A0AA82MRD3_SCHMA Loading...

Uncharacterized protein AlphaSync

AlphaFold DB , UniProt , Accession A0AA82MRD3, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 77 aa.

						>A0AA82MRD3_SCHMA|A0AA82MRD3
MSKDKADDVLRHFIKHTEKSNVRRSVIVQATNRKVSKIALVAFGFAFASYFYSLYAIKRNRELGTSFDQLPPYTSSE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	66.8	Low	91.2	Very high	205 Å²	205	115.4 Å²	115.4	100%	1.01	58%	0.58	S	S	*	*				0	128	0	-155.8	127.1	93.7	0	0	107	K5	M1-K5 HydrophobicContact CG-CB 4.29Å
2	S	88.2	Confident	91.6	Very high	64 Å²	64	116.2 Å²	116.2	45%	0.448	58%	0.58	S	S	.	*			trans	-61.9	141.1	176	-173.3	0	0	0	0	109.4	D4 K5 A6	S2-D4 PolarHBondContact O-N 2.98Å; S2-D4 PolarHBondContact OG-OD2 3.07Å; S2-K5 PolarHBondContact O-N 3.15Å; S2-A6 PolarHBondContact O-N 3.21Å
3	K	91.1	Very high	91.8	Very high	162 Å²	162	117.1 Å²	117.1	70%	0.704	58%	0.579	S	S	*	*	H	α-helix	trans	-52.6	-39.5	178.1	-172.5	172.5	176.3	168	0	111.3	K5 A6 D7	K3-K5 VanDerWaalsContact C-N 3.31Å; K3-K5 PolarHBondContact O-N 3.43Å; K3-A6 WeakPolarHBondContact O-CB 3.35Å; K3-A6 PolarHBondContact O-N 3.12Å; K3-A6 VanDerWaalsContact O-N 3.1Å; K3-D7 PolarHBondContact O-N 3.31Å
4	D	93.2	Very high	92.1	Very high	119 Å²	119	115.3 Å²	115.3	64%	0.636	57%	0.571	S	S	*	*	H	α-helix	trans	-60.2	-37.6	177.9	-46.2	-43.7	0	0	0	113	S2 D7 D8	S2-D4 PolarHBondContact O-N 2.98Å; S2-D4 PolarHBondContact OG-OD2 3.07Å; D4-D7 PolarHBondContact O-N 3.39Å; D4-D8 PolarHBondContact O-N 3.19Å
5	K	93.5	Very high	92.4	Very high	146 Å²	146	116 Å²	116	64%	0.635	57%	0.57	S	S	*	*	H	α-helix	trans	-68.9	-38	177.4	-67.5	-159.8	-179.8	-168	0	111.3	M1 S2 K3 D8 V9	M1-K5 HydrophobicContact CG-CB 4.29Å; S2-K5 PolarHBondContact O-N 3.15Å; K3-K5 VanDerWaalsContact C-N 3.31Å; K3-K5 PolarHBondContact O-N 3.43Å; K5-D8 PolarHBondContact O-N 3.27Å; K5-V9 WeakPolarHBondContact O-CG2 3.3Å; K5-V9 PolarHBondContact O-N 3.43Å; K5-V9 VanDerWaalsContact O-N 3.14Å
6	A	94	Very high	92.5	Very high	44 Å²	44	116.8 Å²	116.8	36%	0.364	57%	0.571	S	S	.	*	H	α-helix	trans	-65.5	-41.5	176.9	0	0	0	0	0	111.2	S2 K3 V9 L10	S2-A6 PolarHBondContact O-N 3.21Å; K3-A6 WeakPolarHBondContact O-CB 3.35Å; K3-A6 PolarHBondContact O-N 3.12Å; K3-A6 VanDerWaalsContact O-N 3.1Å; A6-V9 PolarHBondContact O-N 3.3Å; A6-L10 WeakPolarHBondContact O-CB 3.39Å; A6-L10 PolarHBondContact O-N 3.3Å
7	D	94.7	Very high	92.7	Very high	69 Å²	69	115.1 Å²	115.1	37%	0.369	57%	0.569	S	S	.	*	H	α-helix	trans	-64.8	-38.8	177	-71.1	-17.1	0	0	0	112.2	K3 D4 L10 R11	K3-D7 PolarHBondContact O-N 3.31Å; D4-D7 PolarHBondContact O-N 3.39Å; D7-L10 PolarHBondContact O-N 2.9Å; D7-R11 WeakPolarHBondContact O-CB 3.04Å; D7-R11 WeakPolarHBondContact O-CG 3.31Å; D7-R11 PolarHBondContact O-N 3.47Å
8	D	95.3	Very high	92.9	Very high	112 Å²	112	115.2 Å²	115.2	60%	0.599	57%	0.568	S	S	*	*	H	α-helix	trans	-64.6	-46.8	176	-173	34.6	0	0	0	112.2	D4 K5 L10 R11 H12	D4-D8 PolarHBondContact O-N 3.19Å; K5-D8 PolarHBondContact O-N 3.27Å; D8-L10 VanDerWaalsContact C-N 3.33Å; D8-L10 PolarHBondContact O-N 3.07Å; D8-R11 PolarHBondContact O-N 3.49Å; D8-H12 PolarHBondContact O-N 3.41Å
9	V	94.9	Very high	93	Very high	72 Å²	72	116.6 Å²	116.6	44%	0.436	57%	0.571	S	S	.	*	H	α-helix	trans	-60	-44.2	175	172.9	0	0	0	0	111.1	K5 A6 H12 F13	K5-V9 WeakPolarHBondContact O-CG2 3.3Å; K5-V9 PolarHBondContact O-N 3.43Å; K5-V9 VanDerWaalsContact O-N 3.14Å; A6-V9 PolarHBondContact O-N 3.3Å; V9-H12 WeakPolarHBondContact O-CB 3.47Å; V9-H12 PolarHBondContact O-N 3.29Å; V9-F13 HydrophobicContact CG1-CD2 3.64Å; V9-F13 HydrophobicContact CG1-CE2 3.37Å; V9-F13 WeakPolarHBondContact O-CD2 3.43Å; V9-F13 PolarHBondContact O-N 2.87Å
10	L	95.6	Very high	93	Very high	97 Å²	97	113.3 Å²	113.3	51%	0.508	56%	0.56	S	S	.	*	H	α-helix	trans	-61.2	-46	177.1	179.1	61.8	0	0	0	111.5	A6 D7 D8 H12 F13 I14	A6-L10 WeakPolarHBondContact O-CB 3.39Å; A6-L10 PolarHBondContact O-N 3.3Å; D7-L10 PolarHBondContact O-N 2.9Å; D8-L10 VanDerWaalsContact C-N 3.33Å; D8-L10 PolarHBondContact O-N 3.07Å; L10-H12 VanDerWaalsContact C-N 3.28Å; L10-H12 PolarHBondContact O-N 3.37Å; L10-F13 PolarHBondContact O-N 3.31Å; L10-I14 HydrophobicContact CD1-CD1 4.01Å; L10-I14 HydrophobicContact CD1-CG1 4.18Å; L10-I14 HydrophobicContact CD2-CD1 4.38Å; L10-I14 HydrophobicContact CG-CD1 3.75Å; L10-I14 HydrophobicContact CG-CG1 4.35Å; L10-I14 VanDerWaalsContact O-CG1 3.29Å; L10-I14 WeakPolarHBondContact O-CG1 3.07Å; L10-I14 PolarHBondContact O-N 3.31Å
