A0AA82N2N2_SCHMA Loading...

Uncharacterized protein AlphaSync

AlphaFold DB , UniProt , Accession A0AA82N2N2, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 59 aa.

						>A0AA82N2N2_SCHMA|A0AA82N2N2
MSQYSLRKCNTLIPYRTADVILVDAHINEKFKLYKELNTGLVKHEFLSKILKAITDDGN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.5	Low	74.4	Confident	171 Å²	171	114.2 Å²	114.2	84%	0.842	57%	0.565	S	S	*	*				0	144.2	0	-85.3	170.6	79.2	0	0	109.6	L6	M1-L6 HydrophobicContact CB-CD1 4.29Å; M1-L6 HydrophobicContact CB-CG 4.3Å; M1-L6 HydrophobicContact CE-CD2 4.34Å; M1-L6 HydrophobicContact CE-CG 4.17Å
2	S	76.7	Confident	74.8	Confident	68 Å²	68	116.7 Å²	116.7	48%	0.476	58%	0.581	S	S	.	*			trans	-73.4	152.4	174.1	76.3	0	0	0	0	111.2	Y4 S5 L6	S2-Y4 PolarHBondContact O-N 3.41Å; S2-S5 WeakPolarHBondContact CA-OG 3.44Å; S2-S5 PolarHBondContact N-OG 3Å; S2-S5 PolarHBondContact O-N 3.45Å; S2-S5 PolarHBondContact O-OG 2.95Å; S2-S5 PolarHBondContact OG-N 3.23Å; S2-S5 PolarHBondContact OG-OG 3.3Å; S2-L6 PolarHBondContact O-N 3.43Å; S2-L6 VanDerWaalsContact O-N 3.1Å
3	Q	75	Confident	74.4	Confident	176 Å²	176	116.1 Å²	116.1	82%	0.822	58%	0.579	S	S	*	*	H	α-helix	trans	-58.6	-36.1	176.3	-78.1	-170.4	-3.9	0	0	112.5	L6 R7	Q3-L6 PolarHBondContact O-N 3.33Å; Q3-R7 PolarHBondContact O-N 3.23Å
4	Y	75.3	Confident	74.1	Confident	155 Å²	155	112.3 Å²	112.3	61%	0.608	57%	0.567	S	S	*	*	H	α-helix	trans	-61.3	-46.8	176.4	179.1	-98.6	0	0	0	112	S2 L6 R7 K8	S2-Y4 PolarHBondContact O-N 3.41Å; Y4-L6 PolarHBondContact O-N 3.5Å; Y4-R7 PolarHBondContact O-N 2.68Å; Y4-K8 HydrophobicContact CE1-CD 3.81Å; Y4-K8 PolarHBondContact O-N 3.02Å; Y4-K8 WeakPolarHBondContact OH-CE 3.37Å; Y4-K8 PolarHBondContact OH-NZ 3.01Å
5	S	74.9	Confident	73.7	Confident	37 Å²	37	112.1 Å²	112.1	26%	0.259	56%	0.558	S	S	.	*	H	α-helix	trans	-61.8	-41.2	176.6	44.2	0	0	0	0	112.5	S2 R7 K8 C9	S2-S5 WeakPolarHBondContact CA-OG 3.44Å; S2-S5 PolarHBondContact N-OG 3Å; S2-S5 PolarHBondContact O-N 3.45Å; S2-S5 PolarHBondContact O-OG 2.95Å; S2-S5 PolarHBondContact OG-N 3.23Å; S2-S5 PolarHBondContact OG-OG 3.3Å; S5-R7 PolarHBondContact O-N 2.82Å; S5-K8 PolarHBondContact O-N 3.49Å; S5-C9 WeakPolarHBondContact O-CB 3.38Å; S5-C9 PolarHBondContact O-N 2.89Å
6	L	75.7	Confident	73.5	Confident	75 Å²	75	119.8 Å²	119.8	39%	0.393	58%	0.578	S	S	.	*	H	α-helix	trans	-61.8	-43.3	176	-88.9	155.9	0	0	0	111.8	M1 S2 Q3 Y4 C9 N10	M1-L6 HydrophobicContact CB-CD1 4.29Å; M1-L6 HydrophobicContact CB-CG 4.3Å; M1-L6 HydrophobicContact CE-CD2 4.34Å; M1-L6 HydrophobicContact CE-CG 4.17Å; S2-L6 PolarHBondContact O-N 3.43Å; S2-L6 VanDerWaalsContact O-N 3.1Å; Q3-L6 PolarHBondContact O-N 3.33Å; Y4-L6 PolarHBondContact O-N 3.5Å; L6-C9 PolarHBondContact O-N 3.16Å; L6-N10 WeakPolarHBondContact O-CB 3.33Å; L6-N10 PolarHBondContact O-N 2.95Å
7	R	77.9	Confident	73.8	Confident	203 Å²	203	115.9 Å²	115.9	77%	0.766	56%	0.564	S	S	*	*	H	α-helix	trans	-64.6	-44.8	179.7	-147.9	178.7	-171.1	-170.2	2.2	111.5	Q3 Y4 S5 N10 T11	Q3-R7 PolarHBondContact O-N 3.23Å; Y4-R7 PolarHBondContact O-N 2.68Å; S5-R7 PolarHBondContact O-N 2.82Å; R7-N10 PolarHBondContact O-N 3.05Å; R7-T11 PolarHBondContact O-N 2.85Å; R7-T11 VanDerWaalsContact O-N 3.12Å; R7-T11 PolarHBondContact O-OG1 3.3Å; R7-T11 VanDerWaalsContact O-OG1 3.13Å
8	K	79	Confident	74.3	Confident	115 Å²	115	113.3 Å²	113.3	50%	0.5	56%	0.564	S	S	.	*	H	α-helix	trans	-63.1	-45.5	175.9	-109.7	-175.5	173.2	174	0	112.4	Y4 S5 N10 T11 L12	Y4-K8 HydrophobicContact CE1-CD 3.81Å; Y4-K8 PolarHBondContact O-N 3.02Å; Y4-K8 WeakPolarHBondContact OH-CE 3.37Å; Y4-K8 PolarHBondContact OH-NZ 3.01Å; S5-K8 PolarHBondContact O-N 3.49Å; K8-N10 VanDerWaalsContact C-N 3.34Å; K8-N10 PolarHBondContact O-N 3.47Å; K8-T11 PolarHBondContact O-N 3.46Å; K8-L12 PolarHBondContact O-N 2.97Å; K8-L12 VanDerWaalsContact O-N 3.15Å
