A0A913KWM2_SCHMA Loading...

40S ribosomal protein S26 AlphaSync

AlphaFold DB , UniProt , Accession A0A913KWM2, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 114 aa.

						>A0A913KWM2_SCHMA|A0A913KWM2
MTRKRRNHGRSKKGRGHVSFVRCTNCGRACPKDKSVWKLVTRSMIEAAAVKDLEDASVYGKNYAVPKLYVKLQYCISCAIHSKVLRNRSRESRRLRRIIVKPRVKFSRPVPPKA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	74.9	Confident	89.5	Confident	246 Å²	246	124.5 Å²	124.5	100%	1.212	59%	0.594	S	S	*	*				0	124.6	0	-111.7	-168.7	-89.8	0	0	110.8
2	T	89.2	Confident	89.5	Confident	153 Å²	153	119.3 Å²	119.3	94%	0.939	57%	0.567	S	S	*	*			trans	-82.7	131.4	-178.9	54.1	0	0	0	0	111.5
3	R	90.7	Very high	89.5	Confident	130 Å²	130	120.2 Å²	120.2	49%	0.491	57%	0.567	S	S	.	*			trans	-111.9	109.6	-179.7	-172.1	179.9	179.8	-169.7	7.1	110.9	R5 R6 H8	R3-R5 VanDerWaalsContact C-N 3.3Å; R3-R5 WeakPolarHBondContact CG-O 3.25Å; R3-R5 PolarHBondContact NE-O 3.32Å; R3-R5 PolarHBondContact O-N 3.15Å; R3-R6 PolarHBondContact NH1-O 3.43Å; R3-R6 PolarHBondContact NH2-O 3.49Å; R3-H8 VanDerWaalsContact CZ-CE1 3.47Å; R3-H8 VanDerWaalsContact CZ-NE2 3.3Å; R3-H8 PolarHBondContact NE-CE1 3.4Å; R3-H8 PolarHBondContact NE-ND1 3.26Å; R3-H8 PolarHBondContact NE-NE2 3Å; R3-H8 PolarHBondContact NH2-CD2 2.93Å; R3-H8 PolarHBondContact NH2-CE1 3.01Å; R3-H8 PolarHBondContact NH2-NE2 2.99Å
4	K	90.4	Very high	89.5	Confident	149 Å²	149	118.6 Å²	118.6	65%	0.648	60%	0.598	S	S	*	*	S	Bend	trans	-58.5	-35.5	-179.5	-170.6	175.3	-175.5	168.9	0	114	R93	K4-R93 VanDerWaalsContact CE-CZ 3.44Å
5	R	90.8	Very high	89.2	Confident	99 Å²	99	119.5 Å²	119.5	37%	0.374	59%	0.592	S	S	.	*			trans	-143.2	133.8	-178.2	-61.9	-174.4	171.3	94.9	-3.7	112.3	R3 N7 H8	R3-R5 VanDerWaalsContact C-N 3.3Å; R3-R5 WeakPolarHBondContact CG-O 3.25Å; R3-R5 PolarHBondContact NE-O 3.32Å; R3-R5 PolarHBondContact O-N 3.15Å; R5-N7 WeakPolarHBondContact CB-OD1 3.11Å; R5-N7 PolarHBondContact O-N 3.29Å; R5-H8 PolarHBondContact O-N 3.29Å
6	R	90.8	Very high	89.3	Confident	219 Å²	219	116.5 Å²	116.5	83%	0.826	60%	0.601	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.7	-15.4	176.2	-173.9	178.1	178.3	-159.7	0.4	114.5	R3	R3-R6 PolarHBondContact NH1-O 3.43Å; R3-R6 PolarHBondContact NH2-O 3.49Å
7	N	90.4	Very high	89.4	Confident	51 Å²	51	117.6 Å²	117.6	27%	0.273	60%	0.603	S	S	.	*	T	Hydrogen-bonded Turn	trans	-108.7	4	178.3	67.8	-11.4	0	0	0	113.9	R5 G9 R10	R5-N7 WeakPolarHBondContact CB-OD1 3.11Å; R5-N7 PolarHBondContact O-N 3.29Å; N7-G9 PolarHBondContact O-N 3.19Å; N7-G9 PolarHBondContact OD1-N 2.98Å; N7-R10 PolarHBondContact O-N 3.3Å; N7-R10 VanDerWaalsContact O-N 3.08Å
8	H	91.6	Very high	89.6	Confident	124 Å²	124	112.3 Å²	112.3	57%	0.574	58%	0.576	S	S	*	*	T	Hydrogen-bonded Turn	trans	52	20.6	-169.4	-54.4	-73.1	0	0	0	114.4	R3 R5	R3-H8 VanDerWaalsContact CZ-CE1 3.47Å; R3-H8 VanDerWaalsContact CZ-NE2 3.3Å; R3-H8 PolarHBondContact NE-CE1 3.4Å; R3-H8 PolarHBondContact NE-ND1 3.26Å; R3-H8 PolarHBondContact NE-NE2 3Å; R3-H8 PolarHBondContact NH2-CD2 2.93Å; R3-H8 PolarHBondContact NH2-CE1 3.01Å; R3-H8 PolarHBondContact NH2-NE2 2.99Å; R5-H8 PolarHBondContact O-N 3.29Å
9	G	90.9	Very high	89.8	Confident	32 Å²	32	109.9 Å²	109.9	33%	0.33	57%	0.571	S	S	.	*	T	Hydrogen-bonded Turn	trans	73.5	19.3	-176.9	0	0	0	0	0	115.5	N7	N7-G9 PolarHBondContact O-N 3.19Å; N7-G9 PolarHBondContact OD1-N 2.98Å
10	R	92.8	Very high	90.1	Very high	92 Å²	92	110.5 Å²	110.5	35%	0.347	57%	0.569	S	S	.	*	S	Bend	trans	-139.8	157.4	174.6	64.9	178.1	-178.1	-167.6	-3.4	112.5	N7 K12 D33 K34	N7-R10 PolarHBondContact O-N 3.3Å; N7-R10 VanDerWaalsContact O-N 3.08Å; R10-K12 VanDerWaalsContact C-N 3.34Å; R10-K12 HydrophobicContact CG-CB 3.99Å; R10-K12 VanDerWaalsContact CZ-CD 3.42Å; R10-K12 PolarHBondContact O-N 3.11Å; R10-D33 WeakPolarHBondContact CA-O 3.4Å; R10-D33 HydrophobicContact CB-CB 4.41Å; R10-K34 HydrophobicContact CB-CB 4.09Å; R10-K34 HydrophobicContact CB-CG 4.47Å
11	S	91.8	Very high	90.3	Very high	75 Å²	75	107.1 Å²	107.1	52%	0.524	55%	0.553	S	S	.	*			trans	-94.5	50.4	176.2	-157	0	0	0	0	113.3	R15 D33	S11-R15 PolarHBondContact O-NH2 3.16Å; S11-D33 PolarHBondContact N-O 3.48Å; S11-D33 VanDerWaalsContact O-OD2 3.08Å
12	K	89.5	Confident	91.3	Very high	61 Å²	61	104.1 Å²	104.1	27%	0.265	53%	0.528	S	S	.	.			trans	-99.6	91.3	179	-168.7	-178.7	-179.5	-178.8	0	108.8	R10 R15 G16 V18	R10-K12 VanDerWaalsContact C-N 3.34Å; R10-K12 HydrophobicContact CG-CB 3.99Å; R10-K12 VanDerWaalsContact CZ-CD 3.42Å; R10-K12 PolarHBondContact O-N 3.11Å; K12-R15 WeakPolarHBondContact CE-O 3.36Å; K12-R15 HydrophobicContact CG-CB 4.39Å; K12-R15 VanDerWaalsContact CG-O 3.24Å; K12-R15 WeakPolarHBondContact CG-O 3.46Å; K12-G16 WeakPolarHBondContact CE-O 3.46Å; K12-G16 PolarHBondContact NZ-O 3.06Å; K12-V18 HydrophobicContact CG-CG2 4.26Å
13	K	89.9	Confident	91.6	Very high	132 Å²	132	97.2 Å²	97.2	57%	0.574	49%	0.486	S	S	*	.	S	Bend	trans	-120.4	125.1	177.7	-63.7	-62.6	-176.9	178.2	0	108.3	R15	K13-R15 PolarHBondContact O-N 3.36Å
14	G	88.8	Confident	91.8	Very high	97 Å²	97	94.2 Å²	94.2	100%	1	48%	0.483	S	S	*	.	S	Bend	trans	64.4	4.2	-177.8	0	0	0	0	0	115.8
