A0A913KWJ7_SCHMA Loading...

Uncharacterized protein AlphaSync

AlphaFold DB , UniProt , Accession A0A913KWJ7, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 44 aa.

						>A0A913KWJ7_SCHMA|A0A913KWJ7
MCPRAPKTMHFVLSHVCRKDEPWLKLIKRLLAIHILIIVYHGDT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.7	Low	58.9	Low	247 Å²	247	147 Å²	147	100%	1.217	76%	0.756	S	S	*	*				0	107.7	0	-71.1	170.9	178.5	0	0	107.4
2	C	55.9	Low	58.4	Low	116 Å²	116	144.3 Å²	144.3	78%	0.784	75%	0.751	S	S	*	*			trans	-85.4	131.7	172.7	-78	0	0	0	0	108.9
3	P	66.8	Low	58.5	Low	117 Å²	117	142.3 Å²	142.3	76%	0.76	74%	0.741	S	S	*	*			trans	-66.7	133.5	178.1	27.1	-32.3	0	0	0	110.6	A5	P3-A5 PolarHBondContact O-N 3.34Å
4	R	65.6	Low	58.3	Low	258 Å²	258	135.2 Å²	135.2	97%	0.974	71%	0.709	S	S	*	*			trans	-76.2	87.8	179.7	-160.2	177.4	-166.7	-178.5	2.7	109.2
5	A	59.2	Low	58.4	Low	44 Å²	44	133.2 Å²	133.2	36%	0.364	69%	0.694	S	S	.	*			trans	-83	149.2	177.7	0	0	0	0	0	111.8	P3 H10	P3-A5 PolarHBondContact O-N 3.34Å; A5-H10 PolarHBondContact O-CD2 3.05Å
6	P	56.9	Low	58.2	Low	102 Å²	102	130 Å²	130	66%	0.662	68%	0.682	S	S	*	*			trans	-65.7	140.3	-171.6	25.9	-33.8	0	0	0	112.6	T8 M9	P6-T8 PolarHBondContact O-N 3.16Å; P6-M9 PolarHBondContact O-N 2.93Å
7	K	61.5	Low	58.1	Low	201 Å²	201	127 Å²	127	87%	0.874	67%	0.673	S	S	*	*	T	Hydrogen-bonded Turn	trans	-51.6	-14.1	-168	-93.3	177	172.8	176.5	0	116.9
8	T	64	Low	58.1	Low	140 Å²	140	131.3 Å²	131.3	86%	0.859	68%	0.679	S	S	*	*	T	Hydrogen-bonded Turn	trans	-106.2	-12.1	-167.5	-38	0	0	0	0	114.1	P6	P6-T8 PolarHBondContact O-N 3.16Å
9	M	56.4	Low	58.1	Low	154 Å²	154	132.5 Å²	132.5	76%	0.759	68%	0.678	S	S	*	*	T	Hydrogen-bonded Turn	trans	-112	0.7	163.4	-63.9	-165	-157.9	0	0	112.5	P6 F11	P6-M9 PolarHBondContact O-N 2.93Å; M9-F11 PolarHBondContact O-N 3.24Å
10	H	56.9	Low	58.4	Low	75 Å²	75	129.8 Å²	129.8	35%	0.347	67%	0.665	S	S	.	*	H	α-helix	trans	-66.6	-20.1	-171.1	-153.9	-101.9	0	0	0	113.8	A5 S14	A5-H10 PolarHBondContact O-CD2 3.05Å; H10-S14 PolarHBondContact CE1-OG 2.78Å; H10-S14 PolarHBondContact ND1-OG 3.2Å; H10-S14 WeakPolarHBondContact O-CB 3.45Å; H10-S14 PolarHBondContact O-N 3.2Å; H10-S14 PolarHBondContact O-OG 3.17Å