11	R	96	Very high	93.1	Very high	179 Å²	179	112.7 Å²	112.7	68%	0.675	56%	0.558	S	S	*	*	H	α-helix	trans	-58.8	-40	176.3	-75.9	169.9	-176.2	-82	0.3	111.8	D7 D8 K15	D7-R11 WeakPolarHBondContact O-CB 3.04Å; D7-R11 WeakPolarHBondContact O-CG 3.31Å; D7-R11 PolarHBondContact O-N 3.47Å; D8-R11 PolarHBondContact O-N 3.49Å; R11-K15 VanDerWaalsContact O-CB 3.28Å; R11-K15 WeakPolarHBondContact O-CB 3.38Å; R11-K15 PolarHBondContact O-N 3.48Å
12	H	95.3	Very high	94.5	Very high	125 Å²	125	106.6 Å²	106.6	58%	0.579	53%	0.533	S	S	*	.	H	α-helix	trans	-63.1	-46.2	176.2	-175.2	-91.1	0	0	0	111.9	D8 V9 L10 K15 H16	D8-H12 PolarHBondContact O-N 3.41Å; V9-H12 WeakPolarHBondContact O-CB 3.47Å; V9-H12 PolarHBondContact O-N 3.29Å; L10-H12 VanDerWaalsContact C-N 3.28Å; L10-H12 PolarHBondContact O-N 3.37Å; H12-K15 PolarHBondContact O-N 3.46Å; H12-H16 WeakPolarHBondContact O-CB 3.42Å; H12-H16 PolarHBondContact O-N 3.26Å
13	F	95.4	Very high	94.8	Very high	128 Å²	128	112.6 Å²	112.6	56%	0.561	55%	0.546	S	S	*	.	H	α-helix	trans	-66	-40.7	177.1	-77	-64.1	0	0	0	113.1	V9 L10 H16 T17	V9-F13 HydrophobicContact CG1-CD2 3.64Å; V9-F13 HydrophobicContact CG1-CE2 3.37Å; V9-F13 WeakPolarHBondContact O-CD2 3.43Å; V9-F13 PolarHBondContact O-N 2.87Å; L10-F13 PolarHBondContact O-N 3.31Å; F13-H16 PolarHBondContact O-N 3.26Å; F13-T17 WeakPolarHBondContact O-CB 3.17Å; F13-T17 PolarHBondContact O-N 3.04Å; F13-T17 PolarHBondContact O-OG1 3.31Å
14	I	96	Very high	95	Very high	92 Å²	92	113.1 Å²	113.1	47%	0.472	54%	0.543	S	S	.	.	H	α-helix	trans	-59.5	-52.1	174.5	-70.4	169.1	0	0	0	109.6	L10 H16 T17 E18	L10-I14 HydrophobicContact CD1-CD1 4.01Å; L10-I14 HydrophobicContact CD1-CG1 4.18Å; L10-I14 HydrophobicContact CD2-CD1 4.38Å; L10-I14 HydrophobicContact CG-CD1 3.75Å; L10-I14 HydrophobicContact CG-CG1 4.35Å; L10-I14 VanDerWaalsContact O-CG1 3.29Å; L10-I14 WeakPolarHBondContact O-CG1 3.07Å; L10-I14 PolarHBondContact O-N 3.31Å; I14-H16 VanDerWaalsContact C-N 3.27Å; I14-H16 PolarHBondContact O-N 3.47Å; I14-T17 PolarHBondContact O-N 3.39Å; I14-T17 VanDerWaalsContact O-N 3.1Å; I14-E18 WeakPolarHBondContact O-CB 3.42Å; I14-E18 PolarHBondContact O-N 3.09Å
15	K	95.9	Very high	95.1	Very high	126 Å²	126	109.6 Å²	109.6	55%	0.548	53%	0.528	S	S	.	.	H	α-helix	trans	-60.6	-37	-179.9	-172.8	174.9	-174.6	175.9	0	112.1	R11 H12 K19	R11-K15 VanDerWaalsContact O-CB 3.28Å; R11-K15 WeakPolarHBondContact O-CB 3.38Å; R11-K15 PolarHBondContact O-N 3.48Å; H12-K15 PolarHBondContact O-N 3.46Å; K15-K19 WeakPolarHBondContact O-CG 3.5Å; K15-K19 PolarHBondContact O-N 3.06Å
16	H	94.3	Very high	95.3	Very high	129 Å²	129	106.7 Å²	106.7	60%	0.597	52%	0.522	S	S	*	.	H	α-helix	trans	-67	-43.5	175.5	-167.2	86.6	0	0	0	111.8	H12 F13 I14 S20	H12-H16 WeakPolarHBondContact O-CB 3.42Å; H12-H16 PolarHBondContact O-N 3.26Å; F13-H16 PolarHBondContact O-N 3.26Å; I14-H16 VanDerWaalsContact C-N 3.27Å; I14-H16 PolarHBondContact O-N 3.47Å; H16-S20 PolarHBondContact O-N 3.04Å
17	T	95.2	Very high	95.4	Very high	87 Å²	87	109.1 Å²	109.1	53%	0.534	53%	0.528	S	S	.	.	H	α-helix	trans	-70	-40.4	-179.5	-56.1	0	0	0	0	111.8	F13 I14 S20 N21	F13-T17 WeakPolarHBondContact O-CB 3.17Å; F13-T17 PolarHBondContact O-N 3.04Å; F13-T17 PolarHBondContact O-OG1 3.31Å; I14-T17 PolarHBondContact O-N 3.39Å; I14-T17 VanDerWaalsContact O-N 3.1Å; T17-S20 PolarHBondContact O-N 3.4Å; T17-N21 WeakPolarHBondContact O-CB 3.48Å; T17-N21 PolarHBondContact O-N 3.33Å
18	E	96	Very high	95.5	Very high	118 Å²	118	109.6 Å²	109.6	55%	0.551	53%	0.533	S	S	*	.	H	α-helix	trans	-59.5	-49.1	176.8	-176	-177.7	-169.5	0	0	111	I14 S20 N21 V22	I14-E18 WeakPolarHBondContact O-CB 3.42Å; I14-E18 PolarHBondContact O-N 3.09Å; E18-S20 VanDerWaalsContact C-N 3.28Å; E18-S20 PolarHBondContact O-N 3.28Å; E18-N21 PolarHBondContact O-N 3.48Å; E18-N21 VanDerWaalsContact O-N 3.12Å; E18-V22 HydrophobicContact CG-CG2 4.34Å; E18-V22 VanDerWaalsContact O-CG2 3.31Å; E18-V22 WeakPolarHBondContact O-CG2 3.09Å; E18-V22 PolarHBondContact O-N 2.83Å