15	R	85.9	Confident	92	Very high	132 Å²	132	91.6 Å²	91.6	50%	0.498	48%	0.476	S	S	.	.			trans	-111.2	122.5	-176.4	-66.8	-171	-76.1	-117.3	2.5	110.5	S11 K12 K13 V18 D33	S11-R15 PolarHBondContact O-NH2 3.16Å; K12-R15 WeakPolarHBondContact CE-O 3.36Å; K12-R15 HydrophobicContact CG-CB 4.39Å; K12-R15 VanDerWaalsContact CG-O 3.24Å; K12-R15 WeakPolarHBondContact CG-O 3.46Å; K13-R15 PolarHBondContact O-N 3.36Å; R15-V18 HydrophobicContact CB-CG2 4.34Å; R15-D33 IonicContact NE-OD2 3.93Å; R15-D33 IonicContact NH2-OD2 3.73Å
16	G	89.8	Confident	92.2	Very high	72 Å²	72	90.1 Å²	90.1	74%	0.742	48%	0.48	S	S	*	.	S	Bend	trans	-71.6	-47.6	179.9	0	0	0	0	0	113.4	K12	K12-G16 WeakPolarHBondContact CE-O 3.46Å; K12-G16 PolarHBondContact NZ-O 3.06Å
17	H	92	Very high	92.3	Very high	136 Å²	136	81.5 Å²	81.5	63%	0.63	46%	0.459	S	S	*	.			trans	-131.4	154	176.6	179.6	-100	0	0	0	110.6	F20	H17-F20 AromaticContact NE2-CE2 3.48Å; H17-F20 WeakPolarHBondContact NE2-CE2 3.3Å
18	V	92.4	Very high	92.5	Very high	21 Å²	21	86.6 Å²	86.6	13%	0.127	47%	0.474	C	S	.	.			trans	-141	135.7	179.1	-178.8	0	0	0	0	107.5	K12 R15 K32 D33	K12-V18 HydrophobicContact CG-CG2 4.26Å; R15-V18 HydrophobicContact CB-CG2 4.34Å; V18-K32 HydrophobicContact CG1-CB 3.99Å; V18-D33 WeakPolarHBondContact CG2-OD2 3.3Å
19	S	93.9	Very high	92.7	Very high	67 Å²	67	83 Å²	83	47%	0.469	47%	0.467	S	S	.	.			trans	-53.9	144.4	179	65.7	0	0	0	0	112.3	K32	S19-K32 WeakPolarHBondContact O-CB 3.31Å; S19-K32 PolarHBondContact O-N 2.75Å
20	F	94.6	Very high	92.8	Very high	122 Å²	122	82.3 Å²	82.3	54%	0.535	46%	0.456	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.7	152.2	173.3	-64.3	-88.3	0	0	0	110.8	H17 C30 P31	H17-F20 AromaticContact NE2-CE2 3.48Å; H17-F20 WeakPolarHBondContact NE2-CE2 3.3Å; F20-C30 CarbonylContact C-O 3.51Å; F20-C30 WeakPolarHBondContact CA-O 2.94Å; F20-P31 HydrophobicContact CD1-CB 4.44Å; F20-P31 HydrophobicContact CD1-CG 4.12Å; F20-P31 HydrophobicContact CE1-CB 4.4Å; F20-P31 HydrophobicContact CE1-CG 3.78Å
21	V	94.8	Very high	92.9	Very high	40 Å²	40	79.4 Å²	79.4	24%	0.242	45%	0.449	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.3	147.2	170.2	-167.1	0	0	0	0	108.8	C30 K32	V21-C30 PolarHBondContact N-O 3.49Å; V21-C30 PolarHBondContact O-N 3.48Å; V21-C30 VanDerWaalsContact O-O 3.11Å; V21-K32 HydrophobicContact CG2-CB 4.01Å; V21-K32 HydrophobicContact CG2-CG 4.18Å
22	R	96.1	Very high	93	Very high	183 Å²	183	81.1 Å²	81.1	69%	0.691	45%	0.447	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-83.1	135.5	177.9	-64.7	-77	171.7	96.5	-4.3	109.7	G27	R22-G27 WeakPolarHBondContact CD-O 3.4Å
23	C	95.8	Very high	93.2	Very high	7 Å²	7	80 Å²	80	5%	0.047	44%	0.444	C	S	.	.			trans	-62.8	136.1	171.7	-177	0	0	0	0	110.1	N25 G27 R28 Q73 C75	C23-N25 PolarHBondContact O-N 3.15Å; C23-G27 VanDerWaalsContact O-CA 3.3Å; C23-G27 WeakPolarHBondContact O-CA 3.34Å; C23-G27 PolarHBondContact O-N 3.38Å; C23-R28 PolarHBondContact N-O 3.46Å; C23-Q73 CarbonylContact C-O 3.51Å; C23-Q73 WeakPolarHBondContact CA-O 3.32Å; C23-C75 HydrophobicContact CB-CB 4.09Å; C23-C75 PolarHBondContact SG-N 2.97Å
24	T	94.9	Very high	93.4	Very high	68 Å²	68	78 Å²	78	42%	0.417	44%	0.436	S	S	.	.	T	Hydrogen-bonded Turn	trans	-65.1	-25.6	179.3	51.5	0	0	0	0	113.9	L72 Q73	T24-L72 HydrophobicContact CG2-CD2 4.19Å; T24-Q73 PolarHBondContact N-O 3.19Å; T24-Q73 PolarHBondContact OG1-O 3.15Å
25	N	93.7	Very high	93.7	Very high	94 Å²	94	74.2 Å²	74.2	50%	0.503	39%	0.394	S	S	.	.	T	Hydrogen-bonded Turn	trans	-97.5	-52.9	-175.3	-69	32.1	0	0	0	112.3	C23 Y74	C23-N25 PolarHBondContact O-N 3.15Å; N25-Y74 VanDerWaalsContact OD1-CE1 3.28Å; N25-Y74 WeakPolarHBondContact OD1-CE1 2.88Å
26	C	95.2	Very high	94.1	Very high	68 Å²	68	69.6 Å²	69.6	46%	0.459	38%	0.38	S	S	.	.	T	Hydrogen-bonded Turn	trans	-103.7	0.6	-173.6	65.4	0	0	0	0	114.1	R28 C78	C26-R28 PolarHBondContact O-N 3.43Å; C26-R28 VanDerWaalsContact SG-CB 3.54Å; C26-C78 PolarHBondContact SG-SG 3.07Å
27	G	93.9	Very high	94.2	Very high	38 Å²	38	73.8 Å²	73.8	39%	0.392	37%	0.373	S	S	.	.			trans	66.4	-2.7	-177.5	0	0	0	0	0	115.3	R22 C23 A29	R22-G27 WeakPolarHBondContact CD-O 3.4Å; C23-G27 VanDerWaalsContact O-CA 3.3Å; C23-G27 WeakPolarHBondContact O-CA 3.34Å; C23-G27 PolarHBondContact O-N 3.38Å; G27-A29 PolarHBondContact O-N 3.37Å
28	R	94.9	Very high	94.2	Very high	157 Å²	157	72.2 Å²	72.2	59%	0.592	37%	0.365	S	S	*	.			trans	-60.1	132.1	-178.5	-173.8	176.8	-177.5	168.2	6.9	111.8	C23 C26 C30	C23-R28 PolarHBondContact N-O 3.46Å; C26-R28 PolarHBondContact O-N 3.43Å; C26-R28 VanDerWaalsContact SG-CB 3.54Å; R28-C30 PolarHBondContact O-N 2.99Å
29	A	95.1	Very high	94.2	Very high	50 Å²	50	75.7 Å²	75.7	41%	0.413	38%	0.382	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-67	125.3	171.8	0	0	0	0	0	111.1	G27	G27-A29 PolarHBondContact O-N 3.37Å
30	C	93.1	Very high	94.2	Very high	17 Å²	17	73.4 Å²	73.4	12%	0.115	37%	0.365	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.5	141.6	176.1	-70.6	0	0	0	0	109.7	F20 V21 R28 K32 C75	F20-C30 CarbonylContact C-O 3.51Å; F20-C30 WeakPolarHBondContact CA-O 2.94Å; V21-C30 PolarHBondContact N-O 3.49Å; V21-C30 PolarHBondContact O-N 3.48Å; V21-C30 VanDerWaalsContact O-O 3.11Å; R28-C30 PolarHBondContact O-N 2.99Å; C30-K32 PolarHBondContact O-N 3.04Å; C30-C75 WeakPolarHBondContact SG-CB 3.21Å
