A0A913KWL1_SCHMA Loading...

Uncharacterized protein AlphaSync

AlphaFold DB , UniProt , Accession A0A913KWL1, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 60 aa.

						>A0A913KWL1_SCHMA|A0A913KWL1
MMSEYSIEICSKLIPYFTSDVRLMDAHINMKYEFIEEFYIEFFKNEFLSKILEVKSNDGN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59.9	Low	80.2	Confident	247 Å²	247	106.5 Å²	106.5	100%	1.217	55%	0.547	S	S	*	.				0	122	0	-133.1	171.6	-178.3	0	0	107
2	M	72.8	Confident	80.4	Confident	105 Å²	105	110.1 Å²	110.1	52%	0.517	56%	0.556	S	S	.	*			trans	-70.3	149.7	175.6	-101	171.6	54.2	0	0	110.2	S6 I7 C10	M2-S6 VanDerWaalsContact CE-C 3.4Å; M2-S6 WeakPolarHBondContact CE-O 3.35Å; M2-I7 HydrophobicContact CB-CG1 4.04Å; M2-I7 HydrophobicContact CE-CB 4.32Å; M2-I7 HydrophobicContact CE-CG1 3.74Å; M2-C10 HydrophobicContact CE-CB 4.37Å
3	S	86.9	Confident	80.3	Confident	68 Å²	68	111.9 Å²	111.9	48%	0.476	57%	0.567	S	S	.	*			trans	-72.4	151.7	172.5	66.4	0	0	0	0	110.7	Y5 S6 I7	S3-Y5 PolarHBondContact O-N 3.49Å; S3-S6 PolarHBondContact N-OG 3.18Å; S3-S6 PolarHBondContact O-N 3.45Å; S3-S6 PolarHBondContact O-OG 3.44Å; S3-S6 PolarHBondContact OG-N 2.96Å; S3-S6 PolarHBondContact OG-OG 3.49Å; S3-I7 PolarHBondContact O-N 2.71Å
4	E	86.1	Confident	79.7	Confident	175 Å²	175	111.1 Å²	111.1	82%	0.818	56%	0.563	S	S	*	*	H	α-helix	trans	-53.1	-40.8	175.8	-80.1	-179.7	149.9	0	0	112.3	S6 I7 E8	E4-S6 VanDerWaalsContact C-N 3.31Å; E4-S6 PolarHBondContact O-N 3.19Å; E4-I7 WeakPolarHBondContact O-CB 3.38Å; E4-I7 PolarHBondContact O-N 3.44Å; E4-E8 PolarHBondContact O-N 2.91Å
5	Y	85.6	Confident	79.2	Confident	165 Å²	165	107.9 Å²	107.9	65%	0.647	55%	0.553	S	S	*	*	H	α-helix	trans	-58.1	-42.2	176	179.9	-106.2	0	0	0	113	S3 E8 I9	S3-Y5 PolarHBondContact O-N 3.49Å; Y5-E8 PolarHBondContact O-N 2.9Å; Y5-I9 HydrophobicContact CD1-CD1 4.02Å; Y5-I9 HydrophobicContact CE1-CD1 3.33Å; Y5-I9 HydrophobicContact CE1-CG1 4.34Å; Y5-I9 HydrophobicContact CE2-CD1 4.07Å; Y5-I9 HydrophobicContact CE2-CG1 4.48Å; Y5-I9 PolarHBondContact O-N 3.41Å; Y5-I9 WeakPolarHBondContact OH-CD1 3.38Å
6	S	83	Confident	78.4	Confident	35 Å²	35	109.1 Å²	109.1	25%	0.245	55%	0.55	C	S	.	*	H	α-helix	trans	-72.3	-34.3	178.9	44.8	0	0	0	0	111.7	M2 S3 E4 E8 I9 C10	M2-S6 VanDerWaalsContact CE-C 3.4Å; M2-S6 WeakPolarHBondContact CE-O 3.35Å; S3-S6 PolarHBondContact N-OG 3.18Å; S3-S6 PolarHBondContact O-N 3.45Å; S3-S6 PolarHBondContact O-OG 3.44Å; S3-S6 PolarHBondContact OG-N 2.96Å; S3-S6 PolarHBondContact OG-OG 3.49Å; E4-S6 VanDerWaalsContact C-N 3.31Å; E4-S6 PolarHBondContact O-N 3.19Å; S6-E8 VanDerWaalsContact C-N 3.34Å; S6-I9 PolarHBondContact O-N 3.01Å; S6-C10 WeakPolarHBondContact O-CB 3.48Å; S6-C10 PolarHBondContact O-N 2.8Å; S6-C10 PolarHBondContact O-SG 3.48Å
7	I	83	Confident	77.8	Confident	85 Å²	85	112.6 Å²	112.6	44%	0.436	56%	0.561	S	S	.	*	H	α-helix	trans	-61.6	-43.9	171.5	-64.4	170.4	0	0	0	110.7	M2 S3 E4 C10 S11	M2-I7 HydrophobicContact CB-CG1 4.04Å; M2-I7 HydrophobicContact CE-CB 4.32Å; M2-I7 HydrophobicContact CE-CG1 3.74Å; S3-I7 PolarHBondContact O-N 2.71Å; E4-I7 WeakPolarHBondContact O-CB 3.38Å; E4-I7 PolarHBondContact O-N 3.44Å; I7-C10 PolarHBondContact O-N 3.06Å; I7-S11 WeakPolarHBondContact O-CB 3.4Å; I7-S11 PolarHBondContact O-N 3.32Å; I7-S11 PolarHBondContact O-OG 3.23Å
8	E	85.5	Confident	78.1	Confident	101 Å²	101	109.3 Å²	109.3	47%	0.472	55%	0.548	S	S	.	.	H	α-helix	trans	-64.4	-44.8	-179.8	-160.2	-164.1	155.5	0	0	111.6	E4 Y5 S6 S11 K12	E4-E8 PolarHBondContact O-N 2.91Å; Y5-E8 PolarHBondContact O-N 2.9Å; S6-E8 VanDerWaalsContact C-N 3.34Å; E8-S11 PolarHBondContact O-N 3.01Å; E8-K12 PolarHBondContact O-N 3.45Å; E8-K12 WeakPolarHBondContact OE1-CE 3.43Å; E8-K12 IonicContact OE1-NZ 2.73Å; E8-K12 PolarHBondContact OE1-NZ 3.46Å