19	K	94.6	Very high	95.6	Very high	142 Å²	142	109.3 Å²	109.3	62%	0.617	53%	0.528	S	S	*	.	H	α-helix	trans	-56.9	-41.7	176.6	-74.2	180	179.6	-171.7	0	112.4	K15 R23	K15-K19 WeakPolarHBondContact O-CG 3.5Å; K15-K19 PolarHBondContact O-N 3.06Å; K19-R23 PolarHBondContact O-N 3.41Å
20	S	93.9	Very high	95.7	Very high	50 Å²	50	108 Å²	108	35%	0.35	53%	0.525	S	S	.	.	H	α-helix	trans	-66.7	-42.8	176.6	-173.5	0	0	0	0	111.8	H16 T17 E18 R23 R24	H16-S20 PolarHBondContact O-N 3.04Å; T17-S20 PolarHBondContact O-N 3.4Å; E18-S20 VanDerWaalsContact C-N 3.28Å; E18-S20 PolarHBondContact O-N 3.28Å; S20-R23 PolarHBondContact O-N 3.39Å; S20-R24 WeakPolarHBondContact O-CG 3.41Å; S20-R24 PolarHBondContact O-N 2.98Å; S20-R24 VanDerWaalsContact O-N 3.13Å
21	N	95.5	Very high	95.7	Very high	100 Å²	100	106.6 Å²	106.6	54%	0.535	52%	0.521	S	S	.	.	H	α-helix	trans	-66.6	-43.6	179.4	-166.7	-2.5	0	0	0	112.1	T17 E18 R23 R24 S25	T17-N21 WeakPolarHBondContact O-CB 3.48Å; T17-N21 PolarHBondContact O-N 3.33Å; E18-N21 PolarHBondContact O-N 3.48Å; E18-N21 VanDerWaalsContact O-N 3.12Å; N21-R23 VanDerWaalsContact C-N 3.3Å; N21-R23 PolarHBondContact O-N 2.78Å; N21-R24 WeakPolarHBondContact O-CB 3.5Å; N21-R24 PolarHBondContact O-N 3.03Å; N21-R24 VanDerWaalsContact O-N 3.12Å; N21-S25 PolarHBondContact O-N 3.23Å
22	V	96	Very high	95.8	Very high	78 Å²	78	102.9 Å²	102.9	47%	0.473	51%	0.514	S	S	.	.	H	α-helix	trans	-58.1	-43.3	176	172.1	0	0	0	0	111	E18 R24 S25 V26	E18-V22 HydrophobicContact CG-CG2 4.34Å; E18-V22 VanDerWaalsContact O-CG2 3.31Å; E18-V22 WeakPolarHBondContact O-CG2 3.09Å; E18-V22 PolarHBondContact O-N 2.83Å; V22-R24 VanDerWaalsContact C-N 3.35Å; V22-R24 PolarHBondContact O-N 3.49Å; V22-S25 PolarHBondContact O-N 2.87Å; V22-S25 PolarHBondContact O-OG 2.93Å; V22-V26 WeakPolarHBondContact O-CG2 3.36Å; V22-V26 PolarHBondContact O-N 3.42Å
23	R	94.8	Very high	95.9	Very high	189 Å²	189	105.2 Å²	105.2	71%	0.713	52%	0.518	S	S	*	.	H	α-helix	trans	-63	-42.3	176.9	-171.8	175.3	-177.4	179.1	1	111.9	K19 S20 N21 I27	K19-R23 PolarHBondContact O-N 3.41Å; S20-R23 PolarHBondContact O-N 3.39Å; N21-R23 VanDerWaalsContact C-N 3.3Å; N21-R23 PolarHBondContact O-N 2.78Å; R23-I27 HydrophobicContact CG-CD1 4.17Å; R23-I27 WeakPolarHBondContact O-CG1 3.49Å; R23-I27 PolarHBondContact O-N 2.88Å
24	R	95.6	Very high	96	Very high	174 Å²	174	105.8 Å²	105.8	66%	0.657	52%	0.52	S	S	*	.	H	α-helix	trans	-63.5	-44.7	176.7	-70.5	175.4	-179.1	-175.9	0.7	111.3	S20 N21 V22 V26 I27 V28	S20-R24 WeakPolarHBondContact O-CG 3.41Å; S20-R24 PolarHBondContact O-N 2.98Å; S20-R24 VanDerWaalsContact O-N 3.13Å; N21-R24 WeakPolarHBondContact O-CB 3.5Å; N21-R24 PolarHBondContact O-N 3.03Å; N21-R24 VanDerWaalsContact O-N 3.12Å; V22-R24 VanDerWaalsContact C-N 3.35Å; V22-R24 PolarHBondContact O-N 3.49Å; R24-V26 PolarHBondContact O-N 2.85Å; R24-I27 PolarHBondContact O-N 3.4Å; R24-V28 VanDerWaalsContact O-CG2 3.31Å; R24-V28 WeakPolarHBondContact O-CG2 3.11Å; R24-V28 PolarHBondContact O-N 3.21Å
25	S	95.4	Very high	96.1	Very high	44 Å²	44	105.5 Å²	105.5	31%	0.308	52%	0.522	S	S	.	.	H	α-helix	trans	-64.6	-39.9	-178.7	75.8	0	0	0	0	112.1	N21 V22 V28 Q29	N21-S25 PolarHBondContact O-N 3.23Å; V22-S25 PolarHBondContact O-N 2.87Å; V22-S25 PolarHBondContact O-OG 2.93Å; S25-V28 PolarHBondContact O-N 2.95Å; S25-Q29 WeakPolarHBondContact O-CB 3.38Å; S25-Q29 VanDerWaalsContact O-CG 3.26Å; S25-Q29 WeakPolarHBondContact O-CG 3.48Å; S25-Q29 PolarHBondContact O-N 2.85Å
26	V	96.6	Very high	96.2	Very high	86 Å²	86	102.6 Å²	102.6	52%	0.521	52%	0.518	S	S	.	.	H	α-helix	trans	-63.6	-44.6	176	171.4	0	0	0	0	111.5	V22 R24 Q29 A30	V22-V26 WeakPolarHBondContact O-CG2 3.36Å; V22-V26 PolarHBondContact O-N 3.42Å; R24-V26 PolarHBondContact O-N 2.85Å; V26-Q29 PolarHBondContact O-N 3.38Å; V26-A30 WeakPolarHBondContact O-CB 3.45Å; V26-A30 PolarHBondContact O-N 3.23Å
27	I	96.1	Very high	96.3	Very high	94 Å²	94	103.5 Å²	103.5	48%	0.482	52%	0.52	S	S	.	.	H	α-helix	trans	-63.5	-46.2	178.3	-67.5	166.9	0	0	0	110.5	R23 R24 Q29 A30 T31	R23-I27 HydrophobicContact CG-CD1 4.17Å; R23-I27 WeakPolarHBondContact O-CG1 3.49Å; R23-I27 PolarHBondContact O-N 2.88Å; R24-I27 PolarHBondContact O-N 3.4Å; I27-Q29 PolarHBondContact O-N 2.98Å; I27-A30 PolarHBondContact O-N 3.01Å; I27-T31 WeakPolarHBondContact O-CB 3.35Å; I27-T31 PolarHBondContact O-N 2.84Å; I27-T31 PolarHBondContact O-OG1 2.86Å; I27-T31 VanDerWaalsContact O-OG1 3.04Å