31	P	95	Very high	94.1	Very high	30 Å²	30	71 Å²	71	20%	0.195	36%	0.361	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-58.9	137.9	172.3	-17.9	27.4	0	0	0	110.1	F20 D33 K34 S35	F20-P31 HydrophobicContact CD1-CB 4.44Å; F20-P31 HydrophobicContact CD1-CG 4.12Å; F20-P31 HydrophobicContact CE1-CB 4.4Å; F20-P31 HydrophobicContact CE1-CG 3.78Å; P31-D33 PolarHBondContact O-N 2.91Å; P31-D33 VanDerWaalsContact O-N 3.15Å; P31-K34 HydrophobicContact CB-CB 4.24Å; P31-K34 HydrophobicContact CG-CB 4.32Å; P31-K34 PolarHBondContact O-N 2.85Å; P31-S35 PolarHBondContact O-N 2.98Å
32	K	93.7	Very high	93.9	Very high	112 Å²	112	77.2 Å²	77.2	49%	0.487	38%	0.38	S	S	.	.	G	3₁₀ helix	trans	-49.2	-44.2	178.8	-172.3	178	177.8	-178.9	0	112.3	V18 S19 V21 C30 K34 S35	V18-K32 HydrophobicContact CG1-CB 3.99Å; S19-K32 WeakPolarHBondContact O-CB 3.31Å; S19-K32 PolarHBondContact O-N 2.75Å; V21-K32 HydrophobicContact CG2-CB 4.01Å; V21-K32 HydrophobicContact CG2-CG 4.18Å; C30-K32 PolarHBondContact O-N 3.04Å; K32-K34 PolarHBondContact O-N 2.89Å; K32-S35 PolarHBondContact O-N 2.92Å; K32-S35 PolarHBondContact O-OG 3.04Å
33	D	93.7	Very high	93.7	Very high	37 Å²	37	71.2 Å²	71.2	20%	0.198	37%	0.366	C	S	.	.	G	3₁₀ helix	trans	-71.2	-10.3	-178.7	-66.9	-5.8	0	0	0	115.6	R10 S11 R15 V18 P31	R10-D33 WeakPolarHBondContact CA-O 3.4Å; R10-D33 HydrophobicContact CB-CB 4.41Å; S11-D33 PolarHBondContact N-O 3.48Å; S11-D33 VanDerWaalsContact O-OD2 3.08Å; R15-D33 IonicContact NE-OD2 3.93Å; R15-D33 IonicContact NH2-OD2 3.73Å; V18-D33 WeakPolarHBondContact CG2-OD2 3.3Å; P31-D33 PolarHBondContact O-N 2.91Å; P31-D33 VanDerWaalsContact O-N 3.15Å
34	K	93.9	Very high	93.4	Very high	91 Å²	91	75.9 Å²	75.9	40%	0.396	39%	0.388	S	S	.	.	G	3₁₀ helix	trans	-110.1	-18.6	178	-166.9	174.5	-173.6	-172.2	0	111.6	R10 P31 K32 I76	R10-K34 HydrophobicContact CB-CB 4.09Å; R10-K34 HydrophobicContact CB-CG 4.47Å; P31-K34 HydrophobicContact CB-CB 4.24Å; P31-K34 HydrophobicContact CG-CB 4.32Å; P31-K34 PolarHBondContact O-N 2.85Å; K32-K34 PolarHBondContact O-N 2.89Å; K34-I76 HydrophobicContact CD-CD1 4.12Å; K34-I76 HydrophobicContact CG-CD1 3.82Å
35	S	94.5	Very high	93.2	Very high	17 Å²	17	74.1 Å²	74.1	12%	0.119	38%	0.376	C	S	.	.	S	Bend	trans	-63.9	145.9	176.2	75.4	0	0	0	0	110.8	P31 K32	P31-S35 PolarHBondContact O-N 2.98Å; K32-S35 PolarHBondContact O-N 2.92Å; K32-S35 PolarHBondContact O-OG 3.04Å
36	V	94.2	Very high	92.9	Very high	34 Å²	34	77.1 Å²	77.1	21%	0.206	39%	0.387	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100	103.4	176	177.5	0	0	0	0	105.9	Y74 A79 V84 L85	V36-Y74 PolarHBondContact N-O 3.29Å; V36-Y74 PolarHBondContact O-N 3.01Å; V36-A79 HydrophobicContact CB-CB 4.28Å; V36-A79 HydrophobicContact CG1-CB 4.41Å; V36-A79 HydrophobicContact CG2-CB 4.31Å; V36-V84 HydrophobicContact CG1-CG1 4.47Å; V36-L85 HydrophobicContact CB-CD1 4.28Å; V36-L85 HydrophobicContact CG1-CD1 4.07Å; V36-L85 HydrophobicContact CG1-CG 4.44Å; V36-L85 HydrophobicContact CG2-CD1 3.39Å
37	W	92.3	Very high	92.5	Very high	161 Å²	161	78.2 Å²	78.2	61%	0.61	40%	0.401	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-90.7	142.6	178.2	71.6	-85	0	0	0	110.3	L39 L72 Q73	W37-L39 HydrophobicContact CE3-CB 4.47Å; W37-L39 HydrophobicContact CZ3-CB 3.97Å; W37-L72 CarbonylContact C-O 3.58Å; W37-L72 VanDerWaalsContact CA-O 3.23Å; W37-L72 WeakPolarHBondContact CA-O 3.49Å; W37-Q73 HydrophobicContact CB-CG 4.35Å
38	K	92.7	Very high	92.2	Very high	102 Å²	102	79.6 Å²	79.6	44%	0.443	41%	0.409	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.3	119.8	173	-174.4	-179.8	-179.2	-176.3	0	107.6	V40 L72	K38-V40 HydrophobicContact CD-CG2 4.02Å; K38-V40 HydrophobicContact CG-CG2 3.99Å; K38-L72 PolarHBondContact N-O 3.03Å; K38-L72 PolarHBondContact O-N 2.85Å
39	L	92.8	Very high	92	Very high	95 Å²	95	74.1 Å²	74.1	50%	0.497	40%	0.397	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.8	122.2	166.5	-175.7	66.8	0	0	0	107.9	W37	W37-L39 HydrophobicContact CE3-CB 4.47Å; W37-L39 HydrophobicContact CZ3-CB 3.97Å
40	V	92.8	Very high	91.6	Very high	18 Å²	18	73.7 Å²	73.7	11%	0.109	39%	0.389	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.3	112.9	175.8	176.4	0	0	0	0	107.1	K38 R42 V70 L72	K38-V40 HydrophobicContact CD-CG2 4.02Å; K38-V40 HydrophobicContact CG-CG2 3.99Å; V40-R42 HydrophobicContact CG1-CG 3.64Å; V40-V70 PolarHBondContact N-O 3.25Å; V40-V70 PolarHBondContact O-N 3.33Å; V40-L72 HydrophobicContact CB-CD1 4.38Å; V40-L72 HydrophobicContact CG2-CD1 3.57Å; V40-L72 HydrophobicContact CG2-CG 4.23Å
41	T	92.7	Very high	91.3	Very high	72 Å²	72	79.5 Å²	79.5	44%	0.442	41%	0.412	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.5	115.3	168.1	-54.7	0	0	0	0	107.3	K67 L68 Y69	T41-K67 HydrophobicContact CG2-CB 4.2Å; T41-K67 HydrophobicContact CG2-CD 4.09Å; T41-L68 WeakPolarHBondContact CA-O 3.32Å; T41-Y69 HydrophobicContact CG2-CD1 4.05Å; T41-Y69 HydrophobicContact CG2-CE1 3.64Å
42	R	91.3	Very high	91.1	Very high	170 Å²	170	83.4 Å²	83.4	64%	0.642	43%	0.432	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-123	143.3	176.7	-76.3	172.9	179.2	-178.6	-2	108.5	V40 K67 L68	V40-R42 HydrophobicContact CG1-CG 3.64Å; R42-K67 CarbonylContact O-C 3.56Å; R42-K67 WeakPolarHBondContact O-CA 2.93Å; R42-L68 PolarHBondContact N-O 3.41Å; R42-L68 PolarHBondContact O-N 3.42Å