11	F	54	Low	58.8	Low	163 Å²	163	129.9 Å²	129.9	72%	0.715	66%	0.663	S	S	*	*	H	α-helix	trans	-75.8	-40.8	-173.9	-136.3	-92.4	0	0	0	112.6	M9 H15	M9-F11 PolarHBondContact O-N 3.24Å; F11-H15 AromaticContact CD1-CD2 3.61Å; F11-H15 AromaticContact CD1-NE2 3.9Å; F11-H15 AromaticContact CE1-CD2 3.57Å; F11-H15 AromaticContact CE1-NE2 3.33Å; F11-H15 VanDerWaalsContact CE1-NE2 3.33Å; F11-H15 WeakPolarHBondContact CE1-NE2 3.33Å; F11-H15 AromaticContact CZ-NE2 3.97Å; F11-H15 WeakPolarHBondContact O-CB 3.43Å; F11-H15 PolarHBondContact O-CD2 3.05Å; F11-H15 PolarHBondContact O-N 3.1Å
12	V	53.5	Low	60	Low	115 Å²	115	122.2 Å²	122.2	70%	0.697	63%	0.632	S	S	*	*	H	α-helix	trans	-72.2	-44.2	178.8	179.1	0	0	0	0	110.4	V16	V12-V16 VanDerWaalsContact O-CG2 3.3Å; V12-V16 WeakPolarHBondContact O-CG2 3.31Å; V12-V16 PolarHBondContact O-N 2.97Å
13	L	59	Low	61.1	Low	118 Å²	118	124.6 Å²	124.6	62%	0.618	62%	0.624	S	S	*	*	H	α-helix	trans	-70.5	-34.7	179.2	-86.8	138.1	0	0	0	113.6	C17	L13-C17 VanDerWaalsContact O-CB 3.24Å; L13-C17 WeakPolarHBondContact O-CB 3.35Å; L13-C17 PolarHBondContact O-N 3.23Å
14	S	56.2	Low	61.8	Low	43 Å²	43	124.7 Å²	124.7	30%	0.301	62%	0.618	S	S	.	*	H	α-helix	trans	-76.4	-28.7	177.9	-61.1	0	0	0	0	113.4	H10 R18	H10-S14 PolarHBondContact CE1-OG 2.78Å; H10-S14 PolarHBondContact ND1-OG 3.2Å; H10-S14 WeakPolarHBondContact O-CB 3.45Å; H10-S14 PolarHBondContact O-N 3.2Å; H10-S14 PolarHBondContact O-OG 3.17Å; S14-R18 PolarHBondContact O-N 2.99Å
15	H	59.8	Low	62.7	Low	105 Å²	105	118.8 Å²	118.8	49%	0.486	60%	0.599	S	S	.	*	H	α-helix	trans	-72.5	-35.3	173.3	-95.2	-87	0	0	0	112.6	F11 K19	F11-H15 AromaticContact CD1-CD2 3.61Å; F11-H15 AromaticContact CD1-NE2 3.9Å; F11-H15 AromaticContact CE1-CD2 3.57Å; F11-H15 AromaticContact CE1-NE2 3.33Å; F11-H15 VanDerWaalsContact CE1-NE2 3.33Å; F11-H15 WeakPolarHBondContact CE1-NE2 3.33Å; F11-H15 AromaticContact CZ-NE2 3.97Å; F11-H15 WeakPolarHBondContact O-CB 3.43Å; F11-H15 PolarHBondContact O-CD2 3.05Å; F11-H15 PolarHBondContact O-N 3.1Å; H15-K19 WeakPolarHBondContact O-CB 3.09Å; H15-K19 PolarHBondContact O-N 3.36Å
16	V	54.6	Low	64	Low	82 Å²	82	120.8 Å²	120.8	50%	0.497	60%	0.603	S	S	.	*	H	α-helix	trans	-68.5	-49.1	172.6	176	0	0	0	0	109.6	V12 R18 K19 D20	V12-V16 VanDerWaalsContact O-CG2 3.3Å; V12-V16 WeakPolarHBondContact O-CG2 3.31Å; V12-V16 PolarHBondContact O-N 2.97Å; V16-R18 VanDerWaalsContact C-N 3.31Å; V16-R18 PolarHBondContact O-N 3.18Å; V16-K19 PolarHBondContact O-N 2.83Å; V16-D20 VanDerWaalsContact CG1-OD2 3.26Å; V16-D20 WeakPolarHBondContact CG1-OD2 3.49Å; V16-D20 WeakPolarHBondContact O-CB 3.26Å; V16-D20 PolarHBondContact O-N 2.81Å
