-CD1 3.77Å; I20-I24 HydrophobicContact CG2-CG1 4.43Å; I20-I24 VanDerWaalsContact O-CG1 3.27Å; I20-I24 WeakPolarHBondContact O-CG1 3.36Å; I20-I24 PolarHBondContact O-N 2.96Å; I24-S26 VanDerWaalsContact C-N 3.27Å; I24-S26 PolarHBondContact O-N 3.41Å; I24-E27 PolarHBondContact O-N 3.36Å; I24-Y28 HydrophobicContact CG2-CD2 3.61Å; I24-Y28 HydrophobicContact CG2-CE2 3.42Å; I24-Y28 VanDerWaalsContact CG2-CE2 3.42Å; I24-Y28 WeakPolarHBondContact O-CD2 2.97Å; I24-Y28 PolarHBondContact O-N 3.45Å
25	N	89.4	Confident	90.9	Very high	96 Å²	96	104 Å²	104	51%	0.513	51%	0.513	S	S	.	.	H	α-helix	trans	-62.4	-36.1	179	-73.9	-13	0	0	0	112.1	Q21 T22 D23 E27 L29	Q21-N25 VanDerWaalsContact O-CB 3.29Å; Q21-N25 WeakPolarHBondContact O-CB 3.35Å; Q21-N25 PolarHBondContact O-N 2.98Å; Q21-N25 PolarHBondContact O-ND2 3.21Å; T22-N25 PolarHBondContact O-N 3.43Å; D23-N25 PolarHBondContact O-N 2.94Å; N25-E27 VanDerWaalsContact C-N 3.35Å; N25-L29 VanDerWaalsContact O-CB 3.31Å; N25-L29 WeakPolarHBondContact O-CB 3.31Å; N25-L29 PolarHBondContact O-N 2.95Å
26	S	90.5	Very high	91	Very high	66 Å²	66	104 Å²	104	46%	0.462	51%	0.513	S	S	.	.	H	α-helix	trans	-65.7	-38.9	177.4	81.2	0	0	0	0	111.8	T22 D23 I24 L29 L30	T22-S26 WeakPolarHBondContact O-CB 3.46Å; T22-S26 PolarHBondContact O-N 2.93Å; D23-S26 WeakPolarHBondContact O-CB 3.48Å; D23-S26 PolarHBondContact O-N 3.47Å; D23-S26 VanDerWaalsContact O-N 3.13Å; D23-S26 PolarHBondContact O-OG 3.31Å; I24-S26 VanDerWaalsContact C-N 3.27Å; I24-S26 PolarHBondContact O-N 3.41Å; S26-L29 PolarHBondContact O-N 2.91Å; S26-L30 WeakPolarHBondContact O-CB 3.3Å; S26-L30 PolarHBondContact O-N 3.37Å
27	E	92.1	Very high	91	Very high	146 Å²	146	101.9 Å²	101.9	68%	0.682	51%	0.507	S	S	*	.	H	α-helix	trans	-67.8	-45.2	178.1	-167.6	-180	175.3	0	0	111.3	D23 I24 N25 L29 L30 K31	D23-E27 PolarHBondContact O-N 3.14Å; I24-E27 PolarHBondContact O-N 3.36Å; N25-E27 VanDerWaalsContact C-N 3.35Å; E27-L29 VanDerWaalsContact C-N 3.34Å; E27-L29 PolarHBondContact O-N 3.02Å; E27-L30 PolarHBondContact O-N 2.97Å; E27-K31 PolarHBondContact O-N 3.38Å
28	Y	89.7	Confident	91	Very high	155 Å²	155	101.3 Å²	101.3	61%	0.608	51%	0.506	S	S	*	.	H	α-helix	trans	-61.8	-40.9	173.9	-79.2	-67.2	0	0	0	112.3	I24 L30 K31 A32	I24-Y28 HydrophobicContact CG2-CD2 3.61Å; I24-Y28 HydrophobicContact CG2-CE2 3.42Å; I24-Y28 VanDerWaalsContact CG2-CE2 3.42Å; I24-Y28 WeakPolarHBondContact O-CD2 2.97Å; I24-Y28 PolarHBondContact O-N 3.45Å; Y28-L30 VanDerWaalsContact C-N 3.32Å; Y28-L30 PolarHBondContact O-N 3.39Å; Y28-K31 PolarHBondContact O-N 3.37Å; Y28-A32 WeakPolarHBondContact O-CB 3.41Å; Y28-A32 PolarHBondContact O-N 3.47Å