43	S	90.8	Very high	90.8	Very high	57 Å²	57	81.8 Å²	81.8	40%	0.399	43%	0.428	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-59.4	145.8	162.2	177.3	0	0	0	0	108.3	I45	S43-I45 WeakPolarHBondContact CB-O 3.4Å; S43-I45 PolarHBondContact O-N 3.3Å; S43-I45 PolarHBondContact OG-N 2.98Å; S43-I45 PolarHBondContact OG-O 3Å
44	M	90.3	Very high	90.5	Very high	105 Å²	105	83.4 Å²	83.4	52%	0.517	43%	0.434	S	S	.	.	S	Bend	trans	-61.6	-30	170.3	-76.2	-172.9	-158.2	0	0	111.6	P66 L68	M44-P66 HydrophobicContact CE-CB 3.57Å; M44-P66 HydrophobicContact CE-CG 3.64Å; M44-P66 HydrophobicContact CG-CG 4.38Å; M44-P66 WeakPolarHBondContact CG-O 3.48Å; M44-P66 PolarHBondContact N-O 2.96Å; M44-P66 VanDerWaalsContact N-O 3.15Å; M44-P66 HydrophobicContact SD-CB 4.13Å; M44-P66 HydrophobicContact SD-CG 3.52Å; M44-P66 VanDerWaalsContact SD-CG 3.52Å; M44-L68 HydrophobicContact CE-CD2 3.87Å; M44-L68 HydrophobicContact CG-CD1 4.3Å; M44-L68 HydrophobicContact CG-CD2 3.86Å; M44-L68 HydrophobicContact CG-CG 3.7Å; M44-L68 HydrophobicContact SD-CD2 4.4Å
45	I	90.4	Very high	90.2	Very high	32 Å²	32	84.6 Å²	84.6	16%	0.164	45%	0.445	C	S	.	.	S	Bend	trans	-107.5	136.3	-176	-49.7	172.6	0	0	0	109.2	S43 A49 V50 L53 V65	S43-I45 WeakPolarHBondContact CB-O 3.4Å; S43-I45 PolarHBondContact O-N 3.3Å; S43-I45 PolarHBondContact OG-N 2.98Å; S43-I45 PolarHBondContact OG-O 3Å; I45-A49 HydrophobicContact CG2-CB 3.81Å; I45-V50 HydrophobicContact CG2-CG2 4.21Å; I45-L53 HydrophobicContact CD1-CB 4.33Å; I45-L53 HydrophobicContact CD1-CD1 3.76Å; I45-L53 HydrophobicContact CD1-CD2 3.43Å; I45-L53 VanDerWaalsContact CD1-CD2 3.43Å; I45-L53 HydrophobicContact CD1-CG 4Å; I45-V65 HydrophobicContact CB-CG1 4.2Å; I45-V65 HydrophobicContact CD1-CB 4.37Å; I45-V65 HydrophobicContact CD1-CG1 3.52Å; I45-V65 HydrophobicContact CD1-CG2 3.87Å; I45-V65 HydrophobicContact CG1-CG1 3.73Å
46	E	87.5	Confident	90	Very high	157 Å²	157	87.9 Å²	87.9	73%	0.734	47%	0.473	S	S	*	.			trans	-70.7	146.5	171.7	-178.9	167.8	-158.2	0	0	111.1	A48 A49 V50	E46-A48 PolarHBondContact O-N 3.42Å; E46-A49 PolarHBondContact O-N 2.79Å; E46-V50 PolarHBondContact O-N 2.88Å
47	A	86.4	Confident	89.6	Confident	91 Å²	91	87.8 Å²	87.8	75%	0.752	47%	0.474	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55.4	-25.4	-173.1	0	0	0	0	0	115
48	A	88.7	Confident	89.4	Confident	67 Å²	67	87 Å²	87	55%	0.554	49%	0.486	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73.3	-39.4	177.2	0	0	0	0	0	112.7	E46 V50	E46-A48 PolarHBondContact O-N 3.42Å; A48-V50 VanDerWaalsContact C-N 3.3Å; A48-V50 PolarHBondContact O-N 3.41Å
49	A	89.6	Confident	89	Confident	41 Å²	41	90.5 Å²	90.5	34%	0.339	50%	0.498	S	S	.	.	T	Hydrogen-bonded Turn	trans	-84.5	-3.7	-176.1	0	0	0	0	0	113.4	I45 E46 K51 D52 L53	I45-A49 HydrophobicContact CG2-CB 3.81Å; E46-A49 PolarHBondContact O-N 2.79Å; A49-K51 VanDerWaalsContact C-N 3.26Å; A49-K51 PolarHBondContact O-N 2.85Å; A49-D52 PolarHBondContact O-N 2.84Å; A49-L53 WeakPolarHBondContact O-CB 3.4Å; A49-L53 PolarHBondContact O-N 3.37Å; A49-L53 VanDerWaalsContact O-N 3.11Å
50	V	87.9	Confident	88.2	Confident	41 Å²	41	87.3 Å²	87.3	25%	0.248	49%	0.488	C	S	.	.	H	α-helix	trans	-59.2	-41.4	178.9	174.7	0	0	0	0	110.6	I45 E46 A48 L53 E54	I45-V50 HydrophobicContact CG2-CG2 4.21Å; E46-V50 PolarHBondContact O-N 2.88Å; A48-V50 VanDerWaalsContact C-N 3.3Å; A48-V50 PolarHBondContact O-N 3.41Å; V50-L53 PolarHBondContact O-N 2.95Å; V50-E54 HydrophobicContact CG1-CG 4.46Å; V50-E54 VanDerWaalsContact CG1-OE1 3.3Å; V50-E54 WeakPolarHBondContact CG1-OE1 3.25Å; V50-E54 VanDerWaalsContact O-CG 3.31Å; V50-E54 WeakPolarHBondContact O-CG 3.23Å; V50-E54 PolarHBondContact O-N 3.37Å
51	K	86.7	Confident	87.5	Confident	140 Å²	140	94.5 Å²	94.5	61%	0.609	52%	0.518	S	S	*	.	H	α-helix	trans	-68.3	-46.6	-178.3	-177.2	164.2	177.4	169.2	0	112.5	A49 L53 E54 D55	A49-K51 VanDerWaalsContact C-N 3.26Å; A49-K51 PolarHBondContact O-N 2.85Å; K51-L53 PolarHBondContact O-N 2.88Å; K51-E54 PolarHBondContact O-N 3.46Å; K51-D55 PolarHBondContact O-N 3.37Å
52	D	90.4	Very high	86.9	Confident	112 Å²	112	98.6 Å²	98.6	60%	0.599	54%	0.537	S	S	*	.	H	α-helix	trans	-62	-36.2	179.7	-53.3	-36.6	0	0	0	111.2	A49 A56	A49-D52 PolarHBondContact O-N 2.84Å; D52-A56 VanDerWaalsContact O-CB 3.25Å; D52-A56 WeakPolarHBondContact O-CB 3.33Å; D52-A56 PolarHBondContact O-N 2.95Å
53	L	87.6	Confident	86.6	Confident	78 Å²	78	96.3 Å²	96.3	41%	0.408	53%	0.529	S	S	.	.	H	α-helix	trans	-75	-34.7	178.3	-159.9	124.7	0	0	0	112.6	I45 A49 V50 K51 S57	I45-L53 HydrophobicContact CD1-CB 4.33Å; I45-L53 HydrophobicContact CD1-CD1 3.76Å; I45-L53 HydrophobicContact CD1-CD2 3.43Å; I45-L53 VanDerWaalsContact CD1-CD2 3.43Å; I45-L53 HydrophobicContact CD1-CG 4Å; A49-L53 WeakPolarHBondContact O-CB 3.4Å; A49-L53 PolarHBondContact O-N 3.37Å; A49-L53 VanDerWaalsContact O-N 3.11Å; V50-L53 PolarHBondContact O-N 2.95Å; K51-L53 PolarHBondContact O-N 2.88Å; L53-S57 WeakPolarHBondContact O-CB 3.36Å; L53-S57 PolarHBondContact O-N 2.63Å; L53-S57 PolarHBondContact O-OG 2.92Å
54	E	87.8	Confident	86.3	Confident	71 Å²	71	97.7 Å²	97.7	33%	0.332	54%	0.544	S	S	.	.	H	α-helix	trans	-61.9	-46.4	171.7	-78	173.2	-167.9	0	0	111	V50 K51 S57	V50-E54 HydrophobicContact CG1-CG 4.46Å; V50-E54 VanDerWaalsContact CG1-OE1 3.3Å; V50-E54 WeakPolarHBondContact CG1-OE1 3.25Å; V50-E54 VanDerWaalsContact O-CG 3.31Å; V50-E54 WeakPolarHBondContact O-CG 3.23Å; V50-E54 PolarHBondContact O-N 3.37Å; K51-E54 PolarHBondContact O-N 3.46Å; E54-S57 PolarHBondContact O-N 3.15Å; E54-S57 PolarHBondContact O-OG 2.71Å