28	V	97.1	Very high	96.5	Very high	80 Å²	80	105.1 Å²	105.1	49%	0.485	52%	0.524	S	S	.	.	H	α-helix	trans	-60.7	-46.2	177.9	170.6	0	0	0	0	110.9	R24 S25 A30 T31 N32	R24-V28 VanDerWaalsContact O-CG2 3.31Å; R24-V28 WeakPolarHBondContact O-CG2 3.11Å; R24-V28 PolarHBondContact O-N 3.21Å; S25-V28 PolarHBondContact O-N 2.95Å; V28-A30 PolarHBondContact O-N 3.38Å; V28-T31 PolarHBondContact O-N 2.9Å; V28-N32 WeakPolarHBondContact O-CB 3.38Å; V28-N32 PolarHBondContact O-N 3.5Å; V28-N32 PolarHBondContact O-OD1 3.35Å
29	Q	97.2	Very high	96.6	Very high	106 Å²	106	101.4 Å²	101.4	50%	0.495	51%	0.513	S	S	.	.	H	α-helix	trans	-61.4	-43.8	177.1	-75.6	-177	55	0	0	112.3	S25 V26 I27 T31 N32 R33	S25-Q29 WeakPolarHBondContact O-CB 3.38Å; S25-Q29 VanDerWaalsContact O-CG 3.26Å; S25-Q29 WeakPolarHBondContact O-CG 3.48Å; S25-Q29 PolarHBondContact O-N 2.85Å; V26-Q29 PolarHBondContact O-N 3.38Å; I27-Q29 PolarHBondContact O-N 2.98Å; Q29-T31 VanDerWaalsContact C-N 3.35Å; Q29-N32 PolarHBondContact O-N 3.3Å; Q29-R33 VanDerWaalsContact O-CG 3.3Å; Q29-R33 WeakPolarHBondContact O-CG 3.33Å; Q29-R33 PolarHBondContact O-N 3.06Å
30	A	96.6	Very high	96.8	Very high	43 Å²	43	100.3 Å²	100.3	36%	0.355	51%	0.514	S	S	.	.	H	α-helix	trans	-63	-42.3	177.7	0	0	0	0	0	111.6	V26 I27 V28 R33 K34	V26-A30 WeakPolarHBondContact O-CB 3.45Å; V26-A30 PolarHBondContact O-N 3.23Å; I27-A30 PolarHBondContact O-N 3.01Å; V28-A30 PolarHBondContact O-N 3.38Å; A30-R33 PolarHBondContact O-N 3.24Å; A30-K34 WeakPolarHBondContact O-CG 3.38Å; A30-K34 PolarHBondContact O-N 3.16Å; A30-K34 VanDerWaalsContact O-N 3.14Å
31	T	96.6	Very high	97	Very high	69 Å²	69	103 Å²	103	42%	0.423	53%	0.528	S	S	.	.	H	α-helix	trans	-66	-46	177.1	-61.9	0	0	0	0	111.5	I27 V28 Q29 R33 K34 V35	I27-T31 WeakPolarHBondContact O-CB 3.35Å; I27-T31 PolarHBondContact O-N 2.84Å; I27-T31 PolarHBondContact O-OG1 2.86Å; I27-T31 VanDerWaalsContact O-OG1 3.04Å; V28-T31 PolarHBondContact O-N 2.9Å; Q29-T31 VanDerWaalsContact C-N 3.35Å; T31-R33 VanDerWaalsContact C-N 3.29Å; T31-R33 PolarHBondContact O-N 3.24Å; T31-K34 WeakPolarHBondContact O-CB 3.3Å; T31-K34 PolarHBondContact O-N 3.41Å; T31-V35 HydrophobicContact CG2-CG2 4.28Å; T31-V35 WeakPolarHBondContact O-CG2 3.34Å; T31-V35 PolarHBondContact O-N 2.95Å
32	N	97.3	Very high	97.2	Very high	100 Å²	100	101 Å²	101	54%	0.535	53%	0.526	S	S	.	.	H	α-helix	trans	-59.7	-39.8	177.8	-71.6	-4.6	0	0	0	111.9	V28 Q29 K34 V35 S36	V28-N32 WeakPolarHBondContact O-CB 3.38Å; V28-N32 PolarHBondContact O-N 3.5Å; V28-N32 PolarHBondContact O-OD1 3.35Å; Q29-N32 PolarHBondContact O-N 3.3Å; N32-K34 PolarHBondContact O-N 3.46Å; N32-V35 PolarHBondContact O-N 3.47Å; N32-S36 WeakPolarHBondContact O-CB 3.39Å; N32-S36 PolarHBondContact O-N 3.38Å
33	R	97.6	Very high	97.3	Very high	174 Å²	174	103.5 Å²	103.5	66%	0.657	53%	0.53	S	S	*	.	H	α-helix	trans	-62.8	-40.4	174.2	-72.6	175.8	-175.1	-81.9	1.8	112.1	Q29 A30 T31 K37	Q29-R33 VanDerWaalsContact O-CG 3.3Å; Q29-R33 WeakPolarHBondContact O-CG 3.33Å; Q29-R33 PolarHBondContact O-N 3.06Å; A30-R33 PolarHBondContact O-N 3.24Å; T31-R33 VanDerWaalsContact C-N 3.29Å; T31-R33 PolarHBondContact O-N 3.24Å; R33-K37 WeakPolarHBondContact O-CG 3.41Å; R33-K37 PolarHBondContact O-N 2.92Å; R33-K37 VanDerWaalsContact O-N 3.16Å
34	K	97.1	Very high	97.5	Very high	140 Å²	140	96.3 Å²	96.3	61%	0.609	52%	0.515	S	S	*	.	H	α-helix	trans	-66.4	-46.4	176.4	-69.8	174.8	-176.5	-175.5	0	111.5	A30 T31 N32 S36 K37 I38	A30-K34 WeakPolarHBondContact O-CG 3.38Å; A30-K34 PolarHBondContact O-N 3.16Å; A30-K34 VanDerWaalsContact O-N 3.14Å; T31-K34 WeakPolarHBondContact O-CB 3.3Å; T31-K34 PolarHBondContact O-N 3.41Å; N32-K34 PolarHBondContact O-N 3.46Å; K34-S36 VanDerWaalsContact C-N 3.35Å; K34-S36 PolarHBondContact O-N 3.29Å; K34-K37 PolarHBondContact O-N 3.14Å; K34-I38 WeakPolarHBondContact O-CG1 3.26Å; K34-I38 PolarHBondContact O-N 3.04Å