9	I	85.2	Confident	78.4	Confident	65 Å²	65	107.7 Å²	107.7	33%	0.333	55%	0.548	S	S	.	.	H	α-helix	trans	-61.5	-48.7	175.3	-74.5	-175.9	0	0	0	111.1	Y5 S6 S11 K12 L13	Y5-I9 HydrophobicContact CD1-CD1 4.02Å; Y5-I9 HydrophobicContact CE1-CD1 3.33Å; Y5-I9 HydrophobicContact CE1-CG1 4.34Å; Y5-I9 HydrophobicContact CE2-CD1 4.07Å; Y5-I9 HydrophobicContact CE2-CG1 4.48Å; Y5-I9 PolarHBondContact O-N 3.41Å; Y5-I9 WeakPolarHBondContact OH-CD1 3.38Å; S6-I9 PolarHBondContact O-N 3.01Å; I9-S11 VanDerWaalsContact C-N 3.27Å; I9-S11 PolarHBondContact O-N 3.31Å; I9-K12 PolarHBondContact O-N 3Å; I9-K12 VanDerWaalsContact O-N 3.14Å; I9-L13 HydrophobicContact CG2-CD1 3.64Å; I9-L13 HydrophobicContact CG2-CG 4.25Å; I9-L13 WeakPolarHBondContact O-CG 3.38Å; I9-L13 PolarHBondContact O-N 3.32Å
10	C	78.4	Confident	78.7	Confident	61 Å²	61	107.9 Å²	107.9	41%	0.412	55%	0.55	S	S	.	*	H	α-helix	trans	-59.3	-41.9	179.3	-74.6	0	0	0	0	111.2	M2 S6 I7 K12 L13 I14	M2-C10 HydrophobicContact CE-CB 4.37Å; S6-C10 WeakPolarHBondContact O-CB 3.48Å; S6-C10 PolarHBondContact O-N 2.8Å; S6-C10 PolarHBondContact O-SG 3.48Å; I7-C10 PolarHBondContact O-N 3.06Å; C10-K12 VanDerWaalsContact C-N 3.29Å; C10-K12 PolarHBondContact O-N 2.92Å; C10-L13 PolarHBondContact O-N 3.48Å; C10-I14 CarbonylContact O-C 3.57Å; C10-I14 PolarHBondContact O-N 2.97Å
11	S	76	Confident	79	Confident	64 Å²	64	103.5 Å²	103.5	45%	0.448	53%	0.529	S	S	.	.	H	α-helix	trans	-64.9	-31.9	178.3	-59.5	0	0	0	0	112.9	I7 E8 I9 P15	I7-S11 WeakPolarHBondContact O-CB 3.4Å; I7-S11 PolarHBondContact O-N 3.32Å; I7-S11 PolarHBondContact O-OG 3.23Å; E8-S11 PolarHBondContact O-N 3.01Å; I9-S11 VanDerWaalsContact C-N 3.27Å; I9-S11 PolarHBondContact O-N 3.31Å; S11-P15 WeakPolarHBondContact O-CA 3.43Å
12	K	82.7	Confident	80.2	Confident	150 Å²	150	98.3 Å²	98.3	65%	0.652	50%	0.496	S	S	*	.	H	α-helix	trans	-74.4	-42.4	174	-76.3	177.3	-174	162.6	0	112.5	E8 I9 C10	E8-K12 PolarHBondContact O-N 3.45Å; E8-K12 WeakPolarHBondContact OE1-CE 3.43Å; E8-K12 IonicContact OE1-NZ 2.73Å; E8-K12 PolarHBondContact OE1-NZ 3.46Å; I9-K12 PolarHBondContact O-N 3Å; I9-K12 VanDerWaalsContact O-N 3.14Å; C10-K12 VanDerWaalsContact C-N 3.29Å; C10-K12 PolarHBondContact O-N 2.92Å
13	L	79.3	Confident	80.9	Confident	134 Å²	134	98.5 Å²	98.5	70%	0.702	50%	0.498	S	S	*	.	H	α-helix	trans	-74.9	-40.9	-176.7	-71.7	174.4	0	0	0	112.6	I9 C10	I9-L13 HydrophobicContact CG2-CD1 3.64Å; I9-L13 HydrophobicContact CG2-CG 4.25Å; I9-L13 WeakPolarHBondContact O-CG 3.38Å; I9-L13 PolarHBondContact O-N 3.32Å; C10-L13 PolarHBondContact O-N 3.48Å
14	I	71.4	Confident	81	Confident	100 Å²	100	100.6 Å²	100.6	51%	0.513	50%	0.502	S	S	.	.	S	Bend	trans	-126.9	90.4	179.9	-62.6	163.1	0	0	0	105.8	C10 Y16 V21	C10-I14 CarbonylContact O-C 3.57Å; C10-I14 PolarHBondContact O-N 2.97Å; I14-Y16 PolarHBondContact O-N 2.9Å; I14-V21 HydrophobicContact CG2-CB 4.48Å; I14-V21 HydrophobicContact CG2-CG1 4.29Å; I14-V21 HydrophobicContact CG2-CG2 3.36Å
15	P	71.8	Confident	81	Confident	64 Å²	64	94.9 Å²	94.9	42%	0.416	48%	0.477	S	S	.	.			trans	-65	110.2	178.8	-8.3	21	0	0	0	107.8	S11 F17 T18	S11-P15 WeakPolarHBondContact O-CA 3.43Å; P15-F17 PolarHBondContact O-N 3.24Å; P15-T18 HydrophobicContact CB-CG2 4.07Å; P15-T18 HydrophobicContact CG-CG2 4.15Å; P15-T18 WeakPolarHBondContact O-CB 3.28Å; P15-T18 WeakPolarHBondContact O-CG2 3.48Å; P15-T18 PolarHBondContact O-N 3.45Å; P15-T18 PolarHBondContact O-OG1 3.05Å