9	C	72.4	Confident	74.5	Confident	66 Å²	66	113.6 Å²	113.6	45%	0.446	57%	0.568	S	S	.	*	H	α-helix	trans	-58.4	-46.8	175.5	-81.6	0	0	0	0	111.1	S5 L6 T11 L12 I13	S5-C9 WeakPolarHBondContact O-CB 3.38Å; S5-C9 PolarHBondContact O-N 2.89Å; L6-C9 PolarHBondContact O-N 3.16Å; C9-T11 PolarHBondContact O-N 3.37Å; C9-L12 PolarHBondContact O-N 3.35Å; C9-L12 VanDerWaalsContact O-N 3.11Å; C9-I13 CarbonylContact O-C 3.48Å; C9-I13 PolarHBondContact O-N 3.27Å; C9-I13 VanDerWaalsContact O-O 3.05Å
10	N	71.5	Confident	74.7	Confident	74 Å²	74	109.6 Å²	109.6	40%	0.396	55%	0.55	S	S	.	.	H	α-helix	trans	-63.1	-27.2	178.6	-80.9	-8.6	0	0	0	114	L6 R7 K8 P14	L6-N10 WeakPolarHBondContact O-CB 3.33Å; L6-N10 PolarHBondContact O-N 2.95Å; R7-N10 PolarHBondContact O-N 3.05Å; K8-N10 VanDerWaalsContact C-N 3.34Å; K8-N10 PolarHBondContact O-N 3.47Å; N10-P14 WeakPolarHBondContact O-CA 3.45Å
11	T	79.8	Confident	75	Confident	116 Å²	116	108.7 Å²	108.7	71%	0.712	55%	0.546	S	S	*	.	H	α-helix	trans	-72.8	-42	173.1	-56.9	0	0	0	0	111.7	R7 K8 C9	R7-T11 PolarHBondContact O-N 2.85Å; R7-T11 VanDerWaalsContact O-N 3.12Å; R7-T11 PolarHBondContact O-OG1 3.3Å; R7-T11 VanDerWaalsContact O-OG1 3.13Å; K8-T11 PolarHBondContact O-N 3.46Å; C9-T11 PolarHBondContact O-N 3.37Å
12	L	78.5	Confident	76.2	Confident	144 Å²	144	105.6 Å²	105.6	75%	0.754	53%	0.532	S	S	*	.	H	α-helix	trans	-77.9	-42.3	-176.7	-69.3	171.2	0	0	0	112.4	K8 C9	K8-L12 PolarHBondContact O-N 2.97Å; K8-L12 VanDerWaalsContact O-N 3.15Å; C9-L12 PolarHBondContact O-N 3.35Å; C9-L12 VanDerWaalsContact O-N 3.11Å
13	I	70	Confident	76.6	Confident	109 Å²	109	106.4 Å²	106.4	56%	0.559	53%	0.534	S	S	*	.	S	Bend	trans	-135.9	95.9	-179.2	-50.3	179.5	0	0	0	106.1	C9 Y15 V20	C9-I13 CarbonylContact O-C 3.48Å; C9-I13 PolarHBondContact O-N 3.27Å; C9-I13 VanDerWaalsContact O-O 3.05Å; I13-Y15 PolarHBondContact O-N 2.93Å; I13-Y15 VanDerWaalsContact O-N 3.16Å; I13-V20 HydrophobicContact CG2-CG2 3.43Å; I13-V20 VanDerWaalsContact CG2-CG2 3.43Å
14	P	70.9	Confident	77	Confident	63 Å²	63	100.4 Å²	100.4	41%	0.409	51%	0.508	S	S	.	.			trans	-59.7	123.5	-178.6	-20.7	31.2	0	0	0	109.7	N10 R16 T17	N10-P14 WeakPolarHBondContact O-CA 3.45Å; P14-R16 PolarHBondContact O-N 2.92Å; P14-T17 HydrophobicContact CB-CG2 4.33Å; P14-T17 PolarHBondContact O-N 2.87Å; P14-T17 PolarHBondContact O-OG1 3.46Å; P14-T17 VanDerWaalsContact O-OG1 3.11Å
15	Y	66.9	Low	77.4	Confident	110 Å²	110	95.6 Å²	95.6	43%	0.431	50%	0.5	S	S	.	.	T	Hydrogen-bonded Turn	trans	-56.6	-15.8	178	-145.7	-91	0	0	0	113.9	I13 T17 V20 I21 D24	I13-Y15 PolarHBondContact O-N 2.93Å; I13-Y15 VanDerWaalsContact O-N 3.16Å; Y15-T17 VanDerWaalsContact C-N 3.34Å; Y15-V20 HydrophobicContact CD1-CG1 4.46Å; Y15-V20 HydrophobicContact CD2-CG1 3.93Å; Y15-V20 HydrophobicContact CE2-CG1 4.22Å; Y15-V20 HydrophobicContact CG-CG1 4.08Å; Y15-I21 VanDerWaalsContact O-CG1 3.26Å; Y15-I21 WeakPolarHBondContact O-CG1 3.3Å; Y15-D24 HydrophobicContact CE1-CB 4.46Å; Y15-D24 PolarHBondContact OH-OD1 2.91Å; Y15-D24 PolarHBondContact OH-OD2 3.48Å
16	R	71	Confident	77.9	Confident	234 Å²	234	99.4 Å²	99.4	88%	0.883	51%	0.513	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.2	-2.4	179.8	-63.7	-172.8	-179.9	-171.9	0.1	114	P14	P14-R16 PolarHBondContact O-N 2.92Å