29	L	90.7	Very high	90.8	Very high	102 Å²	102	104.7 Å²	104.7	53%	0.534	52%	0.516	S	S	.	.	H	α-helix	trans	-62.6	-41.6	175.9	-177.2	67.7	0	0	0	111.3	N25 S26 E27 K31 A32 K33	N25-L29 VanDerWaalsContact O-CB 3.31Å; N25-L29 WeakPolarHBondContact O-CB 3.31Å; N25-L29 PolarHBondContact O-N 2.95Å; S26-L29 PolarHBondContact O-N 2.91Å; E27-L29 VanDerWaalsContact C-N 3.34Å; E27-L29 PolarHBondContact O-N 3.02Å; L29-K31 VanDerWaalsContact C-N 3.35Å; L29-A32 PolarHBondContact O-N 3.39Å; L29-K33 WeakPolarHBondContact O-CG 3.44Å; L29-K33 PolarHBondContact O-N 3.05Å
30	L	93.8	Very high	90.7	Very high	94 Å²	94	106.7 Å²	106.7	49%	0.492	52%	0.518	S	S	.	.	H	α-helix	trans	-66.9	-38.3	178.7	-158.9	130.4	0	0	0	111.4	S26 E27 Y28 K33 R34	S26-L30 WeakPolarHBondContact O-CB 3.3Å; S26-L30 PolarHBondContact O-N 3.37Å; E27-L30 PolarHBondContact O-N 2.97Å; Y28-L30 VanDerWaalsContact C-N 3.32Å; Y28-L30 PolarHBondContact O-N 3.39Å; L30-K33 PolarHBondContact O-N 3.1Å; L30-R34 WeakPolarHBondContact O-CG 3.33Å; L30-R34 PolarHBondContact O-N 3.43Å; L30-R34 VanDerWaalsContact O-N 3.12Å
31	K	94	Very high	90.5	Very high	121 Å²	121	106.8 Å²	106.8	53%	0.526	52%	0.52	S	S	.	.	H	α-helix	trans	-63.4	-47.6	172.6	-171	180	178.5	-176.6	0	111.9	E27 Y28 L29 K33 R34 E35	E27-K31 PolarHBondContact O-N 3.38Å; Y28-K31 PolarHBondContact O-N 3.37Å; L29-K31 VanDerWaalsContact C-N 3.35Å; K31-K33 VanDerWaalsContact C-N 3.31Å; K31-K33 PolarHBondContact O-N 3.11Å; K31-R34 WeakPolarHBondContact O-CB 3.34Å; K31-R34 PolarHBondContact O-N 3.4Å; K31-R34 VanDerWaalsContact O-N 3.11Å; K31-E35 WeakPolarHBondContact CE-OE1 3.47Å; K31-E35 PolarHBondContact O-N 2.93Å
32	A	90.2	Very high	90.4	Very high	53 Å²	53	105.8 Å²	105.8	44%	0.438	52%	0.518	S	S	.	.	H	α-helix	trans	-59.9	-40.7	177.7	0	0	0	0	0	112.1	Y28 L29 R34 E35 L36	Y28-A32 WeakPolarHBondContact O-CB 3.41Å; Y28-A32 PolarHBondContact O-N 3.47Å; L29-A32 PolarHBondContact O-N 3.39Å; A32-R34 PolarHBondContact O-N 2.89Å; A32-E35 PolarHBondContact O-N 2.99Å; A32-L36 WeakPolarHBondContact O-CB 3.42Å; A32-L36 PolarHBondContact O-N 2.88Å
33	K	93.2	Very high	90.1	Very high	128 Å²	128	106.9 Å²	106.9	56%	0.557	52%	0.52	S	S	*	.	H	α-helix	trans	-61.5	-40.9	174	-76.5	-178.1	178.9	-176.2	0	112.5	L29 L30 K31 L36 I37	L29-K33 WeakPolarHBondContact O-CG 3.44Å; L29-K33 PolarHBondContact O-N 3.05Å; L30-K33 PolarHBondContact O-N 3.1Å; K31-K33 VanDerWaalsContact C-N 3.31Å; K31-K33 PolarHBondContact O-N 3.11Å; K33-L36 PolarHBondContact O-N 3.05Å; K33-I37 WeakPolarHBondContact O-CG1 3.47Å; K33-I37 PolarHBondContact O-N 3.21Å; K33-I37 VanDerWaalsContact O-N 3.1Å