16	Y	66.4	Low	81.1	Confident	127 Å²	127	89.6 Å²	89.6	50%	0.498	47%	0.468	S	S	.	.	T	Hydrogen-bonded Turn	trans	-59.3	-17.3	-177.2	-147.6	-92.3	0	0	0	112.7	I14 V21 R22 D25	I14-Y16 PolarHBondContact O-N 2.9Å; Y16-V21 HydrophobicContact CD2-CG1 3.85Å; Y16-V21 HydrophobicContact CE2-CG1 4.14Å; Y16-V21 HydrophobicContact CG-CG1 4.1Å; Y16-R22 WeakPolarHBondContact O-CG 3.41Å; Y16-D25 VanDerWaalsContact OH-CG 3.27Å; Y16-D25 PolarHBondContact OH-OD1 2.69Å
17	F	69.2	Low	81.4	Confident	169 Å²	169	94.5 Å²	94.5	74%	0.741	49%	0.486	S	S	*	.	T	Hydrogen-bonded Turn	trans	-85.6	0	177.3	-68.6	-87.6	0	0	0	114.5	P15	P15-F17 PolarHBondContact O-N 3.24Å
18	T	82.2	Confident	81.7	Confident	53 Å²	53	94.6 Å²	94.6	33%	0.325	49%	0.487	S	S	.	.	S	Bend	trans	-70.3	146.7	169.9	54.8	0	0	0	0	110.5	P15 D20 V21 R22	P15-T18 HydrophobicContact CB-CG2 4.07Å; P15-T18 HydrophobicContact CG-CG2 4.15Å; P15-T18 WeakPolarHBondContact O-CB 3.28Å; P15-T18 WeakPolarHBondContact O-CG2 3.48Å; P15-T18 PolarHBondContact O-N 3.45Å; P15-T18 PolarHBondContact O-OG1 3.05Å; T18-D20 PolarHBondContact O-N 3Å; T18-V21 PolarHBondContact O-N 3.44Å; T18-V21 WeakPolarHBondContact OG1-CG2 3.48Å; T18-R22 PolarHBondContact O-N 3.09Å
19	S	85	Confident	81.8	Confident	78 Å²	78	93.3 Å²	93.3	55%	0.545	48%	0.483	S	S	.	.	H	α-helix	trans	-53.2	-42.3	177.1	47.6	0	0	0	0	111.8	R22 L23	S19-R22 PolarHBondContact O-N 3.37Å; S19-L23 WeakPolarHBondContact O-CB 3.29Å; S19-L23 WeakPolarHBondContact O-CG 3.28Å; S19-L23 PolarHBondContact O-N 2.87Å
20	D	83.9	Confident	82	Confident	111 Å²	111	96.3 Å²	96.3	59%	0.594	50%	0.497	S	S	*	.	H	α-helix	trans	-70.4	-40.9	-170.9	-56.5	-13.4	0	0	0	111.1	T18 L23 M24	T18-D20 PolarHBondContact O-N 3Å; D20-L23 PolarHBondContact O-N 3.43Å; D20-M24 WeakPolarHBondContact O-CG 3.49Å; D20-M24 PolarHBondContact O-N 3.45Å
21	V	84.3	Confident	82.4	Confident	17 Å²	17	100.3 Å²	100.3	10%	0.103	51%	0.507	C	S	.	.	H	α-helix	trans	-65.2	-41.6	176.5	177.4	0	0	0	0	111	I14 Y16 T18 L23 M24 D25	I14-V21 HydrophobicContact CG2-CB 4.48Å; I14-V21 HydrophobicContact CG2-CG1 4.29Å; I14-V21 HydrophobicContact CG2-CG2 3.36Å; Y16-V21 HydrophobicContact CD2-CG1 3.85Å; Y16-V21 HydrophobicContact CE2-CG1 4.14Å; Y16-V21 HydrophobicContact CG-CG1 4.1Å; T18-V21 PolarHBondContact O-N 3.44Å; T18-V21 WeakPolarHBondContact OG1-CG2 3.48Å; V21-L23 PolarHBondContact O-N 2.89Å; V21-M24 HydrophobicContact CG2-CE 4.46Å; V21-M24 PolarHBondContact O-N 3.01Å; V21-D25 WeakPolarHBondContact O-CB 3.46Å; V21-D25 PolarHBondContact O-N 3.25Å
22	R	85.2	Confident	82.9	Confident	138 Å²	138	104.9 Å²	104.9	52%	0.521	52%	0.516	S	S	.	.	H	α-helix	trans	-63.9	-39.9	176.1	-70.8	177.1	168.5	-157.7	-6.6	112.5	Y16 T18 S19 D25 A26	Y16-R22 WeakPolarHBondContact O-CG 3.41Å; T18-R22 PolarHBondContact O-N 3.09Å; S19-R22 PolarHBondContact O-N 3.37Å; R22-D25 PolarHBondContact O-N 2.93Å; R22-A26 WeakPolarHBondContact O-CB 3.32Å; R22-A26 PolarHBondContact O-N 2.92Å
23	L	89	Confident	83.1	Confident	108 Å²	108	103.5 Å²	103.5	57%	0.565	51%	0.512	S	S	*	.	H	α-helix	trans	-67.1	-41.1	176.6	-75.5	170.1	0	0	0	111.8	S19 D20 V21 H27	S19-L23 WeakPolarHBondContact O-CB 3.29Å; S19-L23 WeakPolarHBondContact O-CG 3.28Å; S19-L23 PolarHBondContact O-N 2.87Å; D20-L23 PolarHBondContact O-N 3.43Å; V21-L23 PolarHBondContact O-N 2.89Å; L23-H27 WeakPolarHBondContact O-CB 3.25Å; L23-H27 PolarHBondContact O-N 3.36Å
24	M	87.7	Confident	83.5	Confident	113 Å²	113	103.4 Å²	103.4	56%	0.557	51%	0.506	S	S	*	.	H	α-helix	trans	-62	-45.5	173.7	-73	-167.9	-43.9	0	0	111.6	D20 V21 H27 I28	D20-M24 WeakPolarHBondContact O-CG 3.49Å; D20-M24 PolarHBondContact O-N 3.45Å; V21-M24 HydrophobicContact CG2-CE 4.46Å; V21-M24 PolarHBondContact O-N 3.01Å; M24-H27 PolarHBondContact O-N 3.44Å; M24-I28 WeakPolarHBondContact O-CB 3.41Å; M24-I28 VanDerWaalsContact O-CG1 3.26Å; M24-I28 WeakPolarHBondContact O-CG1 3.19Å; M24-I28 PolarHBondContact O-N 2.97Å