17	C	56.3	Low	65.6	Low	79 Å²	79	120.6 Å²	120.6	53%	0.534	60%	0.595	S	S	.	*	H	α-helix	trans	-58.9	-35	-178.5	-159.1	0	0	0	0	114.1	L13 E21	L13-C17 VanDerWaalsContact O-CB 3.24Å; L13-C17 WeakPolarHBondContact O-CB 3.35Å; L13-C17 PolarHBondContact O-N 3.23Å; C17-E21 WeakPolarHBondContact O-CG 3.3Å
18	R	58.6	Low	66.8	Low	205 Å²	205	118.7 Å²	118.7	77%	0.774	59%	0.587	S	S	*	*	H	α-helix	trans	-79.4	-31.1	174.5	-94.2	-175.1	161.5	-174.8	-3.5	114.5	S14 V16 D20	S14-R18 PolarHBondContact O-N 2.99Å; V16-R18 VanDerWaalsContact C-N 3.31Å; V16-R18 PolarHBondContact O-N 3.18Å; R18-D20 VanDerWaalsContact C-N 3.35Å
19	K	58.3	Low	68.1	Low	153 Å²	153	119.5 Å²	119.5	67%	0.665	57%	0.574	S	S	*	*	H	α-helix	trans	-75.8	-26.2	176	-84.7	-176.3	173.7	-178.9	0	112.3	H15 V16 P22	H15-K19 WeakPolarHBondContact O-CB 3.09Å; H15-K19 PolarHBondContact O-N 3.36Å; V16-K19 PolarHBondContact O-N 2.83Å; K19-P22 VanDerWaalsContact O-CD 3.31Å; K19-P22 WeakPolarHBondContact O-CD 3.46Å; K19-P22 WeakPolarHBondContact O-CG 3.37Å
20	D	63.3	Low	69.8	Low	78 Å²	78	116.3 Å²	116.3	42%	0.417	56%	0.56	S	S	.	*	H	α-helix	trans	-80.3	-18.3	177.1	-83.5	-82.2	0	0	0	113.8	V16 R18 W23 L24	V16-D20 VanDerWaalsContact CG1-OD2 3.26Å; V16-D20 WeakPolarHBondContact CG1-OD2 3.49Å; V16-D20 WeakPolarHBondContact O-CB 3.26Å; V16-D20 PolarHBondContact O-N 2.81Å; R18-D20 VanDerWaalsContact C-N 3.35Å; D20-W23 CarbonylContact O-C 3.6Å; D20-W23 PolarHBondContact O-N 3.44Å; D20-W23 VanDerWaalsContact O-N 3.16Å; D20-L24 WeakPolarHBondContact O-CB 3.33Å; D20-L24 PolarHBondContact O-N 3.41Å
21	E	68.2	Low	71.5	Confident	133 Å²	133	117.8 Å²	117.8	62%	0.621	57%	0.57	S	S	*	*	H	α-helix	trans	-53.4	-47.1	177.4	-68.9	-151.1	93.3	0	0	114.7	C17 K25	C17-E21 WeakPolarHBondContact O-CG 3.3Å; E21-K25 WeakPolarHBondContact O-CB 3.31Å; E21-K25 PolarHBondContact O-N 3.09Å
22	P	75.5	Confident	73.4	Confident	86 Å²	86	112.9 Å²	112.9	56%	0.558	56%	0.559	S	S	*	*	H	α-helix	trans	-66.8	-39.1	175.9	24.7	-34.2	0	0	0	112.7	K19 K25 L26	K19-P22 VanDerWaalsContact O-CD 3.31Å; K19-P22 WeakPolarHBondContact O-CD 3.46Å; K19-P22 WeakPolarHBondContact O-CG 3.37Å; P22-K25 PolarHBondContact O-N 3.5Å; P22-L26 PolarHBondContact O-N 3.16Å