34	R	94.4	Very high	89.9	Confident	166 Å²	166	106.9 Å²	106.9	63%	0.626	52%	0.519	S	S	*	.	H	α-helix	trans	-65.2	-44.5	176.6	-73.7	179.8	-177.3	-176.8	2.6	111.8	L30 K31 A32 L36 I37 I38	L30-R34 WeakPolarHBondContact O-CG 3.33Å; L30-R34 PolarHBondContact O-N 3.43Å; L30-R34 VanDerWaalsContact O-N 3.12Å; K31-R34 WeakPolarHBondContact O-CB 3.34Å; K31-R34 PolarHBondContact O-N 3.4Å; K31-R34 VanDerWaalsContact O-N 3.11Å; A32-R34 PolarHBondContact O-N 2.89Å; R34-L36 VanDerWaalsContact C-N 3.3Å; R34-L36 PolarHBondContact O-N 3.47Å; R34-I37 PolarHBondContact O-N 3.5Å; R34-I38 WeakPolarHBondContact O-CG1 3.5Å; R34-I38 PolarHBondContact O-N 3.27Å
35	E	93.2	Very high	89.8	Confident	105 Å²	105	109.3 Å²	109.3	49%	0.491	53%	0.527	S	S	.	.	H	α-helix	trans	-61.9	-39.4	176.8	-74	178.3	-169.7	0	0	111.7	K31 A32 I38 R39	K31-E35 WeakPolarHBondContact CE-OE1 3.47Å; K31-E35 PolarHBondContact O-N 2.93Å; A32-E35 PolarHBondContact O-N 2.99Å; E35-I38 PolarHBondContact O-N 3.13Å; E35-R39 VanDerWaalsContact O-CG 3.3Å; E35-R39 WeakPolarHBondContact O-CG 3.39Å; E35-R39 PolarHBondContact O-N 3.35Å
36	L	92.5	Very high	89.1	Confident	103 Å²	103	112 Å²	112	54%	0.539	53%	0.531	S	S	.	.	H	α-helix	trans	-59.1	-50.3	174.2	-168.1	99.5	0	0	0	111.6	A32 K33 R34 I38 R39 E40	A32-L36 WeakPolarHBondContact O-CB 3.42Å; A32-L36 PolarHBondContact O-N 2.88Å; K33-L36 PolarHBondContact O-N 3.05Å; R34-L36 VanDerWaalsContact C-N 3.3Å; R34-L36 PolarHBondContact O-N 3.47Å; L36-I38 VanDerWaalsContact C-N 3.31Å; L36-I38 PolarHBondContact O-N 3.23Å; L36-R39 PolarHBondContact O-N 3.12Å; L36-R39 VanDerWaalsContact O-N 3.14Å; L36-E40 WeakPolarHBondContact O-CG 3.46Å; L36-E40 PolarHBondContact O-N 3.33Å
37	I	90.8	Very high	88.5	Confident	90 Å²	90	114.3 Å²	114.3	46%	0.462	54%	0.535	S	S	.	.	H	α-helix	trans	-60.5	-40.7	179.8	-68.1	165.7	0	0	0	111.3	K33 R34 E40 N41	K33-I37 WeakPolarHBondContact O-CG1 3.47Å; K33-I37 PolarHBondContact O-N 3.21Å; K33-I37 VanDerWaalsContact O-N 3.1Å; R34-I37 PolarHBondContact O-N 3.5Å; I37-E40 PolarHBondContact O-N 2.91Å; I37-N41 WeakPolarHBondContact O-CB 3.45Å; I37-N41 PolarHBondContact O-N 2.9Å; I37-N41 PolarHBondContact O-ND2 3.33Å