35	V	97.8	Very high	97.6	Very high	86 Å²	86	95.6 Å²	95.6	52%	0.521	52%	0.517	S	S	.	.	H	α-helix	trans	-60.2	-44.9	177.9	172.7	0	0	0	0	110.9	T31 N32 K37 I38 A39	T31-V35 HydrophobicContact CG2-CG2 4.28Å; T31-V35 WeakPolarHBondContact O-CG2 3.34Å; T31-V35 PolarHBondContact O-N 2.95Å; N32-V35 PolarHBondContact O-N 3.47Å; V35-K37 VanDerWaalsContact C-N 3.34Å; V35-K37 PolarHBondContact O-N 3.49Å; V35-I38 PolarHBondContact O-N 3.48Å; V35-A39 WeakPolarHBondContact O-CB 3.39Å; V35-A39 PolarHBondContact O-N 2.86Å
36	S	98	Very high	97.7	Very high	66 Å²	66	96.1 Å²	96.1	46%	0.462	52%	0.524	S	S	.	.	H	α-helix	trans	-60.5	-41.2	177	177.1	0	0	0	0	112.4	N32 K34 A39 L40	N32-S36 WeakPolarHBondContact O-CB 3.39Å; N32-S36 PolarHBondContact O-N 3.38Å; K34-S36 VanDerWaalsContact C-N 3.35Å; K34-S36 PolarHBondContact O-N 3.29Å; S36-A39 PolarHBondContact O-N 3.46Å; S36-L40 WeakPolarHBondContact O-CG 3.44Å; S36-L40 PolarHBondContact O-N 2.91Å
37	K	98.3	Very high	97.8	Very high	148 Å²	148	97.6 Å²	97.6	64%	0.643	52%	0.523	S	S	*	.	H	α-helix	trans	-62.2	-45.5	174.8	-72.1	179.8	-169.9	-169.3	0	112.3	R33 K34 V35 A39 L40 V41	R33-K37 WeakPolarHBondContact O-CG 3.41Å; R33-K37 PolarHBondContact O-N 2.92Å; R33-K37 VanDerWaalsContact O-N 3.16Å; K34-K37 PolarHBondContact O-N 3.14Å; V35-K37 VanDerWaalsContact C-N 3.34Å; V35-K37 PolarHBondContact O-N 3.49Å; K37-A39 VanDerWaalsContact C-N 3.31Å; K37-A39 PolarHBondContact O-N 3.31Å; K37-L40 PolarHBondContact O-N 3.46Å; K37-V41 WeakPolarHBondContact O-CG2 3.31Å; K37-V41 PolarHBondContact O-N 2.91Å
38	I	98.4	Very high	97.9	Very high	121 Å²	121	95.8 Å²	95.8	62%	0.621	52%	0.523	S	S	*	.	H	α-helix	trans	-61.7	-43.6	178.4	-65.8	165.7	0	0	0	110.2	K34 V35 L40 V41 A42	K34-I38 WeakPolarHBondContact O-CG1 3.26Å; K34-I38 PolarHBondContact O-N 3.04Å; V35-I38 PolarHBondContact O-N 3.48Å; I38-L40 PolarHBondContact O-N 3.04Å; I38-V41 PolarHBondContact O-N 3.32Å; I38-A42 WeakPolarHBondContact O-CB 3.32Å; I38-A42 PolarHBondContact O-N 2.88Å
39	A	98.4	Very high	97.9	Very high	39 Å²	39	95 Å²	95	32%	0.322	52%	0.521	S	S	.	.	H	α-helix	trans	-59.5	-47.6	176.1	0	0	0	0	0	111.4	V35 S36 K37 V41 A42 F43	V35-A39 WeakPolarHBondContact O-CB 3.39Å; V35-A39 PolarHBondContact O-N 2.86Å; S36-A39 PolarHBondContact O-N 3.46Å; K37-A39 VanDerWaalsContact C-N 3.31Å; K37-A39 PolarHBondContact O-N 3.31Å; A39-V41 VanDerWaalsContact C-N 3.32Å; A39-V41 PolarHBondContact O-N 2.9Å; A39-A42 PolarHBondContact O-N 3.21Å; A39-F43 HydrophobicContact CB-CD2 4.41Å; A39-F43 HydrophobicContact CB-CE2 4.43Å; A39-F43 WeakPolarHBondContact O-CB 3.5Å; A39-F43 WeakPolarHBondContact O-CD2 3.4Å; A39-F43 PolarHBondContact O-N 3.42Å
40	L	98.6	Very high	97.8	Very high	119 Å²	119	97.1 Å²	97.1	62%	0.623	53%	0.525	S	S	*	.	H	α-helix	trans	-59.8	-40.5	177.6	-73.8	174.8	0	0	0	112.7	S36 K37 I38 G44	S36-L40 WeakPolarHBondContact O-CG 3.44Å; S36-L40 PolarHBondContact O-N 2.91Å; K37-L40 PolarHBondContact O-N 3.46Å; I38-L40 PolarHBondContact O-N 3.04Å; L40-G44 PolarHBondContact O-N 3.31Å
41	V	98.6	Very high	97.7	Very high	108 Å²	108	100.8 Å²	100.8	66%	0.655	53%	0.533	S	S	*	.	H	α-helix	trans	-65.3	-44.6	176.3	172.3	0	0	0	0	110.8	K37 I38 A39 G44 F45	K37-V41 WeakPolarHBondContact O-CG2 3.31Å; K37-V41 PolarHBondContact O-N 2.91Å; I38-V41 PolarHBondContact O-N 3.32Å; A39-V41 VanDerWaalsContact C-N 3.32Å; A39-V41 PolarHBondContact O-N 2.9Å; V41-G44 PolarHBondContact O-N 3.43Å; V41-F45 WeakPolarHBondContact O-CB 3.28Å; V41-F45 PolarHBondContact O-N 2.97Å
42	A	98.5	Very high	97.6	Very high	58 Å²	58	104.7 Å²	104.7	48%	0.479	54%	0.541	S	S	.	.	H	α-helix	trans	-63.3	-46.2	178.3	0	0	0	0	0	112.1	I38 A39 F45 A46	I38-A42 WeakPolarHBondContact O-CB 3.32Å; I38-A42 PolarHBondContact O-N 2.88Å; A39-A42 PolarHBondContact O-N 3.21Å; A42-F45 PolarHBondContact O-N 3.45Å; A42-A46 WeakPolarHBondContact O-CB 3.35Å; A42-A46 PolarHBondContact O-N 3.32Å
43	F	98.5	Very high	97.4	Very high	130 Å²	130	102.6 Å²	102.6	57%	0.57	54%	0.535	S	S	*	.	H	α-helix	trans	-61.4	-46	174.1	-80.2	-66.5	0	0	0	111.3	A39 F45 A46 F47	A39-F43 HydrophobicContact CB-CD2 4.41Å; A39-F43 HydrophobicContact CB-CE2 4.43Å; A39-F43 WeakPolarHBondContact O-CB 3.5Å; A39-F43 WeakPolarHBondContact O-CD2 3.4Å; A39-F43 PolarHBondContact O-N 3.42Å; F43-F45 VanDerWaalsContact C-N 3.32Å; F43-F45 PolarHBondContact O-N 3.48Å; F43-A46 PolarHBondContact O-N 3.45Å; F43-F47 HydrophobicContact CB-CD2 4.37Å; F43-F47 HydrophobicContact CB-CE2 4.3Å; F43-F47 HydrophobicContact CD1-CE2 4.27Å; F43-F47 WeakPolarHBondContact O-CD2 3.31Å; F43-F47 PolarHBondContact O-N 3.04Å