23	W	79.1	Confident	75.3	Confident	166 Å²	166	111.8 Å²	111.8	63%	0.629	55%	0.549	S	S	*	.	H	α-helix	trans	-68.6	-42.1	178.3	-75.1	102	0	0	0	112	D20 K25 L26 I27	D20-W23 CarbonylContact O-C 3.6Å; D20-W23 PolarHBondContact O-N 3.44Å; D20-W23 VanDerWaalsContact O-N 3.16Å; W23-K25 VanDerWaalsContact C-N 3.31Å; W23-K25 PolarHBondContact O-N 3.13Å; W23-L26 HydrophobicContact CE3-CD2 4.09Å; W23-L26 HydrophobicContact CZ3-CD2 4.14Å; W23-L26 CarbonylContact O-C 3.58Å; W23-L26 WeakPolarHBondContact O-CA 3.35Å; W23-L26 WeakPolarHBondContact O-CB 3.16Å; W23-L26 PolarHBondContact O-N 3.43Å; W23-L26 VanDerWaalsContact O-N 3.09Å; W23-I27 VanDerWaalsContact O-CG1 3.31Å; W23-I27 WeakPolarHBondContact O-CG1 3.46Å; W23-I27 PolarHBondContact O-N 3.11Å
24	L	80.4	Confident	76.9	Confident	118 Å²	118	111.6 Å²	111.6	62%	0.618	55%	0.545	S	S	*	.	H	α-helix	trans	-62.4	-40.4	175.6	-169.7	71.6	0	0	0	110.9	D20 L26 I27 K28	D20-L24 WeakPolarHBondContact O-CB 3.33Å; D20-L24 PolarHBondContact O-N 3.41Å; L24-L26 VanDerWaalsContact C-N 3.32Å; L24-L26 PolarHBondContact O-N 3.45Å; L24-I27 PolarHBondContact O-N 3.05Å; L24-K28 WeakPolarHBondContact O-CB 3.47Å; L24-K28 PolarHBondContact O-N 2.9Å
25	K	84.4	Confident	78.7	Confident	135 Å²	135	114.1 Å²	114.1	59%	0.587	55%	0.554	S	S	*	*	H	α-helix	trans	-63.2	-38.6	173	-168.9	177.6	-172.4	178.7	0	111.7	E21 P22 W23 R29	E21-K25 WeakPolarHBondContact O-CB 3.31Å; E21-K25 PolarHBondContact O-N 3.09Å; P22-K25 PolarHBondContact O-N 3.5Å; W23-K25 VanDerWaalsContact C-N 3.31Å; W23-K25 PolarHBondContact O-N 3.13Å; K25-R29 WeakPolarHBondContact O-CG 3.36Å; K25-R29 PolarHBondContact O-N 3.01Å; K25-R29 VanDerWaalsContact O-N 3.16Å
26	L	87.7	Confident	80.2	Confident	85 Å²	85	115 Å²	115	45%	0.445	56%	0.561	S	S	.	*	H	α-helix	trans	-66.5	-48.4	175.3	-173	68	0	0	0	111.5	P22 W23 L24 K28 R29 L30	P22-L26 PolarHBondContact O-N 3.16Å; W23-L26 HydrophobicContact CE3-CD2 4.09Å; W23-L26 HydrophobicContact CZ3-CD2 4.14Å; W23-L26 CarbonylContact O-C 3.58Å; W23-L26 WeakPolarHBondContact O-CA 3.35Å; W23-L26 WeakPolarHBondContact O-CB 3.16Å; W23-L26 PolarHBondContact O-N 3.43Å; W23-L26 VanDerWaalsContact O-N 3.09Å; L24-L26 VanDerWaalsContact C-N 