17	T	79.1	Confident	78.2	Confident	55 Å²	55	99.7 Å²	99.7	34%	0.337	51%	0.514	S	S	.	.	S	Bend	trans	-72.1	140.2	172.4	58.4	0	0	0	0	109.6	P14 Y15 D19 V20 I21	P14-T17 HydrophobicContact CB-CG2 4.33Å; P14-T17 PolarHBondContact O-N 2.87Å; P14-T17 PolarHBondContact O-OG1 3.46Å; P14-T17 VanDerWaalsContact O-OG1 3.11Å; Y15-T17 VanDerWaalsContact C-N 3.34Å; T17-D19 PolarHBondContact O-N 3.39Å; T17-V20 PolarHBondContact O-N 2.93Å; T17-V20 VanDerWaalsContact O-N 3.12Å; T17-V20 WeakPolarHBondContact OG1-CG2 3.35Å; T17-I21 PolarHBondContact O-N 3.19Å
18	A	81.7	Confident	78.4	Confident	68 Å²	68	94.3 Å²	94.3	56%	0.562	50%	0.501	S	S	*	.	H	α-helix	trans	-54.8	-40.1	-175.9	0	0	0	0	0	112.1	V20 I21 L22	A18-V20 PolarHBondContact O-N 3.44Å; A18-I21 PolarHBondContact O-N 2.9Å; A18-L22 WeakPolarHBondContact O-CB 3.37Å; A18-L22 WeakPolarHBondContact O-CG 3.44Å; A18-L22 PolarHBondContact O-N 3.4Å
19	D	78.3	Confident	78.7	Confident	120 Å²	120	94.4 Å²	94.4	64%	0.642	50%	0.503	S	S	*	.	H	α-helix	trans	-62.7	-41.4	179.8	-58.2	-38.7	0	0	0	112.7	T17 L22 V23	T17-D19 PolarHBondContact O-N 3.39Å; D19-L22 PolarHBondContact O-N 2.69Å; D19-V23 VanDerWaalsContact O-CG2 3.3Å; D19-V23 WeakPolarHBondContact O-CG2 3.49Å; D19-V23 PolarHBondContact O-N 2.89Å
20	V	79.7	Confident	79.1	Confident	33 Å²	33	97.8 Å²	97.8	20%	0.2	51%	0.51	C	S	.	.	H	α-helix	trans	-68.3	-41.4	179.2	176.3	0	0	0	0	110.7	I13 Y15 T17 A18 L22 V23 D24	I13-V20 HydrophobicContact CG2-CG2 3.43Å; I13-V20 VanDerWaalsContact CG2-CG2 3.43Å; Y15-V20 HydrophobicContact CD1-CG1 4.46Å; Y15-V20 HydrophobicContact CD2-CG1 3.93Å; Y15-V20 HydrophobicContact CE2-CG1 4.22Å; Y15-V20 HydrophobicContact CG-CG1 4.08Å; T17-V20 PolarHBondContact O-N 2.93Å; T17-V20 VanDerWaalsContact O-N 3.12Å; T17-V20 WeakPolarHBondContact OG1-CG2 3.35Å; A18-V20 PolarHBondContact O-N 3.44Å; V20-L22 VanDerWaalsContact C-N 3.31Å; V20-L22 PolarHBondContact O-N 3.37Å; V20-V23 PolarHBondContact O-N 2.97Å; V20-D24 WeakPolarHBondContact O-CB 3.48Å; V20-D24 PolarHBondContact O-N 2.87Å
21	I	81.1	Confident	79.4	Confident	91 Å²	91	101.3 Å²	101.3	47%	0.467	52%	0.522	S	S	.	.	H	α-helix	trans	-61.2	-43.4	176.4	-63.4	173.1	0	0	0	110.2	Y15 T17 A18 D24 A25	Y15-I21 VanDerWaalsContact O-CG1 3.26Å; Y15-I21 WeakPolarHBondContact O-CG1 3.3Å; T17-I21 PolarHBondContact O-N 3.19Å; A18-I21 PolarHBondContact O-N 2.9Å; I21-D24 PolarHBondContact O-N 3.43Å; I21-A25 WeakPolarHBondContact O-CB 3.26Å; I21-A25 PolarHBondContact O-N 2.88Å
22	L	85.6	Confident	79.6	Confident	106 Å²	106	102 Å²	102	56%	0.555	52%	0.515	S	S	*	.	H	α-helix	trans	-65.5	-42.9	178.2	-75.8	168.9	0	0	0	112.4	A18 D19 V20 A25 H26	A18-L22 WeakPolarHBondContact O-CB 3.37Å; A18-L22 WeakPolarHBondContact O-CG 3.44Å; A18-L22 PolarHBondContact O-N 3.4Å; D19-L22 PolarHBondContact O-N 2.69Å; V20-L22 VanDerWaalsContact C-N 3.31Å; V20-L22 PolarHBondContact O-N 3.37Å; L22-A25 PolarHBondContact O-N 3.21Å; L22-H26 PolarHBondContact O-N 2.86Å
23	V	84.4	Confident	79.9	Confident	85 Å²	85	99.3 Å²	99.3	52%	0.515	50%	0.501	S	S	.	.	H	α-helix	trans	-63.4	-43.8	176.3	169.7	0	0	0	0	110.8	D19 V20 H26 I27	D19-V23 VanDerWaalsContact O-CG2 3.3Å; D19-V23 WeakPolarHBondContact O-CG2 3.49Å; D19-V23 PolarHBondContact O-N 2.89Å; V20-V23 PolarHBondContact O-N 2.97Å; V23-H26 PolarHBondContact O-N 3.45Å; V23-I27 HydrophobicContact CG1-CD1 3.78Å; V23-I27 HydrophobicContact CG1-CG1 4.43Å; V23-I27 VanDerWaalsContact O-CG1 3.27Å; V23-I27 WeakPolarHBondContact O-CG1 3.39Å; V23-I27 PolarHBondContact O-N 3.48Å