25	D	86.5	Confident	84.3	Confident	55 Å²	55	101.6 Å²	101.6	29%	0.294	50%	0.497	S	S	.	.	H	α-helix	trans	-61.7	-45.3	178.9	-165.4	68.3	0	0	0	111.5	Y16 V21 R22 H27 I28 N29	Y16-D25 VanDerWaalsContact OH-CG 3.27Å; Y16-D25 PolarHBondContact OH-OD1 2.69Å; V21-D25 WeakPolarHBondContact O-CB 3.46Å; V21-D25 PolarHBondContact O-N 3.25Å; R22-D25 PolarHBondContact O-N 2.93Å; D25-H27 PolarHBondContact O-N 3.3Å; D25-I28 PolarHBondContact O-N 3.49Å; D25-N29 WeakPolarHBondContact O-CB 3.48Å; D25-N29 VanDerWaalsContact O-CG 3.31Å; D25-N29 PolarHBondContact O-N 2.73Å; D25-N29 PolarHBondContact O-ND2 2.93Å; D25-N29 PolarHBondContact OD2-ND2 3.48Å
26	A	88.3	Confident	85.1	Confident	54 Å²	54	104.7 Å²	104.7	45%	0.446	51%	0.506	S	S	.	.	H	α-helix	trans	-60.2	-42.8	174.6	0	0	0	0	0	112.6	R22 N29 M30	R22-A26 WeakPolarHBondContact O-CB 3.32Å; R22-A26 PolarHBondContact O-N 2.92Å; A26-N29 PolarHBondContact O-N 3.38Å; A26-M30 VanDerWaalsContact O-CB 3.31Å; A26-M30 WeakPolarHBondContact O-CB 3.14Å; A26-M30 PolarHBondContact O-N 3.26Å
27	H	89.3	Confident	86.2	Confident	137 Å²	137	105 Å²	105	63%	0.634	51%	0.512	S	S	*	.	H	α-helix	trans	-64.8	-39.5	175.5	-88.1	162.2	0	0	0	112.8	L23 M24 D25 K31	L23-H27 WeakPolarHBondContact O-CB 3.25Å; L23-H27 PolarHBondContact O-N 3.36Å; M24-H27 PolarHBondContact O-N 3.44Å; D25-H27 PolarHBondContact O-N 3.3Å; H27-K31 VanDerWaalsContact O-CB 3.3Å; H27-K31 WeakPolarHBondContact O-CB 3.35Å; H27-K31 PolarHBondContact O-N 3.42Å
28	I	88.4	Confident	87.2	Confident	87 Å²	87	102.7 Å²	102.7	45%	0.446	50%	0.502	S	S	.	.	H	α-helix	trans	-63.5	-50.1	176.7	-71.8	167.4	0	0	0	109.4	M24 D25 K31 Y32	M24-I28 WeakPolarHBondContact O-CB 3.41Å; M24-I28 VanDerWaalsContact O-CG1 3.26Å; M24-I28 WeakPolarHBondContact O-CG1 3.19Å; M24-I28 PolarHBondContact O-N 2.97Å; D25-I28 PolarHBondContact O-N 3.49Å; I28-K31 PolarHBondContact O-N 3.41Å; I28-Y32 HydrophobicContact CG2-CD2 3.63Å; I28-Y32 HydrophobicContact CG2-CE2 3.57Å; I28-Y32 VanDerWaalsContact O-CD2 3.23Å; I28-Y32 WeakPolarHBondContact O-CD2 3.31Å; I28-Y32 PolarHBondContact O-N 2.97Å
29	N	87.5	Confident	87.6	Confident	74 Å²	74	106.5 Å²	106.5	40%	0.396	51%	0.511	S	S	.	.	H	α-helix	trans	-61.2	-47.7	180	-68.7	-26.8	0	0	0	111.7	D25 A26 K31 Y32 E33	D25-N29 WeakPolarHBondContact O-CB 3.48Å; D25-N29 VanDerWaalsContact O-CG 3.31Å; D25-N29 PolarHBondContact O-N 2.73Å; D25-N29 PolarHBondContact O-ND2 2.93Å; D25-N29 PolarHBondContact OD2-ND2 3.48Å; A26-N29 PolarHBondContact O-N 3.38Å; N29-K31 VanDerWaalsContact C-N 3.27Å; N29-K31 PolarHBondContact O-N 2.9Å; N29-Y32 PolarHBondContact O-N 3.09Å; N29-Y32 VanDerWaalsContact O-N 3.09Å; N29-E33 WeakPolarHBondContact O-CG 3.48Å; N29-E33 PolarHBondContact O-N 3.2Å
30	M	90	Very high	87.8	Confident	129 Å²	129	106.7 Å²	106.7	64%	0.635	51%	0.505	S	S	*	.	H	α-helix	trans	-58.6	-39.4	176.4	-179.7	-178.1	-100.4	0	0	112	A26 F34	A26-M30 VanDerWaalsContact O-CB 3.31Å; A26-M30 WeakPolarHBondContact O-CB 3.14Å; A26-M30 PolarHBondContact O-N 3.26Å; M30-F34 VanDerWaalsContact O-CB 3.29Å; M30-F34 WeakPolarHBondContact O-CB 3.33Å; M30-F34 PolarHBondContact O-N 2.89Å