3.32Å; L24-L26 PolarHBondContact O-N 3.45Å; L26-K28 VanDerWaalsContact C-N 3.33Å; L26-K28 PolarHBondContact O-N 3.05Å; L26-R29 WeakPolarHBondContact O-CB 3.47Å; L26-R29 PolarHBondContact O-N 2.91Å; L26-R29 VanDerWaalsContact O-N 3.13Å; L26-L30 HydrophobicContact CG-CD1 4.21Å; L26-L30 WeakPolarHBondContact O-CG 3.35Å; L26-L30 PolarHBondContact O-N 2.71Å
27	I	89.7	Confident	82.1	Confident	98 Å²	98	115.1 Å²	115.1	50%	0.503	56%	0.558	S	S	.	*	H	α-helix	trans	-59.7	-44.3	178	-66.9	166.2	0	0	0	110.4	W23 L24 R29 L30 L31	W23-I27 VanDerWaalsContact O-CG1 3.31Å; W23-I27 WeakPolarHBondContact O-CG1 3.46Å; W23-I27 PolarHBondContact O-N 3.11Å; L24-I27 PolarHBondContact O-N 3.05Å; I27-R29 VanDerWaalsContact C-N 3.3Å; I27-R29 PolarHBondContact O-N 3.06Å; I27-L30 PolarHBondContact O-N 3.37Å; I27-L31 WeakPolarHBondContact O-CB 3.43Å; I27-L31 PolarHBondContact O-N 3.29Å
28	K	87.4	Confident	83.8	Confident	161 Å²	161	117.1 Å²	117.1	70%	0.7	56%	0.562	S	S	*	*	H	α-helix	trans	-61.5	-37.9	177.1	-171.6	174.1	-178.2	177.2	0	112.3	L24 L26 A32	L24-K28 WeakPolarHBondContact O-CB 3.47Å; L24-K28 PolarHBondContact O-N 2.9Å; L26-K28 VanDerWaalsContact C-N 3.33Å; L26-K28 PolarHBondContact O-N 3.05Å; K28-A32 WeakPolarHBondContact O-CB 3.24Å; K28-A32 PolarHBondContact O-N 3.08Å; K28-A32 VanDerWaalsContact O-N 3.08Å
29	R	90.6	Very high	85.3	Confident	157 Å²	157	112 Å²	112	59%	0.592	55%	0.553	S	S	*	*	H	α-helix	trans	-67.3	-46	174.2	-75.4	175.1	179	-99	-2.5	111.7	K25 L26 I27 L31 A32 I33	K25-R29 WeakPolarHBondContact O-CG 3.36Å; K25-R29 PolarHBondContact O-N 3.01Å; K25-R29 VanDerWaalsContact O-N 3.16Å; L26-R29 WeakPolarHBondContact O-CB 3.47Å; L26-R29 PolarHBondContact O-N 2.91Å; L26-R29 VanDerWaalsContact O-N 3.13Å; I27-R29 VanDerWaalsContact C-N 3.3Å; I27-R29 PolarHBondContact O-N 3.06Å; R29-L31 VanDerWaalsContact C-N 3.33Å; R29-L31 PolarHBondContact O-N 3.42Å; R29-A32 PolarHBondContact O-N 3.24Å; R29-I33 WeakPolarHBondContact O-CG1 3.31Å; R29-I33 PolarHBondContact O-N 3.38Å
30	L	92.8	Very high	87	Confident	88 Å²	88	112.8 Å²	112.8	46%	0.461	55%	0.554	S	S	.	*	H	α-helix	trans	-60.9	-42.5	177.7	-74	169.6	0	0	0	111.9	L26 I27 I33 H34	L26-L30 HydrophobicContact CG-CD1 4.21Å; L26-L30 WeakPolarHBondContact O-CG 3.35Å; L26-L30 PolarHBondContact O-N 2.71Å; I27-L30 PolarHBondContact O-N 3.37Å; L30-I33 PolarHBondContact O-N 2.89Å; L30-H34 PolarHBondContact O-N 2.98Å; L30-H34 PolarHBondContact O-ND1 3.06Å