24	D	82.9	Confident	80.4	Confident	50 Å²	50	102.1 Å²	102.1	27%	0.267	51%	0.506	S	S	.	.	H	α-helix	trans	-63.5	-42.5	177.1	-172.1	42.7	0	0	0	111.9	Y15 V20 I21 H26 I27 N28	Y15-D24 HydrophobicContact CE1-CB 4.46Å; Y15-D24 PolarHBondContact OH-OD1 2.91Å; Y15-D24 PolarHBondContact OH-OD2 3.48Å; V20-D24 WeakPolarHBondContact O-CB 3.48Å; V20-D24 PolarHBondContact O-N 2.87Å; I21-D24 PolarHBondContact O-N 3.43Å; D24-H26 PolarHBondContact O-N 3.33Å; D24-I27 PolarHBondContact O-N 2.8Å; D24-N28 WeakPolarHBondContact O-CB 3.4Å; D24-N28 PolarHBondContact O-N 3.04Å; D24-N28 PolarHBondContact O-ND2 3.28Å; D24-N28 PolarHBondContact OD1-ND2 3.42Å
25	A	84.5	Confident	81	Confident	54 Å²	54	106.5 Å²	106.5	45%	0.446	52%	0.519	S	S	.	.	H	α-helix	trans	-59.5	-46.8	174.4	0	0	0	0	0	111.9	I21 L22 I27 N28 E29	I21-A25 WeakPolarHBondContact O-CB 3.26Å; I21-A25 PolarHBondContact O-N 2.88Å; L22-A25 PolarHBondContact O-N 3.21Å; A25-I27 PolarHBondContact O-N 2.66Å; A25-N28 PolarHBondContact O-N 3.19Å; A25-E29 WeakPolarHBondContact O-CB 3.28Å; A25-E29 PolarHBondContact O-N 2.89Å
26	H	84.2	Confident	81.9	Confident	117 Å²	117	106.4 Å²	106.4	54%	0.542	52%	0.522	S	S	.	.	H	α-helix	trans	-62.8	-39.8	176.6	-89.1	150.1	0	0	0	113.1	L22 V23 D24 E29 K30	L22-H26 PolarHBondContact O-N 2.86Å; V23-H26 PolarHBondContact O-N 3.45Å; D24-H26 PolarHBondContact O-N 3.33Å; H26-E29 IonicContact CD2-OE2 3.96Å; H26-K30 WeakPolarHBondContact O-CG 3.26Å; H26-K30 PolarHBondContact O-N 3.19Å
27	I	82	Confident	82.6	Confident	80 Å²	80	100.5 Å²	100.5	41%	0.41	51%	0.508	S	S	.	.	H	α-helix	trans	-62.4	-49	175.8	-71.2	167.7	0	0	0	109.4	V23 D24 A25 E29 K30 F31	V23-I27 HydrophobicContact CG1-CD1 3.78Å; V23-I27 HydrophobicContact CG1-CG1 4.43Å; V23-I27 VanDerWaalsContact O-CG1 3.27Å; V23-I27 WeakPolarHBondContact O-CG1 3.39Å; V23-I27 PolarHBondContact O-N 3.48Å; D24-I27 PolarHBondContact O-N 2.8Å; A25-I27 PolarHBondContact O-N 2.66Å; I27-E29 PolarHBondContact O-N 3.42Å; I27-K30 PolarHBondContact O-N 2.89Å; I27-F31 HydrophobicContact CG2-CD2 3.74Å; I27-F31 HydrophobicContact CG2-CE2 3.9Å; I27-F31 WeakPolarHBondContact O-CD2 3.21Å; I27-F31 PolarHBondContact O-N 3.3Å
28	N	82.2	Confident	82.7	Confident	91 Å²	91	103 Å²	103	49%	0.487	52%	0.519	S	S	.	.	H	α-helix	trans	-62.5	-40.5	-179.6	-74.2	-44.2	0	0	0	112.5	D24 A25 F31 K32	D24-N28 WeakPolarHBondContact O-CB 3.4Å; D24-N28 PolarHBondContact O-N 3.04Å; D24-N28 PolarHBondContact O-ND2 3.28Å; D24-N28 PolarHBondContact OD1-ND2 3.42Å; A25-N28 PolarHBondContact O-N 3.19Å; N28-F31 PolarHBondContact O-N 2.89Å; N28-K32 WeakPolarHBondContact O-CB 3.45Å; N28-K32 PolarHBondContact O-N 2.94Å
29	E	86.6	Confident	82.7	Confident	117 Å²	117	103.9 Å²	103.9	55%	0.547	52%	0.517	S	S	.	.	H	α-helix	trans	-62.6	-47.8	175.4	-174.8	178.1	-156	0	0	111.7	A25 H26 I27 F31 K32 L33	A25-E29 WeakPolarHBondContact O-CB 3.28Å; A25-E29 PolarHBondContact O-N 2.89Å; H26-E29 IonicContact CD2-OE2 3.96Å; I27-E29 PolarHBondContact O-N 3.42Å; E29-F31 VanDerWaalsContact C-N 3.33Å; E29-F31 PolarHBondContact O-N 2.94Å; E29-K32 WeakPolarHBondContact O-CB 3.49Å; E29-K32 PolarHBondContact O-N 3.01Å; E29-L33 HydrophobicContact CG-CD1 4.46Å; E29-L33 PolarHBondContact O-N 3.28Å
30	K	79.3	Confident	83.1	Confident	137 Å²	137	100 Å²	100	60%	0.596	51%	0.506	S	S	*	.	H	α-helix	trans	-58.3	-45.8	175.2	-79	-172.8	177.2	-177	0	111.5	H26 I27 K32 L33 Y34	H26-K30 WeakPolarHBondContact O-CG 3.26Å; H26-K30 PolarHBondContact O-N 3.19Å; I27-K30 PolarHBondContact O-N 2.89Å; K30-K32 VanDerWaalsContact C-N 3.31Å; K30-K32 PolarHBondContact O-N 3.49Å; K30-L33 PolarHBondContact O-N 3.45Å; K30-Y34 WeakPolarHBondContact O-CD2 3.31Å; K30-Y34 PolarHBondContact O-N 2.88Å