31	K	86.2	Confident	88.2	Confident	144 Å²	144	105.7 Å²	105.7	63%	0.626	50%	0.497	S	S	*	.	H	α-helix	trans	-66.8	-39.8	177.2	-173.1	176.9	179.2	-179.1	0	111.6	H27 I28 N29 I35	H27-K31 VanDerWaalsContact O-CB 3.3Å; H27-K31 WeakPolarHBondContact O-CB 3.35Å; H27-K31 PolarHBondContact O-N 3.42Å; I28-K31 PolarHBondContact O-N 3.41Å; N29-K31 VanDerWaalsContact C-N 3.27Å; N29-K31 PolarHBondContact O-N 2.9Å; K31-I35 HydrophobicContact CG-CD1 3.92Å; K31-I35 WeakPolarHBondContact O-CB 3.3Å; K31-I35 WeakPolarHBondContact O-CD1 3.49Å; K31-I35 WeakPolarHBondContact O-CG1 3.17Å; K31-I35 PolarHBondContact O-N 3.02Å
32	Y	85.8	Confident	88.6	Confident	160 Å²	160	110.2 Å²	110.2	63%	0.627	52%	0.515	S	S	*	.	H	α-helix	trans	-68	-44.6	176.6	-84.4	-70.3	0	0	0	112.2	I28 N29 F34 I35 E36	I28-Y32 HydrophobicContact CG2-CD2 3.63Å; I28-Y32 HydrophobicContact CG2-CE2 3.57Å; I28-Y32 VanDerWaalsContact O-CD2 3.23Å; I28-Y32 WeakPolarHBondContact O-CD2 3.31Å; I28-Y32 PolarHBondContact O-N 2.97Å; N29-Y32 PolarHBondContact O-N 3.09Å; N29-Y32 VanDerWaalsContact O-N 3.09Å; Y32-F34 PolarHBondContact O-N 3Å; Y32-I35 PolarHBondContact O-N 3.29Å; Y32-E36 WeakPolarHBondContact O-CB 3.43Å; Y32-E36 PolarHBondContact O-N 2.96Å
33	E	87.4	Confident	89	Confident	121 Å²	121	109.6 Å²	109.6	57%	0.565	52%	0.517	S	S	*	.	H	α-helix	trans	-58.1	-47.9	174.6	-73.4	175.8	172.7	0	0	111	N29 I35 E36 E37	N29-E33 WeakPolarHBondContact O-CG 3.48Å; N29-E33 PolarHBondContact O-N 3.2Å; E33-I35 VanDerWaalsContact C-N 3.33Å; E33-I35 PolarHBondContact O-N 3.02Å; E33-E36 PolarHBondContact O-N 2.85Å; E33-E37 WeakPolarHBondContact O-CG 3.5Å; E33-E37 PolarHBondContact O-N 3.21Å
34	F	88.5	Confident	89.1	Confident	133 Å²	133	109.4 Å²	109.4	58%	0.583	51%	0.511	S	S	*	.	H	α-helix	trans	-60.6	-41.7	176.9	179.2	-95.9	0	0	0	112.5	M30 Y32 F38	M30-F34 VanDerWaalsContact O-CB 3.29Å; M30-F34 WeakPolarHBondContact O-CB 3.33Å; M30-F34 PolarHBondContact O-N 2.89Å; Y32-F34 PolarHBondContact O-N 3Å; F34-F38 VanDerWaalsContact O-CB 3.25Å; F34-F38 WeakPolarHBondContact O-CB 3.26Å; F34-F38 PolarHBondContact O-N 3.23Å
35	I	87.5	Confident	89.4	Confident	62 Å²	62	108.5 Å²	108.5	32%	0.318	51%	0.509	S	S	.	.	H	α-helix	trans	-65.1	-43.1	177.3	-75.1	169.4	0	0	0	110.4	K31 Y32 E33 F38 Y39	K31-I35 HydrophobicContact CG-CD1 3.92Å; K31-I35 WeakPolarHBondContact O-CB 3.3Å; K31-I35 WeakPolarHBondContact O-CD1 3.49Å; K31-I35 WeakPolarHBondContact O-CG1 3.17Å; K31-I35 PolarHBondContact O-N 3.02Å; Y32-I35 PolarHBondContact O-N 3.29Å; E33-I35 VanDerWaalsContact C-N 3.33Å; E33-I35 PolarHBondContact O-N 3.02Å; I35-F38 PolarHBondContact O-N 3.38Å; I35-Y39 HydrophobicContact CG2-CD2 3.48Å; I35-Y39 VanDerWaalsContact CG2-CD2 3.48Å; I35-Y39 HydrophobicContact CG2-CE2 3.42Å; I35-Y39 VanDerWaalsContact CG2-CE2 3.42Å; I35-Y39 WeakPolarHBondContact O-CD2 3.47Å; I35-Y39 PolarHBondContact O-N 2.91Å
36	E	88.5	Confident	89.8	Confident	128 Å²	128	109.1 Å²	109.1	60%	0.598	51%	0.51	S	S	*	.	H	α-helix	trans	-61.1	-49.4	177.5	-174.9	174.7	-165	0	0	111.3	Y32 E33 F38 Y39 I40	Y32-E36 WeakPolarHBondContact O-CB 3.43Å; Y32-E36 PolarHBondContact O-N 2.96Å; E33-E36 PolarHBondContact O-N 2.85Å; E36-F38 VanDerWaalsContact C-N 3.35Å; E36-F38 PolarHBondContact O-N 3.48Å; E36-Y39 PolarHBondContact O-N 2.96Å; E36-I40 HydrophobicContact CG-CD1 4.12Å; E36-I40 WeakPolarHBondContact O-CG1 3.48Å; E36-I40 PolarHBondContact O-N 3.43Å
37	E	89.4	Confident	90	Very high	133 Å²	133	112.9 Å²	112.9	62%	0.621	52%	0.516	S	S	*	.	H	α-helix	trans	-59	-44.9	175.4	-73.2	-175.9	171.7	0	0	112	E33 Y39 I40 E41	E33-E37 WeakPolarHBondContact O-CG 3.5Å; E33-E37 PolarHBondContact O-N 3.21Å; E37-Y39 PolarHBondContact O-N 2.89Å; E37-I40 PolarHBondContact O-N 3.26Å; E37-E41 PolarHBondContact O-N 3.18Å