55	D	87.8	Confident	86.1	Confident	115 Å²	115	94.7 Å²	94.7	62%	0.615	53%	0.531	S	S	*	.	H	α-helix	trans	-68.6	-34.6	-179	-68	-21.3	0	0	0	112.2	K51	K51-D55 PolarHBondContact O-N 3.37Å
56	A	89.2	Confident	86.2	Confident	87 Å²	87	95.5 Å²	95.5	72%	0.719	54%	0.539	S	S	*	.	H	α-helix	trans	-85	-13	177.9	0	0	0	0	0	114.4	D52	D52-A56 VanDerWaalsContact O-CB 3.25Å; D52-A56 WeakPolarHBondContact O-CB 3.33Å; D52-A56 PolarHBondContact O-N 2.95Å
57	S	86.4	Confident	86.5	Confident	32 Å²	32	93.7 Å²	93.7	22%	0.224	53%	0.528	C	S	.	.			trans	-81.9	138.6	-174.9	67.6	0	0	0	0	113.1	L53 E54 Y59 G60	L53-S57 WeakPolarHBondContact O-CB 3.36Å; L53-S57 PolarHBondContact O-N 2.63Å; L53-S57 PolarHBondContact O-OG 2.92Å; E54-S57 PolarHBondContact O-N 3.15Å; E54-S57 PolarHBondContact O-OG 2.71Å; S57-Y59 PolarHBondContact O-N 3.21Å; S57-G60 PolarHBondContact O-N 2.97Å; S57-G60 VanDerWaalsContact O-N 3.15Å; S57-G60 PolarHBondContact OG-N 2.99Å; S57-G60 PolarHBondContact OG-O 3.09Å
58	V	88.1	Confident	86.9	Confident	143 Å²	143	93.3 Å²	93.3	87%	0.867	51%	0.514	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.8	-32.4	174.8	-178.1	0	0	0	0	111.8	G60	V58-G60 VanDerWaalsContact C-N 3.26Å; V58-G60 PolarHBondContact O-N 3.26Å
59	Y	84	Confident	87.2	Confident	177 Å²	177	97.7 Å²	97.7	69%	0.694	52%	0.517	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82	-2	-179.9	-60.6	-65.9	0	0	0	113.6	S57 N62 Y63	S57-Y59 PolarHBondContact O-N 3.21Å; Y59-N62 PolarHBondContact O-N 3.28Å; Y59-Y63 HydrophobicContact CD2-CD2 4.27Å
60	G	76.7	Confident	87.5	Confident	27 Å²	27	99 Å²	99	28%	0.278	52%	0.52	S	S	.	.	G	3₁₀ helix	trans	52.2	-147.3	-176.8	0	0	0	0	0	113.3	S57 V58 N62	S57-G60 PolarHBondContact O-N 2.97Å; S57-G60 VanDerWaalsContact O-N 3.15Å; S57-G60 PolarHBondContact OG-N 2.99Å; S57-G60 PolarHBondContact OG-O 3.09Å; V58-G60 VanDerWaalsContact C-N 3.26Å; V58-G60 PolarHBondContact O-N 3.26Å; G60-N62 PolarHBondContact O-N 3.37Å
61	K	76.4	Confident	87.8	Confident	169 Å²	169	102.7 Å²	102.7	74%	0.735	53%	0.533	S	S	*	.	G	3₁₀ helix	trans	-64.9	-10	-176.8	-70.2	-178.9	179.1	173.5	0	115.5
62	N	80.7	Confident	88.2	Confident	159 Å²	159	97.8 Å²	97.8	85%	0.85	51%	0.514	S	S	*	.	G	3₁₀ helix	trans	-87.5	-3.1	-174.8	-82.5	15.6	0	0	0	113.9	Y59 G60 A64	Y59-N62 PolarHBondContact O-N 3.28Å; G60-N62 PolarHBondContact O-N 3.37Å; N62-A64 PolarHBondContact O-N 3.29Å
63	Y	84.7	Confident	88.5	Confident	122 Å²	122	93.9 Å²	93.9	48%	0.478	49%	0.492	S	S	.	.			trans	-79.6	115.4	179.5	-172.5	-108.2	0	0	0	112.4	Y59 V65	Y59-Y63 HydrophobicContact CD2-CD2 4.27Å; Y63-V65 PolarHBondContact O-N 3.36Å; Y63-V65 VanDerWaalsContact O-N 3.16Å
64	A	85.5	Confident	88.9	Confident	86 Å²	86	91.4 Å²	91.4	71%	0.711	48%	0.477	S	S	*	.			trans	-73.6	106.6	174.7	0	0	0	0	0	110.7	N62 P66	N62-A64 PolarHBondContact O-N 3.29Å; A64-P66 WeakPolarHBondContact O-CD 3.28Å
65	V	86.6	Confident	89.3	Confident	41 Å²	41	88.2 Å²	88.2	25%	0.248	46%	0.463	C	S	.	.			trans	-59.4	123.6	179.7	-179.4	0	0	0	0	110.9	I45 Y63	I45-V65 HydrophobicContact CB-CG1 4.2Å; I45-V65 HydrophobicContact CD1-CB 4.37Å; I45-V65 HydrophobicContact CD1-CG1 3.52Å; I45-V65 HydrophobicContact CD1-CG2 3.87Å; I45-V65 HydrophobicContact CG1-CG1 3.73Å; Y63-V65 PolarHBondContact O-N 3.36Å; Y63-V65 VanDerWaalsContact O-N 3.16Å
66	P	91.4	Very high	89.6	Confident	49 Å²	49	86 Å²	86	32%	0.318	45%	0.45	S	S	.	.			trans	-69.6	158	-179.4	29.1	-36.7	0	0	0	112.5	M44 A64	M44-P66 HydrophobicContact CE-CB 3.57Å; M44-P66 HydrophobicContact CE-CG 3.64Å; M44-P66 HydrophobicContact CG-CG 4.38Å; M44-P66 WeakPolarHBondContact CG-O 3.48Å; M44-P66 PolarHBondContact N-O 2.96Å; M44-P66 VanDerWaalsContact N-O 3.15Å; M44-P66 HydrophobicContact SD-CB 4.13Å; M44-P66 HydrophobicContact SD-CG 3.52Å; M44-P66 VanDerWaalsContact SD-CG 3.52Å; A64-P66 WeakPolarHBondContact O-CD 3.28Å
67	K	94.1	Very high	89.9	Confident	119 Å²	119	85.3 Å²	85.3	52%	0.517	44%	0.44	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.6	140.5	-175.3	-66.2	172.8	-174.1	165.6	0	111.2	T41 R42 Y69	T41-K67 HydrophobicContact CG2-CB 4.2Å; T41-K67 HydrophobicContact CG2-CD 4.09Å; R42-K67 CarbonylContact O-C 3.56Å; R42-K67 WeakPolarHBondContact O-CA 2.93Å; K67-Y69 HydrophobicContact CB-CE2 3.82Å; K67-Y69 WeakPolarHBondContact O-CD2 3.39Å; K67-Y69 WeakPolarHBondContact O-CE2 3.42Å
68	L	94.4	Very high	90.3	Very high	84 Å²	84	84.8 Å²	84.8	44%	0.44	44%	0.436	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.9	128.7	170.3	-62.1	176.1	0	0	0	110	T41 R42 M44	T41-L68 WeakPolarHBondContact CA-O 3.32Å; R42-L68 PolarHBondContact N-O 3.41Å; R42-L68 PolarHBondContact O-N 3.42Å; M44-L68 HydrophobicContact CE-CD2 3.87Å; M44-L68 HydrophobicContact CG-CD1 4.3Å; M44-L68 HydrophobicContact CG-CD2 3.86Å; M44-L68 HydrophobicContact CG-CG 3.7Å; M44-L68 HydrophobicContact SD-CD2 4.4Å
69	Y	96.1	Very high	90.7	Very high	158 Å²	158	78 Å²	78	62%	0.62	39%	0.394	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-113.4	105.6	175.9	-63.7	-88.7	0	0	0	109.2	T41 K67	T41-Y69 HydrophobicContact CG2-CD1 4.05Å; T41-Y69 HydrophobicContact CG2-CE1 3.64Å; K67-Y69 HydrophobicContact CB-CE2 3.82Å; K67-Y69 WeakPolarHBondContact O-CD2 3.39Å; K67-Y69 WeakPolarHBondContact O-CE2 3.42Å