44	G	98.5	Very high	97.1	Very high	38 Å²	38	98.9 Å²	98.9	39%	0.392	53%	0.528	S	S	.	.	H	α-helix	trans	-57.8	-43.7	177.2	0	0	0	0	0	112.4	L40 V41 A48	L40-G44 PolarHBondContact O-N 3.31Å; V41-G44 PolarHBondContact O-N 3.43Å; G44-A48 WeakPolarHBondContact O-CB 3.37Å; G44-A48 PolarHBondContact O-N 3.43Å
45	F	98.3	Very high	96.7	Very high	158 Å²	158	98.8 Å²	98.8	69%	0.693	52%	0.524	S	S	*	.	H	α-helix	trans	-64.6	-44	176	-177.3	-100.6	0	0	0	112.4	V41 A42 F43 A48 S49	V41-F45 WeakPolarHBondContact O-CB 3.28Å; V41-F45 PolarHBondContact O-N 2.97Å; A42-F45 PolarHBondContact O-N 3.45Å; F43-F45 VanDerWaalsContact C-N 3.32Å; F43-F45 PolarHBondContact O-N 3.48Å; F45-A48 PolarHBondContact O-N 3.35Å; F45-S49 WeakPolarHBondContact O-CB 3.48Å; F45-S49 PolarHBondContact O-N 2.95Å
46	A	98.1	Very high	96.2	Very high	56 Å²	56	95.9 Å²	95.9	46%	0.463	51%	0.509	S	S	.	.	H	α-helix	trans	-61.3	-48.3	177.2	0	0	0	0	0	111.8	A42 F43 S49 Y50	A42-A46 WeakPolarHBondContact O-CB 3.35Å; A42-A46 PolarHBondContact O-N 3.32Å; F43-A46 PolarHBondContact O-N 3.45Å; A46-S49 PolarHBondContact O-N 3.46Å; A46-Y50 WeakPolarHBondContact O-CB 3.33Å; A46-Y50 PolarHBondContact O-N 3.4Å
47	F	98.1	Very high	95.4	Very high	116 Å²	116	98.1 Å²	98.1	51%	0.509	52%	0.515	S	S	.	.	H	α-helix	trans	-63.4	-44.4	176	-76	-61.2	0	0	0	111.8	F43 S49 Y50 F51	F43-F47 HydrophobicContact CB-CD2 4.37Å; F43-F47 HydrophobicContact CB-CE2 4.3Å; F43-F47 HydrophobicContact CD1-CE2 4.27Å; F43-F47 WeakPolarHBondContact O-CD2 3.31Å; F43-F47 PolarHBondContact O-N 3.04Å; F47-S49 VanDerWaalsContact C-N 3.33Å; F47-S49 PolarHBondContact O-N 2.91Å; F47-Y50 PolarHBondContact O-N 3.28Å; F47-F51 HydrophobicContact CB-CD2 4.09Å; F47-F51 HydrophobicContact CB-CE2 4.04Å; F47-F51 AromaticContact CD1-CE2 3.94Å; F47-F51 HydrophobicContact CD1-CE2 3.94Å; F47-F51 HydrophobicContact CG-CE2 4.36Å; F47-F51 WeakPolarHBondContact O-CB 3.35Å; F47-F51 WeakPolarHBondContact O-CD2 3.2Å; F47-F51 PolarHBondContact O-N 3.04Å
48	A	97.8	Very high	94.4	Very high	57 Å²	57	98.6 Å²	98.6	47%	0.471	52%	0.517	S	S	.	.	H	α-helix	trans	-58.1	-45.7	177.8	0	0	0	0	0	111.4	G44 F45 Y52	G44-A48 WeakPolarHBondContact O-CB 3.37Å; G44-A48 PolarHBondContact O-N 3.43Å; F45-A48 PolarHBondContact O-N 3.35Å; A48-Y52 WeakPolarHBondContact O-CB 3.41Å; A48-Y52 PolarHBondContact O-N 3.35Å
49	S	96.6	Very high	93.1	Very high	62 Å²	62	99.1 Å²	99.1	43%	0.434	51%	0.511	S	S	.	.	H	α-helix	trans	-60.8	-45.4	176.1	-177	0	0	0	0	112.2	F45 A46 F47 S53	F45-S49 WeakPolarHBondContact O-CB 3.48Å; F45-S49 PolarHBondContact O-N 2.95Å; A46-S49 PolarHBondContact O-N 3.46Å; F47-S49 VanDerWaalsContact C-N 3.33Å; F47-S49 PolarHBondContact O-N 2.91Å; S49-S53 WeakPolarHBondContact O-CB 3.29Å; S49-S53 PolarHBondContact O-N 2.83Å; S49-S53 PolarHBondContact O-OG 3.33Å
50	Y	95.2	Very high	91.7	Very high	151 Å²	151	102.4 Å²	102.4	59%	0.592	52%	0.523	S	S	*	.	H	α-helix	trans	-62.3	-52	178.2	179.2	-100.7	0	0	0	112.4	A46 F47 Y52 S53 L54	A46-Y50 WeakPolarHBondContact O-CB 3.33Å; A46-Y50 PolarHBondContact O-N 3.4Å; F47-Y50 PolarHBondContact O-N 3.28Å; Y50-Y52 PolarHBondContact O-N 2.83Å; Y50-S53 PolarHBondContact O-N 3.12Å; Y50-L54 PolarHBondContact O-N 2.87Å
51	F	96	Very high	90	Very high	121 Å²	121	107.1 Å²	107.1	53%	0.531	53%	0.533	S	S	.	.	H	α-helix	trans	-66.4	-36.9	179.4	-72.7	-61.8	0	0	0	112.3	F47 S53 L54 Y55	F47-F51 HydrophobicContact CB-CD2 4.09Å; F47-F51 HydrophobicContact CB-CE2 4.04Å; F47-F51 AromaticContact CD1-CE2 3.94Å; F47-F51 HydrophobicContact CD1-CE2 3.94Å; F47-F51 HydrophobicContact CG-CE2 4.36Å; F47-F51 WeakPolarHBondContact O-CB 3.35Å; F47-F51 WeakPolarHBondContact O-CD2 3.2Å; F47-F51 PolarHBondContact O-N 3.04Å; F51-S53 VanDerWaalsContact C-N 3.34Å; F51-L54 PolarHBondContact O-N 3.12Å; F51-Y55 VanDerWaalsContact O-CB 3.3Å; F51-Y55 WeakPolarHBondContact O-CB 3.16Å; F51-Y55 PolarHBondContact O-N 3.25Å