38	F	90.5	Very high	90.2	Very high	121 Å²	121	111 Å²	111	53%	0.531	51%	0.51	S	S	.	.	H	α-helix	trans	-60.3	-45.4	177.1	178.3	-94.3	0	0	0	111.8	F34 I35 E36 E41 F42	F34-F38 VanDerWaalsContact O-CB 3.25Å; F34-F38 WeakPolarHBondContact O-CB 3.26Å; F34-F38 PolarHBondContact O-N 3.23Å; I35-F38 PolarHBondContact O-N 3.38Å; E36-F38 VanDerWaalsContact C-N 3.35Å; E36-F38 PolarHBondContact O-N 3.48Å; F38-E41 PolarHBondContact O-N 2.87Å; F38-F42 VanDerWaalsContact O-CB 3.28Å; F38-F42 WeakPolarHBondContact O-CB 3.48Å; F38-F42 PolarHBondContact O-N 3.27Å
39	Y	89.8	Confident	90.4	Very high	133 Å²	133	110.2 Å²	110.2	52%	0.522	51%	0.513	S	S	.	.	H	α-helix	trans	-62.8	-42.8	177.4	-88	-65	0	0	0	111.7	I35 E36 E37 E41 F42 F43	I35-Y39 HydrophobicContact CG2-CD2 3.48Å; I35-Y39 VanDerWaalsContact CG2-CD2 3.48Å; I35-Y39 HydrophobicContact CG2-CE2 3.42Å; I35-Y39 VanDerWaalsContact CG2-CE2 3.42Å; I35-Y39 WeakPolarHBondContact O-CD2 3.47Å; I35-Y39 PolarHBondContact O-N 2.91Å; E36-Y39 PolarHBondContact O-N 2.96Å; E37-Y39 PolarHBondContact O-N 2.89Å; Y39-E41 PolarHBondContact O-N 3.22Å; Y39-F42 PolarHBondContact O-N 3.36Å; Y39-F43 HydrophobicContact CD1-CE2 4.25Å; Y39-F43 WeakPolarHBondContact O-CB 3.23Å; Y39-F43 WeakPolarHBondContact O-CD2 3.38Å; Y39-F43 PolarHBondContact O-N 3.27Å
40	I	90.8	Very high	90.7	Very high	82 Å²	82	112 Å²	112	42%	0.421	52%	0.517	S	S	.	.	H	α-helix	trans	-58.9	-49	177.5	-71.1	167.4	0	0	0	110.7	E36 E37 F43 K44	E36-I40 HydrophobicContact CG-CD1 4.12Å; E36-I40 WeakPolarHBondContact O-CG1 3.48Å; E36-I40 PolarHBondContact O-N 3.43Å; E37-I40 PolarHBondContact O-N 3.26Å; I40-F43 PolarHBondContact O-N 2.93Å; I40-K44 HydrophobicContact CG2-CD 4.38Å; I40-K44 WeakPolarHBondContact O-CG 3.5Å; I40-K44 PolarHBondContact O-N 2.94Å
41	E	91.8	Very high	90.8	Very high	91 Å²	91	109 Å²	109	43%	0.425	50%	0.503	S	S	.	.	H	α-helix	trans	-70.2	-35	-179.9	-73.9	-51.1	145.1	0	0	113.2	E37 F38 Y39 K44 N45	E37-E41 PolarHBondContact O-N 3.18Å; F38-E41 PolarHBondContact O-N 2.87Å; Y39-E41 PolarHBondContact O-N 3.22Å; E41-K44 PolarHBondContact O-N 3.46Å; E41-K44 IonicContact OE1-NZ 2.69Å; E41-K44 PolarHBondContact OE1-NZ 2.89Å; E41-K44 WeakPolarHBondContact OE2-CD 3.46Å; E41-N45 WeakPolarHBondContact O-CB 3.38Å; E41-N45 PolarHBondContact O-N 2.96Å; E41-N45 PolarHBondContact O-ND2 3.25Å
42	F	93.2	Very high	91.1	Very high	111 Å²	111	107.2 Å²	107.2	49%	0.487	50%	0.499	S	S	.	.	H	α-helix	trans	-59.4	-49.5	172.2	-178.6	-92.5	0	0	0	111.2	F38 Y39 K44 N45 E46	F38-F42 VanDerWaalsContact O-CB 3.28Å; F38-F42 WeakPolarHBondContact O-CB 3.48Å; F38-F42 PolarHBondContact O-N 3.27Å; Y39-F42 PolarHBondContact O-N 3.36Å; F42-K44 PolarHBondContact O-N 3.43Å; F42-N45 PolarHBondContact O-N 3.45Å; F42-E46 WeakPolarHBondContact O-CB 3.14Å; F42-E46 PolarHBondContact O-N 2.99Å
43	F	92	Very high	91.5	Very high	126 Å²	126	105.4 Å²	105.4	55%	0.553	50%	0.497	S	S	*	.	H	α-helix	trans	-63.4	-39.8	178.9	-86.3	-64.6	0	0	0	112.7	Y39 I40 E46 F47	Y39-F43 HydrophobicContact CD1-CE2 4.25Å; Y39-F43 WeakPolarHBondContact O-CB 3.23Å; Y39-F43 WeakPolarHBondContact O-CD2 3.38Å; Y39-F43 PolarHBondContact O-N 3.27Å; I40-F43 PolarHBondContact O-N 2.93Å; F43-E46 PolarHBondContact O-N 2.83Å; F43-F47 VanDerWaalsContact O-CB 3.28Å; F43-F47 WeakPolarHBondContact O-CB 3.48Å; F43-F47 PolarHBondContact O-N 3.49Å
44	K	92.7	Very high	91.6	Very high	104 Å²	104	103.5 Å²	103.5	45%	0.452	49%	0.493	S	S	.	.	H	α-helix	trans	-59.8	-47.1	174	-76	175.7	-174.2	169.4	0	111.5	I40 E41 F42 F47 L48	I40-K44 HydrophobicContact CG2-CD 4.38Å; I40-K44 WeakPolarHBondContact O-CG 3.5Å; I40-K44 PolarHBondContact O-N 2.94Å; E41-K44 PolarHBondContact O-N 3.46Å; E41-K44 IonicContact OE1-NZ 2.69Å; E41-K44 PolarHBondContact OE1-NZ 2.89Å; E41-K44 WeakPolarHBondContact OE2-CD 3.46Å; F42-K44 PolarHBondContact O-N 3.43Å; K44-F47 PolarHBondContact O-N 3.33Å; K44-L48 WeakPolarHBondContact O-CB 3.46Å; K44-L48 PolarHBondContact O-N 2.97Å