31	L	93.1	Very high	88.3	Confident	105 Å²	105	115 Å²	115	55%	0.55	56%	0.561	S	S	.	*	H	α-helix	trans	-64	-43.4	176.9	-174	67.8	0	0	0	111.4	I27 R29 I33 H34 I35	I27-L31 WeakPolarHBondContact O-CB 3.43Å; I27-L31 PolarHBondContact O-N 3.29Å; R29-L31 VanDerWaalsContact C-N 3.33Å; R29-L31 PolarHBondContact O-N 3.42Å; L31-I33 VanDerWaalsContact C-N 3.32Å; L31-I33 PolarHBondContact O-N 3.28Å; L31-H34 PolarHBondContact O-N 2.84Å; L31-I35 HydrophobicContact CD1-CD1 4.49Å; L31-I35 HydrophobicContact CG-CD1 4.02Å; L31-I35 VanDerWaalsContact O-CG1 3.28Å; L31-I35 WeakPolarHBondContact O-CG1 3.48Å; L31-I35 PolarHBondContact O-N 3.37Å
32	A	92.1	Very high	89	Confident	60 Å²	60	111.8 Å²	111.8	50%	0.496	56%	0.564	S	S	.	*	H	α-helix	trans	-60.6	-40.7	176.5	0	0	0	0	0	112.4	K28 R29 L36	K28-A32 WeakPolarHBondContact O-CB 3.24Å; K28-A32 PolarHBondContact O-N 3.08Å; K28-A32 VanDerWaalsContact O-N 3.08Å; R29-A32 PolarHBondContact O-N 3.24Å; A32-L36 WeakPolarHBondContact O-CB 3.5Å; A32-L36 PolarHBondContact O-N 3.46Å
33	I	94.4	Very high	88.9	Confident	93 Å²	93	115.2 Å²	115.2	48%	0.477	58%	0.577	S	S	.	*	H	α-helix	trans	-66.3	-44.8	176.1	-65.1	164.3	0	0	0	110.7	R29 L30 L31 I35 L36 I37	R29-I33 WeakPolarHBondContact O-CG1 3.31Å; R29-I33 PolarHBondContact O-N 3.38Å; L30-I33 PolarHBondContact O-N 2.89Å; L31-I33 VanDerWaalsContact C-N 3.32Å; L31-I33 PolarHBondContact O-N 3.28Å; I33-I35 VanDerWaalsContact C-N 3.34Å; I33-I35 PolarHBondContact O-N 2.88Å; I33-L36 WeakPolarHBondContact O-CB 3.43Å; I33-L36 PolarHBondContact O-N 3.46Å; I33-I37 HydrophobicContact CG2-CD1 3.82Å; I33-I37 HydrophobicContact CG2-CG1 4.39Å; I33-I37 VanDerWaalsContact O-CG1 3.31Å; I33-I37 WeakPolarHBondContact O-CG1 3.31Å; I33-I37 PolarHBondContact O-N 3.01Å
34	H	93.5	Very high	88.1	Confident	114 Å²	114	114.2 Å²	114.2	53%	0.528	59%	0.59	S	S	.	*	H	α-helix	trans	-59.1	-44.2	177	-83.7	80.5	0	0	0	112.1	L30 L31 L36 I37 I38	L30-H34 PolarHBondContact O-N 2.98Å; L30-H34 PolarHBondContact O-ND1 3.06Å; L31-H34 PolarHBondContact O-N 2.84Å; H34-L36 VanDerWaalsContact C-N 3.34Å; H34-L36 PolarHBondContact O-N 2.91Å; H34-I37 PolarHBondContact O-N 3.42Å; H34-I38 VanDerWaalsContact O-CG1 3.31Å; H34-I38 WeakPolarHBondContact O-CG1 3.35Å; H34-I38 PolarHBondContact O-N 2.96Å