31	F	78.8	Confident	83.4	Confident	147 Å²	147	104 Å²	104	65%	0.645	53%	0.526	S	S	*	.	H	α-helix	trans	-62	-38.9	178	-94.6	-78.8	0	0	0	112.5	I27 N28 E29 Y34 K35	I27-F31 HydrophobicContact CG2-CD2 3.74Å; I27-F31 HydrophobicContact CG2-CE2 3.9Å; I27-F31 WeakPolarHBondContact O-CD2 3.21Å; I27-F31 PolarHBondContact O-N 3.3Å; N28-F31 PolarHBondContact O-N 2.89Å; E29-F31 VanDerWaalsContact C-N 3.33Å; E29-F31 PolarHBondContact O-N 2.94Å; F31-Y34 PolarHBondContact O-N 3.46Å; F31-K35 WeakPolarHBondContact O-CB 3.36Å; F31-K35 PolarHBondContact O-N 3.2Å
32	K	84.2	Confident	83.6	Confident	130 Å²	130	103.7 Å²	103.7	57%	0.565	53%	0.528	S	S	*	.	H	α-helix	trans	-62.9	-47.1	175.1	-173.7	-179.6	172.8	-171.7	0	111.2	N28 E29 K30 Y34 K35 E36	N28-K32 WeakPolarHBondContact O-CB 3.45Å; N28-K32 PolarHBondContact O-N 2.94Å; E29-K32 WeakPolarHBondContact O-CB 3.49Å; E29-K32 PolarHBondContact O-N 3.01Å; K30-K32 VanDerWaalsContact C-N 3.31Å; K30-K32 PolarHBondContact O-N 3.49Å; K32-Y34 PolarHBondContact O-N 3.34Å; K32-K35 WeakPolarHBondContact O-CB 3.2Å; K32-K35 PolarHBondContact O-N 3.29Å; K32-E36 WeakPolarHBondContact CE-OE1 3.47Å; K32-E36 WeakPolarHBondContact O-CG 3.35Å; K32-E36 PolarHBondContact O-N 3.43Å
33	L	84	Confident	83.7	Confident	89 Å²	89	105.3 Å²	105.3	47%	0.466	53%	0.53	S	S	.	.	H	α-helix	trans	-59	-46.8	175.4	-82	165.9	0	0	0	112	E29 K30 K35 E36 L37	E29-L33 HydrophobicContact CG-CD1 4.46Å; E29-L33 PolarHBondContact O-N 3.28Å; K30-L33 PolarHBondContact O-N 3.45Å; L33-K35 VanDerWaalsContact C-N 3.32Å; L33-K35 PolarHBondContact O-N 2.94Å; L33-E36 PolarHBondContact O-N 2.98Å; L33-L37 WeakPolarHBondContact O-CB 3.33Å; L33-L37 WeakPolarHBondContact O-CG 3.42Å; L33-L37 PolarHBondContact O-N 3.48Å
34	Y	80.2	Confident	84	Confident	167 Å²	167	107.7 Å²	107.7	66%	0.655	54%	0.535	S	S	*	.	H	α-helix	trans	-60.3	-42.2	175.6	-87.2	-70.1	0	0	0	111.9	K30 F31 K32 N38	K30-Y34 WeakPolarHBondContact O-CD2 3.31Å; K30-Y34 PolarHBondContact O-N 2.88Å; F31-Y34 PolarHBondContact O-N 3.46Å; K32-Y34 PolarHBondContact O-N 3.34Å; Y34-N38 WeakPolarHBondContact O-CB 3.19Å; Y34-N38 PolarHBondContact O-N 3.1Å
35	K	84.6	Confident	84.3	Confident	155 Å²	155	110.3 Å²	110.3	67%	0.674	55%	0.546	S	S	*	.	H	α-helix	trans	-63.1	-44.4	177.5	-172.9	-177.7	178.3	-177.3	0	111.6	F31 K32 L33 T39	F31-K35 WeakPolarHBondContact O-CB 3.36Å; F31-K35 PolarHBondContact O-N 3.2Å; K32-K35 WeakPolarHBondContact O-CB 3.2Å; K32-K35 PolarHBondContact O-N 3.29Å; L33-K35 VanDerWaalsContact C-N 3.32Å; L33-K35 PolarHBondContact O-N 2.94Å; K35-T39 VanDerWaalsContact O-CB 3.31Å; K35-T39 WeakPolarHBondContact O-CB 3.42Å; K35-T39 PolarHBondContact O-N 3.31Å; K35-T39 PolarHBondContact O-OG1 2.94Å
36	E	85.3	Confident	84.5	Confident	108 Å²	108	114 Å²	114	51%	0.505	55%	0.552	S	S	.	*	H	α-helix	trans	-64.7	-47.4	178	-74.6	174.7	-177.3	0	0	111.5	K32 L33 N38 T39 G40	K32-E36 WeakPolarHBondContact CE-OE1 3.47Å; K32-E36 WeakPolarHBondContact O-CG 3.35Å; K32-E36 PolarHBondContact O-N 3.43Å; L33-E36 PolarHBondContact O-N 2.98Å; E36-N38 PolarHBondContact O-N 2.93Å; E36-T39 PolarHBondContact O-N 3.47Å; E36-G40 PolarHBondContact O-N 3.41Å
37	L	84.9	Confident	84.7	Confident	111 Å²	111	112.4 Å²	112.4	58%	0.581	55%	0.548	S	S	*	.	H	α-helix	trans	-58.9	-47.9	175.7	-75.7	171.8	0	0	0	111.7	L33 T39 G40 L41	L33-L37 WeakPolarHBondContact O-CB 3.33Å; L33-L37 WeakPolarHBondContact O-CG 3.42Å; L33-L37 PolarHBondContact O-N 3.48Å; L37-T39 VanDerWaalsContact C-N 3.33Å; L37-T39 PolarHBondContact O-N 3.39Å; L37-G40 PolarHBondContact O-N 3.3Å; L37-L41 WeakPolarHBondContact O-CG 3.39Å; L37-L41 PolarHBondContact O-N 3.04Å