45	N	93.9	Very high	91.5	Very high	93 Å²	93	104.2 Å²	104.2	50%	0.497	50%	0.496	S	S	.	.	H	α-helix	trans	-65.3	-40.9	179.4	-76.2	-40	0	0	0	112.3	E41 F42 L48 S49	E41-N45 WeakPolarHBondContact O-CB 3.38Å; E41-N45 PolarHBondContact O-N 2.96Å; E41-N45 PolarHBondContact O-ND2 3.25Å; F42-N45 PolarHBondContact O-N 3.45Å; N45-L48 PolarHBondContact O-N 2.93Å; N45-S49 WeakPolarHBondContact O-CB 3.38Å; N45-S49 PolarHBondContact O-N 3.34Å; N45-S49 PolarHBondContact O-OG 3.14Å
46	E	93.4	Very high	91.5	Very high	68 Å²	68	105.2 Å²	105.2	32%	0.318	51%	0.508	S	S	.	.	H	α-helix	trans	-61.9	-45.2	175.2	-166.2	-162.7	159.8	0	0	111	F42 F43 S49 K50	F42-E46 WeakPolarHBondContact O-CB 3.14Å; F42-E46 PolarHBondContact O-N 2.99Å; F43-E46 PolarHBondContact O-N 2.83Å; E46-S49 PolarHBondContact O-N 3.3Å; E46-K50 PolarHBondContact O-N 3.36Å; E46-K50 IonicContact OE1-NZ 2.7Å; E46-K50 PolarHBondContact OE1-NZ 2.93Å
47	F	92.8	Very high	91	Very high	134 Å²	134	104.2 Å²	104.2	59%	0.588	51%	0.507	S	S	*	.	H	α-helix	trans	-64.4	-45	178.5	-175.4	-105.3	0	0	0	112.3	F43 K44 S49 K50 I51	F43-F47 VanDerWaalsContact O-CB 3.28Å; F43-F47 WeakPolarHBondContact O-CB 3.48Å; F43-F47 PolarHBondContact O-N 3.49Å; K44-F47 PolarHBondContact O-N 3.33Å; F47-S49 VanDerWaalsContact C-N 3.32Å; F47-S49 PolarHBondContact O-N 3.38Å; F47-K50 PolarHBondContact O-N 3.29Å; F47-I51 HydrophobicContact CD1-CD1 3.76Å; F47-I51 HydrophobicContact CE1-CD1 3.32Å; F47-I51 HydrophobicContact CE1-CG1 4.33Å; F47-I51 HydrophobicContact CZ-CD1 3.79Å; F47-I51 HydrophobicContact CZ-CG1 4.46Å; F47-I51 WeakPolarHBondContact O-CG1 3.41Å; F47-I51 PolarHBondContact O-N 2.95Å
48	L	93.2	Very high	90.1	Very high	97 Å²	97	104.1 Å²	104.1	51%	0.508	51%	0.511	S	S	.	.	H	α-helix	trans	-58.6	-43.8	173.5	-88.4	154.2	0	0	0	111.8	K44 N45 K50 I51 L52	K44-L48 WeakPolarHBondContact O-CB 3.46Å; K44-L48 PolarHBondContact O-N 2.97Å; N45-L48 PolarHBondContact O-N 2.93Å; L48-K50 PolarHBondContact O-N 3.42Å; L48-I51 PolarHBondContact O-N 2.93Å; L48-L52 WeakPolarHBondContact O-CG 3.48Å; L48-L52 PolarHBondContact O-N 2.84Å
49	S	93.9	Very high	88.7	Confident	71 Å²	71	101.6 Å²	101.6	50%	0.497	52%	0.519	S	S	.	.	H	α-helix	trans	-61.3	-44.4	178.4	-60.5	0	0	0	0	111.5	N45 E46 F47 I51 L52 E53	N45-S49 WeakPolarHBondContact O-CB 3.38Å; N45-S49 PolarHBondContact O-N 3.34Å; N45-S49 PolarHBondContact O-OG 3.14Å; E46-S49 PolarHBondContact O-N 3.3Å; F47-S49 VanDerWaalsContact C-N 3.32Å; F47-S49 PolarHBondContact O-N 3.38Å; S49-I51 PolarHBondContact O-N 2.8Å; S49-L52 PolarHBondContact O-N 2.94Å; S49-E53 WeakPolarHBondContact O-CB 3.5Å; S49-E53 PolarHBondContact O-N 2.92Å
50	K	93.7	Very high	86.8	Confident	111 Å²	111	105.2 Å²	105.2	48%	0.483	55%	0.548	S	S	.	.	H	α-helix	trans	-60.9	-41.2	175	-79.8	169.5	170	161.8	0	112.6	E46 F47 L48 E53 V54	E46-K50 PolarHBondContact O-N 3.36Å; E46-K50 IonicContact OE1-NZ 2.7Å; E46-K50 PolarHBondContact OE1-NZ 2.93Å; F47-K50 PolarHBondContact O-N 3.29Å; L48-K50 PolarHBondContact O-N 3.42Å; K50-E53 PolarHBondContact O-N 3.49Å; K50-V54 WeakPolarHBondContact O-CG2 3.36Å; K50-V54 PolarHBondContact O-N 2.91Å; K50-V54 VanDerWaalsContact O-N 3.09Å