38	I	91.2	Very high	88	Confident	97 Å²	97	112 Å²	112	50%	0.497	53%	0.526	S	S	.	.	H	α-helix	trans	-61.7	-47.3	176.4	-67.7	165.5	0	0	0	110	R34 E35 L36 E40 N41 D42	R34-I38 WeakPolarHBondContact O-CG1 3.5Å; R34-I38 PolarHBondContact O-N 3.27Å; E35-I38 PolarHBondContact O-N 3.13Å; L36-I38 VanDerWaalsContact C-N 3.31Å; L36-I38 PolarHBondContact O-N 3.23Å; I38-E40 PolarHBondContact O-N 3.06Å; I38-N41 PolarHBondContact O-N 3.3Å; I38-D42 PolarHBondContact O-N 2.99Å
39	R	86.9	Confident	87.5	Confident	180 Å²	180	109.1 Å²	109.1	68%	0.679	52%	0.518	S	S	*	.	H	α-helix	trans	-62.9	-39.6	178.6	-70	-67.2	-170.2	175	1.4	112.8	E35 L36 D42 L43	E35-R39 VanDerWaalsContact O-CG 3.3Å; E35-R39 WeakPolarHBondContact O-CG 3.39Å; E35-R39 PolarHBondContact O-N 3.35Å; L36-R39 PolarHBondContact O-N 3.12Å; L36-R39 VanDerWaalsContact O-N 3.14Å; R39-D42 PolarHBondContact O-N 2.93Å; R39-L43 WeakPolarHBondContact O-CB 3.27Å; R39-L43 WeakPolarHBondContact O-CG 3.29Å; R39-L43 PolarHBondContact O-N 3.46Å
40	E	86.3	Confident	86.7	Confident	101 Å²	101	108.5 Å²	108.5	47%	0.472	52%	0.515	S	S	.	.	H	α-helix	trans	-63.4	-44.2	175.3	-74.3	177.5	164.4	0	0	111.5	L36 I37 I38 L43 L44	L36-E40 WeakPolarHBondContact O-CG 3.46Å; L36-E40 PolarHBondContact O-N 3.33Å; I37-E40 PolarHBondContact O-N 2.91Å; I38-E40 PolarHBondContact O-N 3.06Å; E40-L43 PolarHBondContact O-N 2.72Å; E40-L44 WeakPolarHBondContact O-CG 3.2Å; E40-L44 PolarHBondContact O-N 3.02Å
41	N	86.7	Confident	85.9	Confident	94 Å²	94	109.6 Å²	109.6	50%	0.503	52%	0.52	S	S	.	.	H	α-helix	trans	-64.9	-40.8	176.7	-75.8	-25.2	0	0	0	112.4	I37 I38 L44 K45	I37-N41 WeakPolarHBondContact O-CB 3.45Å; I37-N41 PolarHBondContact O-N 2.9Å; I37-N41 PolarHBondContact O-ND2 3.33Å; I38-N41 PolarHBondContact O-N 3.3Å; N41-L44 PolarHBondContact O-N 2.66Å; N41-K45 WeakPolarHBondContact O-CB 3.37Å; N41-K45 PolarHBondContact O-N 3.01Å
42	D	86.9	Confident	85.2	Confident	70 Å²	70	108.1 Å²	108.1	37%	0.374	52%	0.517	S	S	.	.	H	α-helix	trans	-61.4	-46.5	175.7	-72.5	-19.1	0	0	0	110.5	I38 R39 L44 K45 Y46	I38-D42 PolarHBondContact O-N 2.99Å; R39-D42 PolarHBondContact O-N 2.93Å; D42-L44 PolarHBondContact O-N 3.41Å; D42-K45 WeakPolarHBondContact O-CB 3.46Å; D42-K45 PolarHBondContact O-N 3.01Å; D42-Y46 HydrophobicContact CB-CE2 4.42Å; D42-Y46 WeakPolarHBondContact O-CD2 3.43Å; D42-Y46 PolarHBondContact O-N 2.95Å
43	L	82.5	Confident	84.8	Confident	111 Å²	111	111.9 Å²	111.9	58%	0.581	52%	0.521	S	S	*	.	H	α-helix	trans	-60.2	-44.7	177.2	-78.5	165.2	0	0	0	112.4	R39 E40 K45 Y46 Q47	R39-L43 WeakPolarHBondContact O-CB 3.27Å; R39-L43 WeakPolarHBondContact O-CG 3.29Å; R39-L43 PolarHBondContact O-N 3.46Å; E40-L43 PolarHBondContact O-N 2.72Å; L43-K45 VanDerWaalsContact C-N 3.31Å; L43-K45 PolarHBondContact O-N 3.44Å; L43-Y46 PolarHBondContact O-N 3.26Å; L43-Q47 WeakPolarHBondContact O-CG 3.35Å; L43-Q47 PolarHBondContact O-N 2.96Å