70	V	94.9	Very high	91.3	Very high	69 Å²	69	74.2 Å²	74.2	42%	0.418	39%	0.386	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.5	125.2	-178.7	-174.7	0	0	0	0	109.9	V40 L72	V40-V70 PolarHBondContact N-O 3.25Å; V40-V70 PolarHBondContact O-N 3.33Å; V70-L72 HydrophobicContact CG1-CD2 3.64Å; V70-L72 HydrophobicContact CG1-CG 4.11Å; V70-L72 PolarHBondContact O-N 3.19Å
71	K	94.5	Very high	92.2	Very high	118 Å²	118	80.8 Å²	80.8	51%	0.513	41%	0.408	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.8	96.5	171.9	-173.1	176.5	-176.7	172.3	0	109.7
72	L	94.7	Very high	93	Very high	38 Å²	38	75.2 Å²	75.2	20%	0.199	39%	0.391	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.9	135.6	175.8	-59.4	175.2	0	0	0	109.8	T24 W37 K38 V40 V70 Y74	T24-L72 HydrophobicContact CG2-CD2 4.19Å; W37-L72 CarbonylContact C-O 3.58Å; W37-L72 VanDerWaalsContact CA-O 3.23Å; W37-L72 WeakPolarHBondContact CA-O 3.49Å; K38-L72 PolarHBondContact N-O 3.03Å; K38-L72 PolarHBondContact O-N 2.85Å; V40-L72 HydrophobicContact CB-CD1 4.38Å; V40-L72 HydrophobicContact CG2-CD1 3.57Å; V40-L72 HydrophobicContact CG2-CG 4.23Å; V70-L72 HydrophobicContact CG1-CD2 3.64Å; V70-L72 HydrophobicContact CG1-CG 4.11Å; V70-L72 PolarHBondContact O-N 3.19Å; L72-Y74 HydrophobicContact CB-CE2 3.8Å; L72-Y74 HydrophobicContact CD1-CE2 4.42Å; L72-Y74 WeakPolarHBondContact CD1-OH 3.24Å
73	Q	95.9	Very high	93.6	Very high	30 Å²	30	75.3 Å²	75.3	14%	0.14	38%	0.384	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.5	118.5	176.3	-61.9	-163	28	0	0	110	C23 T24 W37	C23-Q73 CarbonylContact C-O 3.51Å; C23-Q73 WeakPolarHBondContact CA-O 3.32Å; T24-Q73 PolarHBondContact N-O 3.19Å; T24-Q73 PolarHBondContact OG1-O 3.15Å; W37-Q73 HydrophobicContact CB-CG 4.35Å
74	Y	96.7	Very high	94	Very high	26 Å²	26	72.2 Å²	72.2	10%	0.102	38%	0.378	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.6	145.5	-177.5	-62.1	-76.4	0	0	0	111.9	N25 V36 L72 C78	N25-Y74 VanDerWaalsContact OD1-CE1 3.28Å; N25-Y74 WeakPolarHBondContact OD1-CE1 2.88Å; V36-Y74 PolarHBondContact N-O 3.29Å; V36-Y74 PolarHBondContact O-N 3.01Å; L72-Y74 HydrophobicContact CB-CE2 3.8Å; L72-Y74 HydrophobicContact CD1-CE2 4.42Å; L72-Y74 WeakPolarHBondContact CD1-OH 3.24Å; Y74-C78 HydrophobicContact CD1-CB 4.25Å
75	C	95.8	Very high	94.3	Very high	4 Å²	4	71.2 Å²	71.2	3%	0.027	36%	0.36	C	S	.	.			trans	-71.8	160	157.3	74.3	0	0	0	0	110	C23 C30 S77 C78 A79	C23-C75 HydrophobicContact CB-CB 4.09Å; C23-C75 PolarHBondContact SG-N 2.97Å; C30-C75 WeakPolarHBondContact SG-CB 3.21Å; C75-S77 VanDerWaalsContact C-N 3.26Å; C75-S77 PolarHBondContact O-N 3.19Å; C75-C78 PolarHBondContact O-N 3.03Å; C75-C78 PolarHBondContact SG-N 3.37Å; C75-C78 VanDerWaalsContact SG-N 3.37Å; C75-C78 PolarHBondContact SG-SG 2.85Å; C75-A79 WeakPolarHBondContact O-CB 3.41Å; C75-A79 PolarHBondContact O-N 3.46Å
76	I	94.6	Very high	94.6	Very high	68 Å²	68	77.7 Å²	77.7	35%	0.349	38%	0.38	S	S	.	.	H	α-helix	trans	-61.2	-37.5	-176.8	-65.1	165.5	0	0	0	111.6	K34 A79 I80	K34-I76 HydrophobicContact CD-CD1 4.12Å; K34-I76 HydrophobicContact CG-CD1 3.82Å; I76-A79 PolarHBondContact O-N 3.09Å; I76-I80 HydrophobicContact CG2-CD1 3.8Å; I76-I80 HydrophobicContact CG2-CG1 4.48Å; I76-I80 VanDerWaalsContact O-CG1 3.3Å; I76-I80 WeakPolarHBondContact O-CG1 3.3Å; I76-I80 PolarHBondContact O-N 3.16Å; I76-I80 VanDerWaalsContact O-N 3.09Å
77	S	95.4	Very high	94.6	Very high	73 Å²	73	82.3 Å²	82.3	51%	0.51	40%	0.402	S	S	.	.	H	α-helix	trans	-63.4	-50.9	179.5	-52.3	0	0	0	0	111.5	C75 A79 I80 H81	C75-S77 VanDerWaalsContact C-N 3.26Å; C75-S77 PolarHBondContact O-N 3.19Å; S77-A79 VanDerWaalsContact C-N 3.32Å; S77-A79 PolarHBondContact O-N 3.27Å; S77-I80 PolarHBondContact O-N 3.02Å; S77-H81 WeakPolarHBondContact O-CB 3.44Å; S77-H81 PolarHBondContact O-N 3.48Å
78	C	96.2	Very high	94.5	Very high	20 Å²	20	81.1 Å²	81.1	14%	0.135	39%	0.394	C	S	.	.	H	α-helix	trans	-62.6	-39.7	176.6	-67.8	0	0	0	0	111.7	C26 Y74 C75 I80 H81 S82	C26-C78 PolarHBondContact SG-SG 3.07Å; Y74-C78 HydrophobicContact CD1-CB 4.25Å; C75-C78 PolarHBondContact O-N 3.03Å; C75-C78 PolarHBondContact SG-N 3.37Å; C75-C78 VanDerWaalsContact SG-N 3.37Å; C75-C78 PolarHBondContact SG-SG 2.85Å; C78-I80 VanDerWaalsContact C-N 3.27Å; C78-I80 PolarHBondContact O-N 3.21Å; C78-H81 PolarHBondContact O-N 3.08Å; C78-S82 WeakPolarHBondContact O-CB 3.38Å; C78-S82 PolarHBondContact O-N 3.35Å; C78-S82 PolarHBondContact O-OG 2.95Å
79	A	95.7	Very high	94.4	Very high	0 Å²	0	80.6 Å²	80.6	0%	0	40%	0.398	C	S	.	.	H	α-helix	trans	-64.5	-31.9	-180	0	0	0	0	0	113	V36 C75 I76 S77 V84 L85	V36-A79 HydrophobicContact CB-CB 4.28Å; V36-A79 HydrophobicContact CG1-CB 4.41Å; V36-A79 HydrophobicContact CG2-CB 4.31Å; C75-A79 WeakPolarHBondContact O-CB 3.41Å; C75-A79 PolarHBondContact O-N 3.46Å; I76-A79 PolarHBondContact O-N 3.09Å; S77-A79 VanDerWaalsContact C-N 3.32Å; S77-A79 PolarHBondContact O-N 3.27Å; A79-V84 PolarHBondContact O-N 3Å; A79-L85 HydrophobicContact CB-CB 4.45Å; A79-L85 HydrophobicContact CB-CD1 3.79Å; A79-L85 HydrophobicContact CB-CG 4.37Å; A79-L85 PolarHBondContact O-N 2.94Å