38	N	81.9	Confident	85.2	Confident	107 Å²	107	111.8 Å²	111.8	57%	0.572	55%	0.55	S	S	*	*	H	α-helix	trans	-65.7	-39.2	-178.6	-153.2	35	0	0	0	111.2	Y34 E36 L41 V42	Y34-N38 WeakPolarHBondContact O-CB 3.19Å; Y34-N38 PolarHBondContact O-N 3.1Å; E36-N38 PolarHBondContact O-N 2.93Å; N38-L41 PolarHBondContact O-N 3.43Å; N38-V42 WeakPolarHBondContact O-CB 3.06Å; N38-V42 VanDerWaalsContact O-CG2 3.3Å; N38-V42 WeakPolarHBondContact O-CG2 3.5Å; N38-V42 PolarHBondContact O-N 2.9Å
39	T	82.9	Confident	85.6	Confident	86 Å²	86	113.4 Å²	113.4	53%	0.528	55%	0.553	S	S	.	*	H	α-helix	trans	-63.4	-42.6	173.9	-55.8	0	0	0	0	111.2	K35 E36 L37 K43	K35-T39 VanDerWaalsContact O-CB 3.31Å; K35-T39 WeakPolarHBondContact O-CB 3.42Å; K35-T39 PolarHBondContact O-N 3.31Å; K35-T39 PolarHBondContact O-OG1 2.94Å; E36-T39 PolarHBondContact O-N 3.47Å; L37-T39 VanDerWaalsContact C-N 3.33Å; L37-T39 PolarHBondContact O-N 3.39Å; T39-K43 VanDerWaalsContact O-CB 3.28Å; T39-K43 WeakPolarHBondContact O-CB 3.42Å; T39-K43 PolarHBondContact O-N 3.3Å
40	G	85.5	Confident	85.7	Confident	39 Å²	39	111.2 Å²	111.2	40%	0.402	54%	0.544	S	S	.	.	H	α-helix	trans	-61.9	-45.1	176.5	0	0	0	0	0	112.6	E36 L37 K43 H44	E36-G40 PolarHBondContact O-N 3.41Å; L37-G40 PolarHBondContact O-N 3.3Å; G40-K43 PolarHBondContact O-N 2.93Å; G40-H44 WeakPolarHBondContact O-CB 3.49Å; G40-H44 PolarHBondContact O-N 3.12Å
41	L	86	Confident	86.2	Confident	117 Å²	117	109.9 Å²	109.9	61%	0.613	54%	0.543	S	S	*	.	H	α-helix	trans	-62.1	-49.9	176.4	-76	171.3	0	0	0	111.8	L37 N38 K43 H44 E45	L37-L41 WeakPolarHBondContact O-CG 3.39Å; L37-L41 PolarHBondContact O-N 3.04Å; N38-L41 PolarHBondContact O-N 3.43Å; L41-K43 VanDerWaalsContact C-N 3.31Å; L41-K43 PolarHBondContact O-N 2.96Å; L41-H44 PolarHBondContact O-N 3.39Å; L41-E45 WeakPolarHBondContact O-CB 3.42Å; L41-E45 PolarHBondContact O-N 3.13Å
42	V	86.3	Confident	86.8	Confident	85 Å²	85	109.2 Å²	109.2	52%	0.515	54%	0.54	S	S	.	.	H	α-helix	trans	-59.9	-42.7	177.7	170.8	0	0	0	0	111	N38 E45 F46	N38-V42 WeakPolarHBondContact O-CB 3.06Å; N38-V42 VanDerWaalsContact O-CG2 3.3Å; N38-V42 WeakPolarHBondContact O-CG2 3.5Å; N38-V42 PolarHBondContact O-N 2.9Å; V42-E45 PolarHBondContact O-N 2.93Å; V42-F46 VanDerWaalsContact O-CB 3.26Å; V42-F46 WeakPolarHBondContact O-CB 3.38Å; V42-F46 PolarHBondContact O-N 3.11Å
43	K	88	Confident	87	Confident	139 Å²	139	105.6 Å²	105.6	60%	0.604	53%	0.534	S	S	*	.	H	α-helix	trans	-62.2	-44.5	176.5	-176.9	178	177.6	-177.3	0	111.5	T39 G40 L41 F46 L47	T39-K43 VanDerWaalsContact O-CB 3.28Å; T39-K43 WeakPolarHBondContact O-CB 3.42Å; T39-K43 PolarHBondContact O-N 3.3Å; G40-K43 PolarHBondContact O-N 2.93Å; L41-K43 VanDerWaalsContact C-N 3.31Å; L41-K43 PolarHBondContact O-N 2.96Å; K43-F46 PolarHBondContact O-N 3.15Å; K43-L47 HydrophobicContact CG-CD1 4.02Å; K43-L47 HydrophobicContact CG-CG 4.48Å; K43-L47 WeakPolarHBondContact O-CB 3.46Å; K43-L47 VanDerWaalsContact O-CG 3.26Å; K43-L47 WeakPolarHBondContact O-CG 3.27Å; K43-L47 PolarHBondContact O-N 3.19Å
44	H	89.6	Confident	87.2	Confident	135 Å²	135	106.7 Å²	106.7	63%	0.625	54%	0.539	S	S	*	.	H	α-helix	trans	-64.3	-45.1	178.6	-174.2	-80.8	0	0	0	111.7	G40 L41 F46 L47 S48	G40-H44 WeakPolarHBondContact O-CB 3.49Å; G40-H44 PolarHBondContact O-N 3.12Å; L41-H44 PolarHBondContact O-N 3.39Å; H44-F46 VanDerWaalsContact C-N 3.34Å; H44-F46 PolarHBondContact O-N 3.25Å; H44-L47 PolarHBondContact O-N 2.8Å; H44-S48 WeakPolarHBondContact O-CB 3.44Å; H44-S48 PolarHBondContact O-N 3.15Å