44	L	85.2	Confident	84.1	Confident	93 Å²	93	112.4 Å²	112.4	49%	0.487	52%	0.521	S	S	.	.	H	α-helix	trans	-61.4	-41.7	175.9	-75.6	170.6	0	0	0	111.4	E40 N41 D42 Q47 I48	E40-L44 WeakPolarHBondContact O-CG 3.2Å; E40-L44 PolarHBondContact O-N 3.02Å; N41-L44 PolarHBondContact O-N 2.66Å; D42-L44 PolarHBondContact O-N 3.41Å; L44-Q47 PolarHBondContact O-N 3.23Å; L44-I48 VanDerWaalsContact O-CG1 3.26Å; L44-I48 WeakPolarHBondContact O-CG1 3.34Å; L44-I48 PolarHBondContact O-N 3.42Å
45	K	85.1	Confident	83.5	Confident	125 Å²	125	109.4 Å²	109.4	54%	0.543	52%	0.517	S	S	.	.	H	α-helix	trans	-62.3	-46.6	177.4	-176.5	179.6	169.7	-174.3	0	111.5	N41 D42 L43 Q47 I48 E49	N41-K45 WeakPolarHBondContact O-CB 3.37Å; N41-K45 PolarHBondContact O-N 3.01Å; D42-K45 WeakPolarHBondContact O-CB 3.46Å; D42-K45 PolarHBondContact O-N 3.01Å; L43-K45 VanDerWaalsContact C-N 3.31Å; L43-K45 PolarHBondContact O-N 3.44Å; K45-Q47 VanDerWaalsContact C-N 3.34Å; K45-Q47 PolarHBondContact O-N 2.97Å; K45-I48 PolarHBondContact O-N 3.33Å; K45-E49 WeakPolarHBondContact CE-OE1 3.45Å; K45-E49 IonicContact NZ-OE1 3.87Å; K45-E49 WeakPolarHBondContact O-CG 3.4Å; K45-E49 PolarHBondContact O-N 3.21Å
46	Y	76.2	Confident	82.8	Confident	151 Å²	151	110.1 Å²	110.1	59%	0.592	52%	0.52	S	S	*	.	H	α-helix	trans	-60.3	-42.6	175.9	-76.8	-64.4	0	0	0	112.1	D42 L43 I48 E49 D50	D42-Y46 HydrophobicContact CB-CE2 4.42Å; D42-Y46 WeakPolarHBondContact O-CD2 3.43Å; D42-Y46 PolarHBondContact O-N 2.95Å; L43-Y46 PolarHBondContact O-N 3.26Å; Y46-I48 VanDerWaalsContact C-N 3.33Å; Y46-I48 PolarHBondContact O-N 3.46Å; Y46-E49 PolarHBondContact O-N 2.89Å; Y46-D50 PolarHBondContact O-N 3.48Å
47	Q	76.3	Confident	82.2	Confident	116 Å²	116	107.9 Å²	107.9	54%	0.542	51%	0.508	S	S	.	.	H	α-helix	trans	-62.6	-39.1	176.3	-74.2	-179.2	-10.4	0	0	112.6	L43 L44 K45 I51	L43-Q47 WeakPolarHBondContact O-CG 3.35Å; L43-Q47 PolarHBondContact O-N 2.96Å; L44-Q47 PolarHBondContact O-N 3.23Å; K45-Q47 VanDerWaalsContact C-N 3.34Å; K45-Q47 PolarHBondContact O-N 2.97Å; Q47-I51 WeakPolarHBondContact O-CD1 3.46Å; Q47-I51 WeakPolarHBondContact O-CG1 3.25Å; Q47-I51 PolarHBondContact O-N 3.29Å