80	I	95.9	Very high	94.2	Very high	99 Å²	99	82.6 Å²	82.6	51%	0.508	40%	0.404	S	S	.	.	H	α-helix	trans	-75.7	-44.8	173.7	-65.7	166	0	0	0	110.2	I76 S77 C78 S82 K83 L85	I76-I80 HydrophobicContact CG2-CD1 3.8Å; I76-I80 HydrophobicContact CG2-CG1 4.48Å; I76-I80 VanDerWaalsContact O-CG1 3.3Å; I76-I80 WeakPolarHBondContact O-CG1 3.3Å; I76-I80 PolarHBondContact O-N 3.16Å; I76-I80 VanDerWaalsContact O-N 3.09Å; S77-I80 PolarHBondContact O-N 3.02Å; C78-I80 VanDerWaalsContact C-N 3.27Å; C78-I80 PolarHBondContact O-N 3.21Å; I80-S82 PolarHBondContact O-N 3.13Å; I80-K83 PolarHBondContact O-N 2.79Å; I80-L85 HydrophobicContact CG1-CB 4.43Å
81	H	96	Very high	94	Very high	164 Å²	164	86.7 Å²	86.7	76%	0.759	42%	0.419	S	S	*	.	H	α-helix	trans	-59.9	-45.7	179.2	-176.3	75.4	0	0	0	112	S77 C78 K83	S77-H81 WeakPolarHBondContact O-CB 3.44Å; S77-H81 PolarHBondContact O-N 3.48Å; C78-H81 PolarHBondContact O-N 3.08Å; H81-K83 PolarHBondContact O-N 3.36Å; H81-K83 VanDerWaalsContact O-N 3.16Å
82	S	93.9	Very high	93.9	Very high	53 Å²	53	82.6 Å²	82.6	37%	0.371	41%	0.405	S	S	.	.	T	Hydrogen-bonded Turn	trans	-77.6	9.3	175.9	-53.1	0	0	0	0	113.9	C78 I80 V84	C78-S82 WeakPolarHBondContact O-CB 3.38Å; C78-S82 PolarHBondContact O-N 3.35Å; C78-S82 PolarHBondContact O-OG 2.95Å; I80-S82 PolarHBondContact O-N 3.13Å; S82-V84 PolarHBondContact O-N 3.41Å
83	K	93.7	Very high	93.7	Very high	160 Å²	160	84 Å²	84	70%	0.696	41%	0.408	S	S	*	.	T	Hydrogen-bonded Turn	trans	56.1	22.4	178.3	-56.1	173.3	-177.5	175.1	0	114.4	I80 H81	I80-K83 PolarHBondContact O-N 2.79Å; H81-K83 PolarHBondContact O-N 3.36Å; H81-K83 VanDerWaalsContact O-N 3.16Å
84	V	91.9	Very high	93.4	Very high	58 Å²	58	92.1 Å²	92.1	35%	0.352	44%	0.437	S	S	.	.	S	Bend	trans	-71.3	-42.7	174	178.8	0	0	0	0	109.6	V36 A79 S82	V36-V84 HydrophobicContact CG1-CG1 4.47Å; A79-V84 PolarHBondContact O-N 3Å; S82-V84 PolarHBondContact O-N 3.41Å
85	L	91.9	Very high	93.1	Very high	65 Å²	65	95.9 Å²	95.9	34%	0.34	46%	0.458	S	S	.	.	S	Bend	trans	-106.5	151.1	170.9	-80.6	164.1	0	0	0	110.3	V36 A79 I80	V36-L85 HydrophobicContact CB-CD1 4.28Å; V36-L85 HydrophobicContact CG1-CD1 4.07Å; V36-L85 HydrophobicContact CG1-CG 4.44Å; V36-L85 HydrophobicContact CG2-CD1 3.39Å; A79-L85 HydrophobicContact CB-CB 4.45Å; A79-L85 HydrophobicContact CB-CD1 3.79Å; A79-L85 HydrophobicContact CB-CG 4.37Å; A79-L85 PolarHBondContact O-N 2.94Å; I80-L85 HydrophobicContact CG1-CB 4.43Å
86	R	92	Very high	92.6	Very high	177 Å²	177	106.2 Å²	106.2	67%	0.668	50%	0.497	S	S	*	.			trans	-127.5	152.6	178.4	-67.6	173.3	173.4	129.5	-7.7	111
87	N	91.9	Very high	92.2	Very high	146 Å²	146	113.6 Å²	113.6	78%	0.781	52%	0.52	S	S	*	.			trans	-56.5	135.5	164.1	173.2	10.7	0	0	0	109
88	R	91.7	Very high	91.6	Very high	93 Å²	93	117.3 Å²	117.3	35%	0.351	53%	0.533	S	S	.	.			trans	-129.7	146.6	178.4	-80.1	-166.8	-74	164.9	-10.7	109.5	S92 R93 L95	R88-S92 WeakPolarHBondContact CB-OG 3.21Å; R88-S92 PolarHBondContact NH1-O 2.96Å; R88-R93 HydrophobicContact CB-CG 3.95Å; R88-R93 VanDerWaalsContact O-CZ 3.29Å; R88-R93 PolarHBondContact O-NE 3.04Å; R88-R93 PolarHBondContact O-NH2 3.42Å; R88-R93 VanDerWaalsContact O-NH2 3.1Å; R88-L95 PolarHBondContact NH1-O 2.79Å
89	S	93.5	Very high	90.7	Very high	74 Å²	74	123.5 Å²	123.5	52%	0.517	56%	0.563	S	S	.	*			trans	-57.9	165.3	173.2	71.3	0	0	0	0	112.3	E91 S92 R93	S89-E91 VanDerWaalsContact C-N 3.28Å; S89-E91 PolarHBondContact O-N 3.01Å; S89-S92 WeakPolarHBondContact CA-OG 3.49Å; S89-S92 PolarHBondContact N-OG 3.49Å; S89-S92 PolarHBondContact O-N 3.03Å; S89-S92 PolarHBondContact O-OG 2.72Å; S89-S92 WeakPolarHBondContact OG-CB 3.4Å; S89-S92 PolarHBondContact OG-N 3.23Å; S89-S92 PolarHBondContact OG-OG 3.29Å; S89-R93 WeakPolarHBondContact O-CG 3.36Å; S89-R93 PolarHBondContact O-N 3Å; S89-R93 VanDerWaalsContact O-N 3.12Å
90	R	91.2	Very high	89.9	Confident	199 Å²	199	129.1 Å²	129.1	75%	0.751	60%	0.597	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.3	-43.1	-176.4	-175.8	179.1	178.4	-168.9	-1.2	112.1
91	E	91.5	Very high	88.8	Confident	156 Å²	156	132 Å²	132	73%	0.729	61%	0.606	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.3	-48.2	-178.6	-64.2	173.3	168.7	0	0	111.6	S89 R93 R94	S89-E91 VanDerWaalsContact C-N 3.28Å; S89-E91 PolarHBondContact O-N 3.01Å; E91-R93 PolarHBondContact O-N 2.95Å; E91-R93 VanDerWaalsContact O-N 3.07Å; E91-R94 WeakPolarHBondContact O-CB 3.37Å; E91-R94 PolarHBondContact O-N 2.91Å
92	S	91.4	Very high	87.8	Confident	31 Å²	31	129.4 Å²	129.4	22%	0.217	60%	0.604	C	S	.	*	T	Hydrogen-bonded Turn	trans	-64.3	-17.5	-179.4	62.3	0	0	0	0	113.7	R88 S89 R94 L95	R88-S92 WeakPolarHBondContact CB-OG 3.21Å; R88-S92 PolarHBondContact NH1-O 2.96Å; S89-S92 WeakPolarHBondContact CA-OG 3.49Å; S89-S92 PolarHBondContact N-OG 3.49Å; S89-S92 PolarHBondContact O-N 3.03Å; S89-S92 PolarHBondContact O-OG 2.72Å; S89-S92 WeakPolarHBondContact OG-CB 3.4Å; S89-S92 PolarHBondContact OG-N 3.23Å; S89-S92 PolarHBondContact OG-OG 3.29Å; S92-R94 VanDerWaalsContact C-N 3.26Å; S92-R94 PolarHBondContact O-N 3.43Å; S92-L95 PolarHBondContact O-N 2.79Å