35	I	92.4	Very high	88.5	Confident	95 Å²	95	114.1 Å²	114.1	49%	0.487	59%	0.588	S	S	.	*	H	α-helix	trans	-61.7	-44.3	176.8	-66	165.3	0	0	0	110.4	L31 I33 I37 I38 V39	L31-I35 HydrophobicContact CD1-CD1 4.49Å; L31-I35 HydrophobicContact CG-CD1 4.02Å; L31-I35 VanDerWaalsContact O-CG1 3.28Å; L31-I35 WeakPolarHBondContact O-CG1 3.48Å; L31-I35 PolarHBondContact O-N 3.37Å; I33-I35 VanDerWaalsContact C-N 3.34Å; I33-I35 PolarHBondContact O-N 2.88Å; I35-I37 VanDerWaalsContact C-N 3.33Å; I35-I37 PolarHBondContact O-N 3.32Å; I35-I38 PolarHBondContact O-N 3.42Å; I35-V39 HydrophobicContact CG2-CG2 4.36Å; I35-V39 VanDerWaalsContact O-CG2 3.31Å; I35-V39 WeakPolarHBondContact O-CG2 3.28Å; I35-V39 PolarHBondContact O-N 3.29Å
36	L	92.4	Very high	88.7	Confident	124 Å²	124	112.9 Å²	112.9	65%	0.649	59%	0.589	S	S	*	*	H	α-helix	trans	-60.2	-41.9	177.8	-174.1	68.6	0	0	0	112.2	A32 I33 H34 V39 Y40	A32-L36 WeakPolarHBondContact O-CB 3.5Å; A32-L36 PolarHBondContact O-N 3.46Å; I33-L36 WeakPolarHBondContact O-CB 3.43Å; I33-L36 PolarHBondContact O-N 3.46Å; H34-L36 VanDerWaalsContact C-N 3.34Å; H34-L36 PolarHBondContact O-N 2.91Å; L36-V39 PolarHBondContact O-N 3.48Å; L36-Y40 VanDerWaalsContact O-CB 3.28Å; L36-Y40 WeakPolarHBondContact O-CB 3.31Å; L36-Y40 PolarHBondContact O-N 3.3Å
37	I	93.7	Very high	88.7	Confident	85 Å²	85	114.5 Å²	114.5	44%	0.436	60%	0.597	S	S	.	*	H	α-helix	trans	-64	-46.5	177.3	-67.8	167.7	0	0	0	110.6	I33 H34 I35 V39 Y40 H41	I33-I37 HydrophobicContact CG2-CD1 3.82Å; I33-I37 HydrophobicContact CG2-CG1 4.39Å; I33-I37 VanDerWaalsContact O-CG1 3.31Å; I33-I37 WeakPolarHBondContact O-CG1 3.31Å; I33-I37 PolarHBondContact O-N 3.01Å; H34-I37 PolarHBondContact O-N 3.42Å; I35-I37 VanDerWaalsContact C-N 3.33Å; I35-I37 PolarHBondContact O-N 3.32Å; I37-V39 VanDerWaalsContact C-N 3.34Å; I37-V39 PolarHBondContact O-N 2.96Å; I37-Y40 PolarHBondContact O-N 3.49Å; I37-H41 WeakPolarHBondContact O-CB 3.28Å; I37-H41 PolarHBondContact O-CD2 3.38Å; I37-H41 PolarHBondContact O-N 3.2Å
38	I	93	Very high	88.7	Confident	120 Å²	120	115.5 Å²	115.5	62%	0.615	60%	0.602	S	S	*	*	H	α-helix	trans	-62	-43.1	179.4	-67.4	165.8	0	0	0	110.7	H34 I35 H41 G42	H34-I38 VanDerWaalsContact O-CG1 3.31Å; H34-I38 WeakPolarHBondContact O-CG1 3.35Å; H34-I38 PolarHBondContact O-N 2.96Å; I35-I38 PolarHBondContact O-N 3.42Å; I38-H41 PolarHBondContact O-N 2.97Å; I38-G42 PolarHBondContact O-N 3.27Å