45	E	89.5	Confident	87.6	Confident	105 Å²	105	102.7 Å²	102.7	49%	0.491	53%	0.532	S	S	.	.	H	α-helix	trans	-61.9	-43.4	177.3	-165.8	-169.3	152.2	0	0	111.5	L41 V42 S48 K49	L41-E45 WeakPolarHBondContact O-CB 3.42Å; L41-E45 PolarHBondContact O-N 3.13Å; V42-E45 PolarHBondContact O-N 2.93Å; E45-S48 PolarHBondContact O-N 2.95Å; E45-K49 WeakPolarHBondContact O-CG 3.3Å; E45-K49 PolarHBondContact O-N 3.46Å; E45-K49 WeakPolarHBondContact OE1-CE 3.35Å; E45-K49 IonicContact OE1-NZ 2.68Å; E45-K49 PolarHBondContact OE1-NZ 2.91Å
46	F	88	Confident	87.4	Confident	131 Å²	131	100.1 Å²	100.1	58%	0.575	53%	0.526	S	S	*	.	H	α-helix	trans	-62.8	-46.2	176.7	-174.3	-104.8	0	0	0	112.1	V42 K43 H44 S48 K49 I50	V42-F46 VanDerWaalsContact O-CB 3.26Å; V42-F46 WeakPolarHBondContact O-CB 3.38Å; V42-F46 PolarHBondContact O-N 3.11Å; K43-F46 PolarHBondContact O-N 3.15Å; H44-F46 VanDerWaalsContact C-N 3.34Å; H44-F46 PolarHBondContact O-N 3.25Å; F46-S48 VanDerWaalsContact C-N 3.34Å; F46-S48 PolarHBondContact O-N 3.21Å; F46-K49 PolarHBondContact O-N 3.47Å; F46-I50 HydrophobicContact CD1-CD1 3.74Å; F46-I50 HydrophobicContact CE1-CD1 3.28Å; F46-I50 HydrophobicContact CE1-CG1 4.31Å; F46-I50 HydrophobicContact CZ-CD1 3.76Å; F46-I50 HydrophobicContact CZ-CG1 4.46Å; F46-I50 PolarHBondContact O-N 3.36Å
47	L	89.9	Confident	86.8	Confident	85 Å²	85	102.1 Å²	102.1	45%	0.445	54%	0.54	S	S	.	.	H	α-helix	trans	-62.3	-40.6	175.8	-74.1	171.7	0	0	0	112	K43 H44 K49 I50 L51	K43-L47 HydrophobicContact CG-CD1 4.02Å; K43-L47 HydrophobicContact CG-CG 4.48Å; K43-L47 WeakPolarHBondContact O-CB 3.46Å; K43-L47 VanDerWaalsContact O-CG 3.26Å; K43-L47 WeakPolarHBondContact O-CG 3.27Å; K43-L47 PolarHBondContact O-N 3.19Å; H44-L47 PolarHBondContact O-N 2.8Å; L47-K49 VanDerWaalsContact C-N 3.34Å; L47-K49 PolarHBondContact O-N 3.16Å; L47-I50 PolarHBondContact O-N 3.49Å; L47-L51 WeakPolarHBondContact O-CB 3.36Å; L47-L51 PolarHBondContact O-N 2.66Å
48	S	90.9	Very high	85.6	Confident	66 Å²	66	99.8 Å²	99.8	46%	0.462	54%	0.542	S	S	.	.	H	α-helix	trans	-63	-40	176.4	-178.8	0	0	0	0	111.9	H44 E45 F46 L51 K52	H44-S48 WeakPolarHBondContact O-CB 3.44Å; H44-S48 PolarHBondContact O-N 3.15Å; E45-S48 PolarHBondContact O-N 2.95Å; F46-S48 VanDerWaalsContact C-N 3.34Å; F46-S48 PolarHBondContact O-N 3.21Å; S48-L51 PolarHBondContact O-N 2.96Å; S48-K52 WeakPolarHBondContact O-CB 3.26Å; S48-K52 PolarHBondContact O-N 3.27Å
49	K	90.7	Very high	84.1	Confident	126 Å²	126	104.8 Å²	104.8	55%	0.548	57%	0.569	S	S	.	*	H	α-helix	trans	-64.2	-42	174.3	-76.5	172	172.5	163.7	0	112.4	E45 F46 L47 K52 A53	E45-K49 WeakPolarHBondContact O-CG 3.3Å; E45-K49 PolarHBondContact O-N 3.46Å; E45-K49 WeakPolarHBondContact OE1-CE 3.35Å; E45-K49 IonicContact OE1-NZ 2.68Å; E45-K49 PolarHBondContact OE1-NZ 2.91Å; F46-K49 PolarHBondContact O-N 3.47Å; L47-K49 VanDerWaalsContact C-N 3.34Å; L47-K49 PolarHBondContact O-N 3.16Å; K49-K52 PolarHBondContact O-N 2.97Å; K49-A53 PolarHBondContact O-N 3.46Å
50	I	89.7	Confident	84.2	Confident	70 Å²	70	105.8 Å²	105.8	36%	0.359	57%	0.571	S	S	.	*	H	α-helix	trans	-63	-49.3	175.1	-70.8	171.9	0	0	0	110.8	F46 L47 K52 A53 I54	F46-I50 HydrophobicContact CD1-CD1 3.74Å; F46-I50 HydrophobicContact CE1-CD1 3.28Å; F46-I50 HydrophobicContact CE1-CG1 4.31Å; F46-I50 HydrophobicContact CZ-CD1 3.76Å; F46-I50 HydrophobicContact CZ-CG1 4.46Å; F46-I50 PolarHBondContact O-N 3.36Å; L47-I50 PolarHBondContact O-N 3.49Å; I50-K52 VanDerWaalsContact C-N 3.28Å; I50-K52 PolarHBondContact O-N 3.33Å; I50-A53 PolarHBondContact O-N 2.91Å; I50-A53 VanDerWaalsContact O-N 3.16Å; I50-I54 HydrophobicContact CG2-CD1 3.7Å; I50-I54 HydrophobicContact CG2-CG1 4.37Å; I50-I54 WeakPolarHBondContact O-CG1 3.16Å; I50-I54 PolarHBondContact O-N 2.87Å