93	R	90.6	Very high	86.6	Confident	69 Å²	69	138.5 Å²	138.5	26%	0.26	63%	0.63	S	S	.	*	T	Hydrogen-bonded Turn	trans	-66	-24.2	169.7	-75.3	166.9	-166.5	167	8.4	113.6	K4 R88 S89 E91	K4-R93 VanDerWaalsContact CE-CZ 3.44Å; R88-R93 HydrophobicContact CB-CG 3.95Å; R88-R93 VanDerWaalsContact O-CZ 3.29Å; R88-R93 PolarHBondContact O-NE 3.04Å; R88-R93 PolarHBondContact O-NH2 3.42Å; R88-R93 VanDerWaalsContact O-NH2 3.1Å; S89-R93 WeakPolarHBondContact O-CG 3.36Å; S89-R93 PolarHBondContact O-N 3Å; S89-R93 VanDerWaalsContact O-N 3.12Å; E91-R93 PolarHBondContact O-N 2.95Å; E91-R93 VanDerWaalsContact O-N 3.07Å
94	R	89.6	Confident	85.5	Confident	199 Å²	199	137.1 Å²	137.1	75%	0.751	63%	0.634	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.4	-29	178.7	-64	-179.2	177	177.3	-1.4	111.5	E91 S92 R96	E91-R94 WeakPolarHBondContact O-CB 3.37Å; E91-R94 PolarHBondContact O-N 2.91Å; S92-R94 VanDerWaalsContact C-N 3.26Å; S92-R94 PolarHBondContact O-N 3.43Å; R94-R96 PolarHBondContact O-N 3.25Å
95	L	89.9	Confident	84.2	Confident	106 Å²	106	143.5 Å²	143.5	56%	0.555	66%	0.657	S	S	*	*			trans	-64.7	119.1	175.4	-64.1	170.7	0	0	0	110.6	R88 S92	R88-L95 PolarHBondContact NH1-O 2.79Å; S92-L95 PolarHBondContact O-N 2.79Å
96	R	85.9	Confident	82.9	Confident	220 Å²	220	149 Å²	149	83%	0.83	68%	0.679	S	S	*	*			trans	-102.7	4.4	178	-64.2	-173	-175.2	177.4	4.6	113.9	R94	R94-R96 PolarHBondContact O-N 3.25Å
97	R	86.9	Confident	81.7	Confident	224 Å²	224	145.5 Å²	145.5	85%	0.845	68%	0.681	S	S	*	*			trans	-63.3	139.8	177.9	-63.8	-175.7	-179.6	-177.2	-0.1	110.1
98	I	82	Confident	80.3	Confident	151 Å²	151	147.6 Å²	147.6	77%	0.774	68%	0.678	S	S	*	*			trans	-74.7	127.6	174.2	-61.6	171.6	0	0	0	107.4	V100	I98-V100 HydrophobicContact CG2-CG2 4.26Å; I98-V100 PolarHBondContact O-N 2.79Å
99	I	77.9	Confident	79.2	Confident	149 Å²	149	148.9 Å²	148.9	76%	0.764	70%	0.699	S	S	*	*			trans	-80.8	102.3	172.9	-57.6	169.1	0	0	0	106.7
100	V	78.3	Confident	77.9	Confident	118 Å²	118	151.7 Å²	151.7	72%	0.715	71%	0.712	S	S	*	*	P	Polyproline II helix	trans	-84.7	119.8	173.6	-173.1	0	0	0	0	107.3	I98	I98-V100 HydrophobicContact CG2-CG2 4.26Å; I98-V100 PolarHBondContact O-N 2.79Å
101	K	73.3	Confident	76.7	Confident	161 Å²	161	147.1 Å²	147.1	70%	0.7	71%	0.709	S	S	*	*	P	Polyproline II helix	trans	-68.8	130.6	167.8	-74	-172	176	-170.3	0	107.7	R103	K101-R103 PolarHBondContact O-N 3.12Å
102	P	75.5	Confident	75.8	Confident	109 Å²	109	145.6 Å²	145.6	71%	0.708	71%	0.712	S	S	*	*	P	Polyproline II helix	trans	-57.6	134.4	171.9	23.2	-30.5	0	0	0	108.6	V104	P102-V104 VanDerWaalsContact C-N 3.28Å; P102-V104 PolarHBondContact O-N 2.71Å
103	R	68.9	Low	74.6	Confident	243 Å²	243	154 Å²	154	92%	0.917	75%	0.745	S	S	*	*			trans	-73.3	91.9	172.3	-65.9	-169.5	-159.4	-168.7	8.1	106.9	K101 K105	K101-R103 PolarHBondContact O-N 3.12Å; R103-K105 PolarHBondContact O-N 3.19Å
104	V	70.7	Confident	73.3	Confident	131 Å²	131	159 Å²	159	79%	0.794	80%	0.801	S	S	*	*			trans	-67.3	107.3	169.2	-142.5	0	0	0	0	105.8	P102 F106	P102-V104 VanDerWaalsContact C-N 3.28Å; P102-V104 PolarHBondContact O-N 2.71Å; V104-F106 PolarHBondContact O-N 3.1Å; V104-F106 VanDerWaalsContact O-N 3.09Å
105	K	63.1	Low	72.5	Confident	193 Å²	193	157 Å²	157	84%	0.839	80%	0.804	S	S	*	*			trans	-66	108.2	166.3	-76.7	-176	178.2	-179.2	0	105	R103 S107	R103-K105 PolarHBondContact O-N 3.19Å; K105-S107 PolarHBondContact O-N 2.94Å
106	F	65.1	Low	71.6	Confident	180 Å²	180	159.7 Å²	159.7	79%	0.789	82%	0.817	S	S	*	*			trans	-70	87.2	172.2	-167.7	-92	0	0	0	107.1	V104 R108	V104-F106 PolarHBondContact O-N 3.1Å; V104-F106 VanDerWaalsContact O-N 3.09Å; F106-R108 HydrophobicContact CD1-CG 4.07Å; F106-R108 HydrophobicContact CE1-CG 4.07Å; F106-R108 PolarHBondContact O-N 3.07Å; F106-R108 VanDerWaalsContact O-N 3.15Å
107	S	67.8	Low	70.8	Confident	103 Å²	103	156.3 Å²	156.3	72%	0.72	82%	0.816	S	S	*	*			trans	-68	106.8	167.3	47.9	0	0	0	0	106.4	K105	K105-S107 PolarHBondContact O-N 2.94Å
108	R	62.7	Low	69.8	Low	190 Å²	190	152.4 Å²	152.4	72%	0.717	81%	0.814	S	S	*	*			trans	-58.1	132.7	165.3	-65.9	-177.7	-178.9	-175.1	0.6	106.6	F106 V110	F106-R108 HydrophobicContact CD1-CG 4.07Å; F106-R108 HydrophobicContact CE1-CG 4.07Å; F106-R108 PolarHBondContact O-N 3.07Å; F106-R108 VanDerWaalsContact O-N 3.15Å; R108-V110 PolarHBondContact O-N 3.37Å
109	P	67	Low	69.1	Low	120 Å²	120	152.4 Å²	152.4	78%	0.779	82%	0.817	S	S	*	*			trans	-59	114.8	169.4	23.8	-29.8	0	0	0	107
110	V	66.3	Low	68.5	Low	133 Å²	133	152.7 Å²	152.7	81%	0.806	82%	0.82	S	S	*	*	P	Polyproline II helix	trans	-77.3	122.7	174.2	-151.7	0	0	0	0	105.2	R108	R108-V110 PolarHBondContact O-N 3.37Å
111	P	66.1	Low	67.8	Low	104 Å²	104	155.1 Å²	155.1	68%	0.675	83%	0.828	S	S	*	*	P	Polyproline II helix	trans	-59.2	142.4	175.6	24.6	-32.2	0	0	0	108.9	K113	P111-K113 PolarHBondContact O-N 3.45Å
112	P	72.3	Confident	67.4	Low	123 Å²	123	154.7 Å²	154.7	80%	0.799	84%	0.837	S	S	*	*	P	Polyproline II helix	trans	-56.7	132.3	175	25.1	-32.2	0	0	0	108.2	A114	P112-A114 PolarHBondContact O-N 3.3Å
113	K	67.1	Low	66.7	Low	208 Å²	208	158.5 Å²	158.5	90%	0.904	85%	0.848	S	S	*	*	P	Polyproline II helix	trans	-61.3	121.5	169.1	-74.9	-177.2	175	-176.6	0	106.6	P111	P111-K113 PolarHBondContact O-N 3.45Å
114	A	63.1	Low	66.5	Low	174 Å²	174	150.8 Å²	150.8	100%	1.438	84%	0.842	S	S	*	*			trans	-58.8	0	168.9	0	0	0	0	0	110.5	P112	P112-A114 PolarHBondContact O-N 3.3Å

Retrieved 114 of 114 residues in 129.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).