48	I	81.8	Confident	81.5	Confident	98 Å²	98	108.6 Å²	108.6	50%	0.503	51%	0.512	S	S	.	.	H	α-helix	trans	-67.4	-43.7	176.8	-68.7	165.4	0	0	0	110.7	L44 K45 Y46 D50 I51 I52	L44-I48 VanDerWaalsContact O-CG1 3.26Å; L44-I48 WeakPolarHBondContact O-CG1 3.34Å; L44-I48 PolarHBondContact O-N 3.42Å; K45-I48 PolarHBondContact O-N 3.33Å; Y46-I48 VanDerWaalsContact C-N 3.33Å; Y46-I48 PolarHBondContact O-N 3.46Å; I48-D50 VanDerWaalsContact C-N 3.32Å; I48-D50 PolarHBondContact O-N 3.25Å; I48-I51 PolarHBondContact O-N 3.49Å; I48-I52 HydrophobicContact CG2-CD1 3.86Å; I48-I52 HydrophobicContact CG2-CG1 4.46Å; I48-I52 WeakPolarHBondContact O-CG1 3.47Å; I48-I52 PolarHBondContact O-N 2.92Å
49	E	79.9	Confident	80.7	Confident	93 Å²	93	106.7 Å²	106.7	44%	0.435	51%	0.508	S	S	.	.	H	α-helix	trans	-60.3	-42	176.8	-74.3	177.1	-178.4	0	0	111.5	K45 Y46 I52 Y53	K45-E49 WeakPolarHBondContact CE-OE1 3.45Å; K45-E49 IonicContact NZ-OE1 3.87Å; K45-E49 WeakPolarHBondContact O-CG 3.4Å; K45-E49 PolarHBondContact O-N 3.21Å; Y46-E49 PolarHBondContact O-N 2.89Å; E49-I52 PolarHBondContact O-N 3.08Å; E49-Y53 WeakPolarHBondContact O-CB 3.45Å; E49-Y53 PolarHBondContact O-N 3.43Å
50	D	73.8	Confident	80.1	Confident	90 Å²	90	103.9 Å²	103.9	48%	0.481	51%	0.506	S	S	.	.	H	α-helix	trans	-62	-44.7	174.2	-76.2	-20.4	0	0	0	111.6	Y46 I48 I52 Y53 Y54	Y46-D50 PolarHBondContact O-N 3.48Å; I48-D50 VanDerWaalsContact C-N 3.32Å; I48-D50 PolarHBondContact O-N 3.25Å; D50-I52 VanDerWaalsContact C-N 3.34Å; D50-I52 PolarHBondContact O-N 3.44Å; D50-Y53 PolarHBondContact O-N 2.97Å; D50-Y54 HydrophobicContact CB-CD2 4.5Å; D50-Y54 HydrophobicContact CB-CE2 4.37Å; D50-Y54 WeakPolarHBondContact O-CD2 3.49Å; D50-Y54 PolarHBondContact O-N 2.97Å
51	I	76.7	Confident	79.4	Confident	116 Å²	116	108.1 Å²	108.1	60%	0.595	52%	0.519	S	S	*	.	H	α-helix	trans	-59.6	-46	178.2	-70.3	163	0	0	0	110.8	Q47 I48 Y53 Y54 D55	Q47-I51 WeakPolarHBondContact O-CD1 3.46Å; Q47-I51 WeakPolarHBondContact O-CG1 3.25Å; Q47-I51 PolarHBondContact O-N 3.29Å; I48-I51 PolarHBondContact O-N 3.49Å; I51-Y53 VanDerWaalsContact C-N 3.34Å; I51-Y53 PolarHBondContact O-N 3.26Å; I51-Y54 PolarHBondContact O-N 3.46Å; I51-D55 WeakPolarHBondContact O-CB 3.36Å; I51-D55 PolarHBondContact O-N 3.12Å
52	I	79.3	Confident	78.5	Confident	90 Å²	90	109.3 Å²	109.3	46%	0.462	53%	0.53	S	S	.	.	H	α-helix	trans	-62.2	-44.2	178.3	-66	166	0	0	0	110.2	I48 E49 D50 Y54 D55 E56	I48-I52 HydrophobicContact CG2-CD1 3.86Å; I48-I52 HydrophobicContact CG2-CG1 4.46Å; I48-I52 WeakPolarHBondContact O-CG1 3.47Å; I48-I52 PolarHBondContact O-N 2.92Å; E49-I52 PolarHBondContact O-N 3.08Å; D50-I52 VanDerWaalsContact C-N 3.34Å; D50-I52 PolarHBondContact O-N 3.44Å; I52-Y54 PolarHBondContact O-N 3.27Å; I52-D55 PolarHBondContact O-N 3.31Å; I52-E56 PolarHBondContact O-N 2.98Å