39	V	90.5	Very high	88.7	Confident	97 Å²	97	112.6 Å²	112.6	59%	0.588	60%	0.596	S	S	*	*	H	α-helix	trans	-64.7	-43.5	177.1	172.3	0	0	0	0	110.9	I35 L36 I37 H41 G42 D43	I35-V39 HydrophobicContact CG2-CG2 4.36Å; I35-V39 VanDerWaalsContact O-CG2 3.31Å; I35-V39 WeakPolarHBondContact O-CG2 3.28Å; I35-V39 PolarHBondContact O-N 3.29Å; L36-V39 PolarHBondContact O-N 3.48Å; I37-V39 VanDerWaalsContact C-N 3.34Å; I37-V39 PolarHBondContact O-N 2.96Å; V39-H41 PolarHBondContact O-N 2.95Å; V39-G42 PolarHBondContact O-N 2.95Å; V39-D43 PolarHBondContact O-N 3.5Å
40	Y	93.2	Very high	88.6	Confident	170 Å²	170	109.7 Å²	109.7	67%	0.667	60%	0.596	S	S	*	*	H	α-helix	trans	-62.7	-42.1	177.6	-176.1	-100.6	0	0	0	112.4	L36 I37 G42	L36-Y40 VanDerWaalsContact O-CB 3.28Å; L36-Y40 WeakPolarHBondContact O-CB 3.31Å; L36-Y40 PolarHBondContact O-N 3.3Å; I37-Y40 PolarHBondContact O-N 3.49Å; Y40-G42 VanDerWaalsContact C-N 3.34Å
41	H	89.5	Confident	88.3	Confident	126 Å²	126	111.2 Å²	111.2	58%	0.583	61%	0.606	S	S	*	*	H	α-helix	trans	-73.8	-21.2	176.6	-88.5	-82.8	0	0	0	114.2	I37 I38 V39 T44	I37-H41 WeakPolarHBondContact O-CB 3.28Å; I37-H41 PolarHBondContact O-CD2 3.38Å; I37-H41 PolarHBondContact O-N 3.2Å; I38-H41 PolarHBondContact O-N 2.97Å; V39-H41 PolarHBondContact O-N 2.95Å; H41-T44 WeakPolarHBondContact CA-OG1 3.48Å; H41-T44 PolarHBondContact O-OG1 3.46Å
42	G	83.6	Confident	88	Confident	65 Å²	65	111.7 Å²	111.7	67%	0.67	61%	0.61	S	S	*	*	H	α-helix	trans	-83.3	-16.2	178.8	0	0	0	0	0	114.2	I38 V39 Y40	I38-G42 PolarHBondContact O-N 3.27Å; V39-G42 PolarHBondContact O-N 2.95Å; Y40-G42 VanDerWaalsContact C-N 3.34Å
43	D	74.4	Confident	87.6	Confident	157 Å²	157	116 Å²	116	84%	0.84	62%	0.62	S	S	*	*	H	α-helix	trans	-91.2	-23.3	176.9	-160.3	-109.6	0	0	0	112.4	V39	V39-D43 PolarHBondContact O-N 3.5Å
44	T	60.9	Low	87	Confident	146 Å²	146	118.1 Å²	118.1	90%	0.896	63%	0.633	S	S	*	*			trans	-77.8	0	165.6	45.6	0	0	0	0	112.3	H41	H41-T44 WeakPolarHBondContact CA-OG1 3.48Å; H41-T44 PolarHBondContact O-OG1 3.46Å

Retrieved 44 of 44 residues in 15 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).