52	Y	94.1	Very high	88.2	Confident	150 Å²	150	109.3 Å²	109.3	59%	0.588	54%	0.536	S	S	*	.	H	α-helix	trans	-60.6	-44.6	174.1	178.1	-100.7	0	0	0	111.4	A48 Y50 Y55 A56	A48-Y52 WeakPolarHBondContact O-CB 3.41Å; A48-Y52 PolarHBondContact O-N 3.35Å; Y50-Y52 PolarHBondContact O-N 2.83Å; Y52-Y55 PolarHBondContact O-N 3.13Å; Y52-A56 WeakPolarHBondContact O-CB 3.38Å; Y52-A56 PolarHBondContact O-N 3.35Å
53	S	93.4	Very high	86.5	Confident	57 Å²	57	111.7 Å²	111.7	40%	0.399	54%	0.54	S	S	.	.	H	α-helix	trans	-62.5	-45.6	178.3	-57.8	0	0	0	0	111.3	S49 Y50 F51 Y55 A56 I57	S49-S53 WeakPolarHBondContact O-CB 3.29Å; S49-S53 PolarHBondContact O-N 2.83Å; S49-S53 PolarHBondContact O-OG 3.33Å; Y50-S53 PolarHBondContact O-N 3.12Å; F51-S53 VanDerWaalsContact C-N 3.34Å; S53-Y55 PolarHBondContact O-N 3.28Å; S53-A56 PolarHBondContact O-N 2.94Å; S53-I57 VanDerWaalsContact O-CG1 3.31Å; S53-I57 WeakPolarHBondContact O-CG1 3.35Å; S53-I57 PolarHBondContact O-N 3.44Å
54	L	90.2	Very high	84.8	Confident	96 Å²	96	106.9 Å²	106.9	50%	0.503	53%	0.527	S	S	.	.	H	α-helix	trans	-63.4	-42.2	176.7	-174.7	63.5	0	0	0	112.3	Y50 F51 I57 K58	Y50-L54 PolarHBondContact O-N 2.87Å; F51-L54 PolarHBondContact O-N 3.12Å; L54-I57 PolarHBondContact O-N 2.93Å; L54-K58 PolarHBondContact O-N 2.79Å
55	Y	88.7	Confident	83.1	Confident	137 Å²	137	110 Å²	110	54%	0.537	54%	0.538	S	S	.	.	H	α-helix	trans	-63.4	-40.9	176.2	-179	-96.1	0	0	0	111.9	F51 Y52 S53 K58 R59	F51-Y55 VanDerWaalsContact O-CB 3.3Å; F51-Y55 WeakPolarHBondContact O-CB 3.16Å; F51-Y55 PolarHBondContact O-N 3.25Å; Y52-Y55 PolarHBondContact O-N 3.13Å; S53-Y55 PolarHBondContact O-N 3.28Å; Y55-K58 PolarHBondContact O-N 3.3Å; Y55-R59 HydrophobicContact CE1-CG 4.31Å; Y55-R59 PolarHBondContact O-N 3.3Å
56	A	87.7	Confident	81.6	Confident	25 Å²	25	106.1 Å²	106.1	21%	0.207	53%	0.531	C	S	.	.	H	α-helix	trans	-63.2	-42.8	176.8	0	0	0	0	0	111.9	Y52 S53 K58 R59 N60	Y52-A56 WeakPolarHBondContact O-CB 3.38Å; Y52-A56 PolarHBondContact O-N 3.35Å; S53-A56 PolarHBondContact O-N 2.94Å; A56-K58 VanDerWaalsContact C-N 3.34Å; A56-K58 PolarHBondContact O-N 2.9Å; A56-R59 PolarHBondContact O-N 3.1Å; A56-N60 PolarHBondContact O-N 3.36Å
57	I	81.1	Confident	80	Confident	114 Å²	114	111.8 Å²	111.8	59%	0.585	55%	0.546	S	S	*	.	H	α-helix	trans	-62.3	-42	176	-66.5	164	0	0	0	110.9	S53 L54 R59 N60	S53-I57 VanDerWaalsContact O-CG1 3.31Å; S53-I57 WeakPolarHBondContact O-CG1 3.35Å; S53-I57 PolarHBondContact O-N 3.44Å; L54-I57 PolarHBondContact O-N 2.93Å; I57-R59 PolarHBondContact O-N 2.97Å; I57-N60 PolarHBondContact O-N 2.86Å; I57-N60 VanDerWaalsContact O-N 3.09Å
58	K	78	Confident	78.6	Confident	157 Å²	157	113 Å²	113	68%	0.683	56%	0.558	S	S	*	*	H	α-helix	trans	-55.7	-39.7	177.7	-174.7	-178.8	174.8	-176.3	0	112	L54 Y55 A56 N60 R61	L54-K58 PolarHBondContact O-N 2.79Å; Y55-K58 PolarHBondContact O-N 3.3Å; A56-K58 VanDerWaalsContact C-N 3.34Å; A56-K58 PolarHBondContact O-N 2.9Å; K58-N60 VanDerWaalsContact C-N 3.34Å; K58-N60 PolarHBondContact O-N 2.8Å; K58-R61 PolarHBondContact O-N 3.06Å
59	R	71.9	Confident	77.4	Confident	132 Å²	132	117.5 Å²	117.5	50%	0.498	57%	0.569	S	S	.	*	H	α-helix	trans	-65.6	-33.4	178.6	-67.2	-170.2	-62.6	-177	-0.1	113.3	Y55 A56 I57 R61	Y55-R59 HydrophobicContact CE1-CG 4.31Å; Y55-R59 PolarHBondContact O-N 3.3Å; A56-R59 PolarHBondContact O-N 3.1Å; I57-R59 PolarHBondContact O-N 2.97Å; R59-R61 PolarHBondContact O-N 3.26Å
60	N	67.5	Low	76.4	Confident	109 Å²	109	122.2 Å²	122.2	58%	0.583	59%	0.588	S	S	*	*	H	α-helix	trans	-71.4	-16.6	-179.4	-68.3	-29.4	0	0	0	113.6	A56 I57 K58 E62 L63	A56-N60 PolarHBondContact O-N 3.36Å; I57-N60 PolarHBondContact O-N 2.86Å; I57-N60 VanDerWaalsContact O-N 3.09Å; K58-N60 VanDerWaalsContact C-N 3.34Å; K58-N60 PolarHBondContact O-N 2.8Å; N60-E62 VanDerWaalsContact C-N 3.28Å; N60-E62 PolarHBondContact O-N 3.26Å; N60-L63 PolarHBondContact O-N 3.14Å
61	R	63	Low	75.4	Confident	217 Å²	217	120.2 Å²	120.2	82%	0.819	59%	0.594	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.4	-20.4	-179.5	-155.2	171	90.2	175.7	7.9	113.4	K58 R59 L63 G64	K58-R61 PolarHBondContact O-N 3.06Å; R59-R61 PolarHBondContact O-N 3.26Å; R61-L63 VanDerWaalsContact C-N 3.31Å; R61-L63 PolarHBondContact O-N 3.41Å; R61-G64 PolarHBondContact O-N 3.21Å