53	Y	82.1	Confident	76.9	Confident	132 Å²	132	115.9 Å²	115.9	52%	0.518	56%	0.563	S	S	.	*	H	α-helix	trans	-59.7	-45.7	178.6	176.5	-103.6	0	0	0	112.4	E49 D50 I51 L57	E49-Y53 WeakPolarHBondContact O-CB 3.45Å; E49-Y53 PolarHBondContact O-N 3.43Å; D50-Y53 PolarHBondContact O-N 2.97Å; I51-Y53 VanDerWaalsContact C-N 3.34Å; I51-Y53 PolarHBondContact O-N 3.26Å; Y53-L57 HydrophobicContact CD1-CD1 4Å; Y53-L57 HydrophobicContact CE1-CD1 3.33Å; Y53-L57 HydrophobicContact CE2-CD1 4.3Å; Y53-L57 PolarHBondContact O-N 3.5Å
54	Y	78	Confident	76.6	Confident	140 Å²	140	116.1 Å²	116.1	55%	0.549	56%	0.562	S	S	.	*	H	α-helix	trans	-69.5	-33	177.8	-72.8	-66.3	0	0	0	112.6	D50 I51 I52 L57 I58	D50-Y54 HydrophobicContact CB-CD2 4.5Å; D50-Y54 HydrophobicContact CB-CE2 4.37Å; D50-Y54 WeakPolarHBondContact O-CD2 3.49Å; D50-Y54 PolarHBondContact O-N 2.97Å; I51-Y54 PolarHBondContact O-N 3.46Å; I52-Y54 PolarHBondContact O-N 3.27Å; Y54-L57 HydrophobicContact CD1-CD1 4.47Å; Y54-L57 WeakPolarHBondContact O-CB 3.3Å; Y54-L57 PolarHBondContact O-N 3.03Å; Y54-I58 VanDerWaalsContact O-CG1 3.3Å; Y54-I58 WeakPolarHBondContact O-CG1 3.45Å; Y54-I58 PolarHBondContact O-N 3.47Å
55	D	82.2	Confident	76.2	Confident	103 Å²	103	117.3 Å²	117.3	55%	0.551	57%	0.566	S	S	*	*	H	α-helix	trans	-66.6	-41.9	175.8	-165.4	45.9	0	0	0	112	I51 I52 I58 S59	I51-D55 WeakPolarHBondContact O-CB 3.36Å; I51-D55 PolarHBondContact O-N 3.12Å; I52-D55 PolarHBondContact O-N 3.31Å; D55-I58 PolarHBondContact O-N 3.28Å; D55-S59 WeakPolarHBondContact O-CB 3.31Å; D55-S59 PolarHBondContact O-N 3.44Å; D55-S59 PolarHBondContact O-OG 3.33Å
56	E	79.2	Confident	75.7	Confident	119 Å²	119	116.9 Å²	116.9	56%	0.556	57%	0.568	S	S	*	*	H	α-helix	trans	-63.1	-41.7	172.4	-75.3	-173.9	171.7	0	0	111.9	I52 S59 N60	I52-E56 PolarHBondContact O-N 2.98Å; E56-S59 PolarHBondContact O-N 3.34Å; E56-N60 PolarHBondContact O-N 3.26Å; E56-N60 PolarHBondContact O-ND2 2.9Å
57	L	78.8	Confident	75.7	Confident	56 Å²	56	114.9 Å²	114.9	29%	0.293	57%	0.566	S	S	.	*	H	α-helix	trans	-59.4	-50.2	175.8	-109.3	161.1	0	0	0	111.4	Y53 Y54 S59 N60 Y61	Y53-L57 HydrophobicContact CD1-CD1 4Å; Y53-L57 HydrophobicContact CE1-CD1 3.33Å; Y53-L57 HydrophobicContact CE2-CD1 4.3Å; Y53-L57 PolarHBondContact O-N 3.5Å; Y54-L57 HydrophobicContact CD1-CD1 4.47Å; Y54-L57 WeakPolarHBondContact O-CB 3.3Å; Y54-L57 PolarHBondContact O-N 3.03Å; L57-S59 VanDerWaalsContact C-N 3.34Å; L57-S59 PolarHBondContact O-N 3.39Å; L57-N60 PolarHBondContact O-N 3.05Å; L57-Y61 HydrophobicContact CD2-CD2 4.15Å; L57-Y61 HydrophobicContact CD2-CE2 3.59Å; L57-Y61 WeakPolarHBondContact O-CD2 3.48Å; L57-Y61 PolarHBondContact O-N 2.98Å