51	L	89.9	Confident	84.1	Confident	110 Å²	110	109.3 Å²	109.3	58%	0.576	58%	0.58	S	S	*	*	H	α-helix	trans	-55.9	-45.7	177.7	-100.5	148.1	0	0	0	111.2	L47 S48 I54 T55	L47-L51 WeakPolarHBondContact O-CB 3.36Å; L47-L51 PolarHBondContact O-N 2.66Å; S48-L51 PolarHBondContact O-N 2.96Å; L51-I54 PolarHBondContact O-N 3.11Å; L51-T55 PolarHBondContact O-N 3.34Å; L51-T55 PolarHBondContact O-OG1 3.45Å; L51-T55 VanDerWaalsContact O-OG1 3.05Å
52	K	90.8	Very high	84	Confident	133 Å²	133	108.8 Å²	108.8	58%	0.578	58%	0.579	S	S	*	*	H	α-helix	trans	-59.6	-46.7	176.6	-173.1	176.3	178.3	-177.3	0	112	S48 K49 I50 I54 T55 D56	S48-K52 WeakPolarHBondContact O-CB 3.26Å; S48-K52 PolarHBondContact O-N 3.27Å; K49-K52 PolarHBondContact O-N 2.97Å; I50-K52 VanDerWaalsContact C-N 3.28Å; I50-K52 PolarHBondContact O-N 3.33Å; K52-I54 VanDerWaalsContact C-N 3.33Å; K52-I54 PolarHBondContact O-N 2.99Å; K52-T55 WeakPolarHBondContact CA-OG1 3.34Å; K52-T55 PolarHBondContact O-N 3.18Å; K52-T55 PolarHBondContact O-OG1 3.12Å; K52-D56 WeakPolarHBondContact O-CB 3.48Å; K52-D56 PolarHBondContact O-N 3.4Å
53	A	88	Confident	83.9	Confident	53 Å²	53	110.2 Å²	110.2	44%	0.438	58%	0.582	S	S	.	*	H	α-helix	trans	-61	-41.8	178	0	0	0	0	0	112.1	K49 I50 T55 D56 D57	K49-A53 PolarHBondContact O-N 3.46Å; I50-A53 PolarHBondContact O-N 2.91Å; I50-A53 VanDerWaalsContact O-N 3.16Å; A53-T55 PolarHBondContact O-N 3.44Å; A53-D56 PolarHBondContact O-N 2.93Å; A53-D57 PolarHBondContact O-N 3.2Å
54	I	88.6	Confident	83.6	Confident	112 Å²	112	108.4 Å²	108.4	57%	0.574	58%	0.581	S	S	*	*	H	α-helix	trans	-64.6	-40.2	176.7	-66.4	168.2	0	0	0	111.2	I50 L51 K52 G58	I50-I54 HydrophobicContact CG2-CD1 3.7Å; I50-I54 HydrophobicContact CG2-CG1 4.37Å; I50-I54 WeakPolarHBondContact O-CG1 3.16Å; I50-I54 PolarHBondContact O-N 2.87Å; L51-I54 PolarHBondContact O-N 3.11Å; K52-I54 VanDerWaalsContact C-N 3.33Å; K52-I54 PolarHBondContact O-N 2.99Å; I54-G58 PolarHBondContact O-N 2.95Å
55	T	87.6	Confident	83.2	Confident	83 Å²	83	106.7 Å²	106.7	51%	0.509	58%	0.578	S	S	.	*	H	α-helix	trans	-72.1	-31.4	177.1	47.9	0	0	0	0	113.1	L51 K52 A53 G58	L51-T55 PolarHBondContact O-N 3.34Å; L51-T55 PolarHBondContact O-OG1 3.45Å; L51-T55 VanDerWaalsContact O-OG1 3.05Å; K52-T55 WeakPolarHBondContact CA-OG1 3.34Å; K52-T55 PolarHBondContact O-N 3.18Å; K52-T55 PolarHBondContact O-OG1 3.12Å; A53-T55 PolarHBondContact O-N 3.44Å; T55-G58 PolarHBondContact O-N 3.37Å
56	D	80.5	Confident	82.8	Confident	101 Å²	101	106.8 Å²	106.8	54%	0.54	58%	0.584	S	S	.	*	H	α-helix	trans	-73.9	-32.4	177.8	-69.7	-12	0	0	0	111.2	K52 A53 G58	K52-D56 WeakPolarHBondContact O-CB 3.48Å; K52-D56 PolarHBondContact O-N 3.4Å; A53-D56 PolarHBondContact O-N 2.93Å; D56-G58 VanDerWaalsContact C-N 3.33Å
57	D	72.9	Confident	82.4	Confident	151 Å²	151	104.9 Å²	104.9	81%	0.807	59%	0.585	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.8	-13	172.8	-87.7	-1.5	0	0	0	113.5	A53	A53-D57 PolarHBondContact O-N 3.2Å
58	G	60.6	Low	81.7	Confident	61 Å²	61	106.6 Å²	106.6	63%	0.629	60%	0.597	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.5	2.7	-175.6	0	0	0	0	0	115.8	I54 T55 D56	I54-G58 PolarHBondContact O-N 2.95Å; T55-G58 PolarHBondContact O-N 3.37Å; D56-G58 VanDerWaalsContact C-N 3.33Å
59	N	50.8	Low	80.9	Confident	213 Å²	213	110.3 Å²	110.3	100%	1.139	61%	0.609	S	S	*	*			trans	-121.7	0	173.7	-96.6	-11.7	0	0	0	110.5

Retrieved 59 of 59 residues in 20.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).