62	E	62.1	Low	74.5	Confident	154 Å²	154	120 Å²	120	72%	0.72	61%	0.605	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.2	-32.1	178.2	-67.7	179.3	-178.1	0	0	111.9	N60 G64 T65	N60-E62 VanDerWaalsContact C-N 3.28Å; N60-E62 PolarHBondContact O-N 3.26Å; E62-G64 VanDerWaalsContact C-N 3.29Å; E62-G64 PolarHBondContact O-N 2.91Å; E62-T65 PolarHBondContact O-OG1 3.45Å
63	L	61.8	Low	73.6	Confident	109 Å²	109	123.3 Å²	123.3	57%	0.571	62%	0.617	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.8	-22.1	175.8	-69	164.5	0	0	0	113.5	N60 R61 T65 S66 F67	N60-L63 PolarHBondContact O-N 3.14Å; R61-L63 VanDerWaalsContact C-N 3.31Å; R61-L63 PolarHBondContact O-N 3.41Å; L63-T65 PolarHBondContact O-N 3.04Å; L63-S66 PolarHBondContact O-N 3.48Å; L63-F67 WeakPolarHBondContact O-CD2 3.46Å
64	G	62	Low	72.7	Confident	28 Å²	28	126.3 Å²	126.3	29%	0.289	63%	0.634	S	S	.	*	H	α-helix	trans	-63.8	-28.9	179.7	0	0	0	0	0	113.3	R61 E62 S66 F67 D68	R61-G64 PolarHBondContact O-N 3.21Å; E62-G64 VanDerWaalsContact C-N 3.29Å; E62-G64 PolarHBondContact O-N 2.91Å; G64-S66 PolarHBondContact O-N 3.44Å; G64-F67 PolarHBondContact O-N 3.45Å; G64-F67 VanDerWaalsContact O-N 3.12Å; G64-D68 PolarHBondContact O-N 2.96Å
65	T	64.6	Low	71.9	Confident	103 Å²	103	126 Å²	126	63%	0.632	64%	0.639	S	S	*	*	H	α-helix	trans	-62.9	-26.2	179.7	61.6	0	0	0	0	113.3	E62 L63	E62-T65 PolarHBondContact O-OG1 3.45Å; L63-T65 PolarHBondContact O-N 3.04Å
66	S	64.9	Low	71.2	Confident	78 Å²	78	125 Å²	125	55%	0.545	65%	0.652	S	S	.	*	H	α-helix	trans	-84.2	-28.7	177.2	-44.2	0	0	0	0	112.8	L63 G64	L63-S66 PolarHBondContact O-N 3.48Å; G64-S66 PolarHBondContact O-N 3.44Å
67	F	65	Low	70	Confident	174 Å²	174	136 Å²	136	76%	0.763	70%	0.7	S	S	*	*	H	α-helix	trans	-84.9	-24	179.9	-74.2	-75.5	0	0	0	113.3	L63 G64 Q69	L63-F67 WeakPolarHBondContact O-CD2 3.46Å; G64-F67 PolarHBondContact O-N 3.45Å; G64-F67 VanDerWaalsContact O-N 3.12Å; F67-Q69 PolarHBondContact O-N 3.03Å
68	D	69	Low	69.5	Low	143 Å²	143	137.2 Å²	137.2	77%	0.765	71%	0.706	S	S	*	*	S	Bend	trans	-76.8	-7.8	175.6	-73.8	-17.9	0	0	0	113.3	G64 L70	G64-D68 PolarHBondContact O-N 2.96Å; D68-L70 PolarHBondContact O-N 3.31Å
69	Q	72.2	Confident	69	Low	151 Å²	151	136.1 Å²	136.1	71%	0.706	71%	0.707	S	S	*	*	S	Bend	trans	-77.8	109.2	173.1	-75.5	-175	-48.6	0	0	109.9	F67	F67-Q69 PolarHBondContact O-N 3.03Å
70	L	75.7	Confident	68.9	Low	161 Å²	161	136.3 Å²	136.3	84%	0.843	72%	0.718	S	S	*	*	P	Polyproline II helix	trans	-55.7	135.4	167.2	-71.7	169.8	0	0	0	109.2	D68	D68-L70 PolarHBondContact O-N 3.31Å
71	P	75.4	Confident	69	Low	108 Å²	108	137.9 Å²	137.9	70%	0.701	73%	0.726	S	S	*	*	P	Polyproline II helix	trans	-58.6	141.1	175.7	24.7	-32.5	0	0	0	109.4	Y73	P71-Y73 PolarHBondContact O-N 3Å
72	P	75.5	Confident	69.3	Low	118 Å²	118	133 Å²	133	77%	0.766	72%	0.721	S	S	*	*	P	Polyproline II helix	trans	-61.3	125.1	177.8	23.5	-30.8	0	0	0	109.5	T74	P72-T74 PolarHBondContact O-N 3.35Å; P72-T74 VanDerWaalsContact O-N 3.15Å
73	Y	75.2	Confident	69.8	Low	218 Å²	218	131.6 Å²	131.6	86%	0.855	72%	0.721	S	S	*	*			trans	-75.5	101	174.9	-161.6	-92.6	0	0	0	108.4	P71 S75	P71-Y73 PolarHBondContact O-N 3Å; Y73-S75 PolarHBondContact O-N 3.1Å
74	T	74.5	Confident	70.4	Confident	120 Å²	120	133.2 Å²	133.2	74%	0.736	73%	0.731	S	S	*	*			trans	-82.5	105.7	164.5	58	0	0	0	0	107	P72 S76	P72-T74 PolarHBondContact O-N 3.35Å; P72-T74 VanDerWaalsContact O-N 3.15Å; T74-S76 PolarHBondContact O-N 3.26Å; T74-S76 VanDerWaalsContact O-N 3.07Å
75	S	74.3	Confident	71	Confident	89 Å²	89	141.3 Å²	141.3	62%	0.622	77%	0.766	S	S	*	*			trans	-62.5	109	160.5	48.7	0	0	0	0	106.5	Y73 E77	Y73-S75 PolarHBondContact O-N 3.1Å; S75-E77 VanDerWaalsContact C-N 3.35Å; S75-E77 PolarHBondContact O-N 3.22Å
76	S	74.2	Confident	71.6	Confident	116 Å²	116	144.5 Å²	144.5	81%	0.811	78%	0.777	S	S	*	*			trans	-61.2	102.7	164	51.9	0	0	0	0	107.1	T74	T74-S76 PolarHBondContact O-N 3.26Å; T74-S76 VanDerWaalsContact O-N 3.07Å
77	E	63.2	Low	72.2	Confident	258 Å²	258	150.5 Å²	150.5	100%	1.206	80%	0.798	S	S	*	*			trans	-66.5	0	155.3	-72.5	-166.7	151.8	0	0	110.1	S75	S75-E77 VanDerWaalsContact C-N 3.35Å; S75-E77 PolarHBondContact O-N 3.22Å

Retrieved 77 of 77 residues in 40 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).