51	I	92.3	Very high	86.6	Confident	67 Å²	67	106.4 Å²	106.4	34%	0.344	55%	0.554	S	S	.	*	H	α-helix	trans	-63	-44.1	175.5	-70.9	171.3	0	0	0	111.1	F47 L48 S49 E53 V54 K55	F47-I51 HydrophobicContact CD1-CD1 3.76Å; F47-I51 HydrophobicContact CE1-CD1 3.32Å; F47-I51 HydrophobicContact CE1-CG1 4.33Å; F47-I51 HydrophobicContact CZ-CD1 3.79Å; F47-I51 HydrophobicContact CZ-CG1 4.46Å; F47-I51 WeakPolarHBondContact O-CG1 3.41Å; F47-I51 PolarHBondContact O-N 2.95Å; L48-I51 PolarHBondContact O-N 2.93Å; S49-I51 PolarHBondContact O-N 2.8Å; I51-E53 VanDerWaalsContact C-N 3.34Å; I51-V54 PolarHBondContact O-N 3.18Å; I51-K55 HydrophobicContact CG2-CD 4.34Å; I51-K55 WeakPolarHBondContact O-CG 3.49Å; I51-K55 PolarHBondContact O-N 3.03Å
52	L	92.7	Very high	86.3	Confident	105 Å²	105	107.2 Å²	107.2	55%	0.55	56%	0.561	S	S	.	*	H	α-helix	trans	-65.3	-38.9	179.6	-72.2	171.7	0	0	0	111.9	L48 S49 K55 S56	L48-L52 WeakPolarHBondContact O-CG 3.48Å; L48-L52 PolarHBondContact O-N 2.84Å; S49-L52 PolarHBondContact O-N 2.94Å; L52-K55 PolarHBondContact O-N 3.06Å; L52-S56 WeakPolarHBondContact O-CB 3.39Å; L52-S56 PolarHBondContact O-N 3.37Å; L52-S56 PolarHBondContact O-OG 3.04Å
53	E	93.1	Very high	86	Confident	122 Å²	122	107 Å²	107	57%	0.57	57%	0.565	S	S	*	*	H	α-helix	trans	-61.1	-49	175.2	-174.5	179.5	-175.3	0	0	111.3	S49 K50 I51 K55 S56 N57	S49-E53 WeakPolarHBondContact O-CB 3.5Å; S49-E53 PolarHBondContact O-N 2.92Å; K50-E53 PolarHBondContact O-N 3.49Å; I51-E53 VanDerWaalsContact C-N 3.34Å; E53-K55 PolarHBondContact O-N 3.04Å; E53-S56 PolarHBondContact O-N 3.39Å; E53-N57 PolarHBondContact O-N 2.76Å; E53-N57 PolarHBondContact O-ND2 2.7Å
54	V	90.1	Very high	85.6	Confident	82 Å²	82	105.9 Å²	105.9	50%	0.497	57%	0.566	S	S	.	*	H	α-helix	trans	-58.9	-47.5	176.2	173	0	0	0	0	111	K50 I51 S56 N57 D58	K50-V54 WeakPolarHBondContact O-CG2 3.36Å; K50-V54 PolarHBondContact O-N 2.91Å; K50-V54 VanDerWaalsContact O-N 3.09Å; I51-V54 PolarHBondContact O-N 3.18Å; V54-S56 VanDerWaalsContact C-N 3.27Å; V54-S56 PolarHBondContact O-N 2.85Å; V54-N57 PolarHBondContact O-N 3.2Å; V54-D58 PolarHBondContact O-N 3.36Å
55	K	86.9	Confident	85.2	Confident	148 Å²	148	106 Å²	106	64%	0.643	57%	0.573	S	S	*	*	H	α-helix	trans	-62.8	-32.6	178.1	-76.3	-171.7	175.3	-167.9	0	113.5	I51 L52 E53 G59	I51-K55 HydrophobicContact CG2-CD 4.34Å; I51-K55 WeakPolarHBondContact O-CG 3.49Å; I51-K55 PolarHBondContact O-N 3.03Å; L52-K55 PolarHBondContact O-N 3.06Å; E53-K55 PolarHBondContact O-N 3.04Å; K55-G59 PolarHBondContact O-N 3.31Å
56	S	87	Confident	84.6	Confident	82 Å²	82	106.9 Å²	106.9	57%	0.573	58%	0.578	S	S	*	*	H	α-helix	trans	-75	-33.1	178.3	-56.8	0	0	0	0	111.4	L52 E53 V54	L52-S56 WeakPolarHBondContact O-CB 3.39Å; L52-S56 PolarHBondContact O-N 3.37Å; L52-S56 PolarHBondContact O-OG 3.04Å; E53-S56 PolarHBondContact O-N 3.39Å; V54-S56 VanDerWaalsContact C-N 3.27Å; V54-S56 PolarHBondContact O-N 2.85Å
57	N	77.6	Confident	84	Confident	107 Å²	107	109.6 Å²	109.6	57%	0.572	60%	0.596	S	S	*	*	H	α-helix	trans	-75.6	-31.2	177.1	-70.8	-20.1	0	0	0	113	E53 V54 G59	E53-N57 PolarHBondContact O-N 2.76Å; E53-N57 PolarHBondContact O-ND2 2.7Å; V54-N57 PolarHBondContact O-N 3.2Å; N57-G59 VanDerWaalsContact C-N 3.27Å; N57-G59 PolarHBondContact O-N 2.98Å
58	D	71.1	Confident	83.3	Confident	132 Å²	132	107.8 Å²	107.8	71%	0.706	60%	0.597	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.1	-13.7	174.8	-72.8	-18.6	0	0	0	113.3	V54	V54-D58 PolarHBondContact O-N 3.36Å
59	G	60.9	Low	82.5	Confident	68 Å²	68	108.7 Å²	108.7	70%	0.701	60%	0.604	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.4	5.1	-178.9	0	0	0	0	0	115.3	K55 N57	K55-G59 PolarHBondContact O-N 3.31Å; N57-G59 VanDerWaalsContact C-N 3.27Å; N57-G59 PolarHBondContact O-N 2.98Å
60	N	50.5	Low	81.4	Confident	209 Å²	209	112.1 Å²	112.1	100%	1.118	61%	0.614	S	S	*	*			trans	-123.4	0	-177.8	-139.5	35.7	0	0	0	110.5

Retrieved 60 of 60 residues in 43.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).