58	I	76	Confident	75.6	Confident	105 Å²	105	114.8 Å²	114.8	54%	0.538	57%	0.568	S	S	.	*	H	α-helix	trans	-60.8	-45.1	178.4	-68.5	166.2	0	0	0	110.4	Y54 D55 N60 Y61 V62	Y54-I58 VanDerWaalsContact O-CG1 3.3Å; Y54-I58 WeakPolarHBondContact O-CG1 3.45Å; Y54-I58 PolarHBondContact O-N 3.47Å; D55-I58 PolarHBondContact O-N 3.28Å; I58-N60 VanDerWaalsContact C-N 3.3Å; I58-N60 PolarHBondContact O-N 2.75Å; I58-Y61 PolarHBondContact O-N 2.98Å; I58-Y61 VanDerWaalsContact O-N 3.09Å; I58-V62 HydrophobicContact CG2-CG2 4.33Å; I58-V62 WeakPolarHBondContact O-CG2 3.34Å; I58-V62 PolarHBondContact O-N 2.9Å
59	S	75.1	Confident	75.2	Confident	58 Å²	58	115.9 Å²	115.9	41%	0.406	57%	0.572	S	S	.	*	H	α-helix	trans	-59.7	-39	-179.9	-65.1	0	0	0	0	112.7	D55 E56 L57 Y61 V62	D55-S59 WeakPolarHBondContact O-CB 3.31Å; D55-S59 PolarHBondContact O-N 3.44Å; D55-S59 PolarHBondContact O-OG 3.33Å; E56-S59 PolarHBondContact O-N 3.34Å; L57-S59 VanDerWaalsContact C-N 3.34Å; L57-S59 PolarHBondContact O-N 3.39Å; S59-Y61 VanDerWaalsContact C-N 3.34Å; S59-Y61 PolarHBondContact O-N 3.17Å; S59-V62 PolarHBondContact O-N 3.28Å
60	N	75.1	Confident	74.9	Confident	121 Å²	121	117.6 Å²	117.6	65%	0.647	58%	0.582	S	S	*	*	H	α-helix	trans	-71.3	-24.4	176.7	-74.3	-32.9	0	0	0	113.9	E56 L57 I58	E56-N60 PolarHBondContact O-N 3.26Å; E56-N60 PolarHBondContact O-ND2 2.9Å; L57-N60 PolarHBondContact O-N 3.05Å; I58-N60 VanDerWaalsContact C-N 3.3Å; I58-N60 PolarHBondContact O-N 2.75Å
61	Y	70.9	Confident	75	Confident	189 Å²	189	119.7 Å²	119.7	74%	0.741	59%	0.59	S	S	*	*	H	α-helix	trans	-83.7	-19.4	176.5	-86.1	-72.6	0	0	0	113.6	L57 I58 S59	L57-Y61 HydrophobicContact CD2-CD2 4.15Å; L57-Y61 HydrophobicContact CD2-CE2 3.59Å; L57-Y61 WeakPolarHBondContact O-CD2 3.48Å; L57-Y61 PolarHBondContact O-N 2.98Å; I58-Y61 PolarHBondContact O-N 2.98Å; I58-Y61 VanDerWaalsContact O-N 3.09Å; S59-Y61 VanDerWaalsContact C-N 3.34Å; S59-Y61 PolarHBondContact O-N 3.17Å
62	V	68.2	Low	74.8	Confident	120 Å²	120	120 Å²	120	73%	0.727	59%	0.589	S	S	*	*	H	α-helix	trans	-88.7	-15.2	-176.9	173.8	0	0	0	0	112.5	I58 S59	I58-V62 HydrophobicContact CG2-CG2 4.33Å; I58-V62 WeakPolarHBondContact O-CG2 3.34Å; I58-V62 PolarHBondContact O-N 2.9Å; S59-V62 PolarHBondContact O-N 3.28Å
63	L	53.1	Low	74.4	Confident	207 Å²	207	122.7 Å²	122.7	100%	1.084	60%	0.601	S	S	*	*			trans	-93.9	0	173.6	-74.6	167.9	0	0	0	112.2

Retrieved 63 of 63 residues in 45.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).