A0AA82N3E9_SCHMA Loading...

Uncharacterized protein AlphaSync

AlphaFold DB , UniProt , Accession A0AA82N3E9, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 35 aa.

						>A0AA82N3E9_SCHMA|A0AA82N3E9
MLLLFTLKQKYNSTLSHCQSAVNLYSYIYIVKWCI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.8	Low	73.2	Confident	226 Å²	226	141.2 Å²	141.2	100%	1.113	68%	0.677	S	S	*	*				0	6.6	0	-101.2	-173.1	175.8	0	115.1
2	L	66.2	Low	73.5	Confident	151 Å²	151	138.6 Å²	138.6	79%	0.791	67%	0.669	S	S	*	*			trans	-85.2	-30.8	-179	-73.3	156.9	0	0	114.2	L4 F5	L2-L4 PolarHBondContact O-N 2.98Å; L2-F5 PolarHBondContact O-N 3.3Å
3	L	68.4	Low	74	Confident	142 Å²	142	132.5 Å²	132.5	74%	0.743	65%	0.65	S	S	*	*	H	α-helix	trans	-67.5	-30.3	-175.4	-70.7	164.4	0	0	114	F5 T6 L7	L3-F5 VanDerWaalsContact C-N 3.34Å; L3-T6 PolarHBondContact O-OG1 3.03Å; L3-L7 WeakPolarHBondContact O-CG 3.45Å; L3-L7 PolarHBondContact O-N 3.03Å
4	L	71.5	Confident	74.5	Confident	126 Å²	126	129.1 Å²	129.1	66%	0.66	64%	0.641	S	S	*	*	H	α-helix	trans	-73.7	-27.9	179	-68.6	169.5	0	0	112.4	L2 K8	L2-L4 PolarHBondContact O-N 2.98Å; L4-K8 PolarHBondContact O-N 3.43Å
5	F	76.6	Confident	75	Confident	129 Å²	129	126.7 Å²	126.7	57%	0.566	63%	0.63	S	S	*	*	H	α-helix	trans	-72.8	-42.6	179.4	-172.9	-106.1	0	0	111.4	L2 L3 L7 K8 Q9	L2-F5 PolarHBondContact O-N 3.3Å; L3-F5 VanDerWaalsContact C-N 3.34Å; F5-L7 PolarHBondContact O-N 3.47Å; F5-K8 PolarHBondContact O-N 3.3Å; F5-Q9 HydrophobicContact CD1-CG 4.36Å; F5-Q9 HydrophobicContact CE1-CG 4.16Å; F5-Q9 HydrophobicContact CZ-CG 4.42Å; F5-Q9 VanDerWaalsContact CZ-NE2 3.33Å; F5-Q9 WeakPolarHBondContact O-CG 3.49Å; F5-Q9 PolarHBondContact O-N 3.38Å
6	T	77.6	Confident	75.4	Confident	67 Å²	67	123.8 Å²	123.8	41%	0.411	63%	0.626	S	S	.	*	H	α-helix	trans	-66.9	-36	178.5	55.5	0	0	0	112.4	L3 Q9 K10	L3-T6 PolarHBondContact O-OG1 3.03Å; T6-Q9 PolarHBondContact O-N 3.26Å; T6-K10 WeakPolarHBondContact O-CG 3.41Å; T6-K10 PolarHBondContact O-N 3.4Å
7	L	74.7	Confident	75.7	Confident	114 Å²	114	124.2 Å²	124.2	60%	0.597	63%	0.625	S	S	*	*	H	α-helix	trans	-64.1	-43.8	173.7	-70.1	173.9	0	0	111.9	L3 F5 K10 Y11	L3-L7 WeakPolarHBondContact O-CG 3.45Å; L3-L7 PolarHBondContact O-N 3.03Å; F5-L7 PolarHBondContact O-N 3.47Å; L7-K10 PolarHBondContact O-N 3.13Å; L7-Y11 WeakPolarHBondContact O-CB 3.48Å; L7-Y11 PolarHBondContact O-N 3.36Å
8	K	75.1	Confident	76.1	Confident	168 Å²	168	121.5 Å²	121.5	73%	0.73	62%	0.619	S	S	*	*	H	α-helix	trans	-63.5	-40.7	175.5	-80.6	-168.8	174.6	-173.9	112.5	L4 F5 Y11 N12	L4-K8 PolarHBondContact O-N 3.43Å; F5-K8 PolarHBondContact O-N 3.3Å; K8-Y11 PolarHBondContact O-N 3.38Å; K8-N12 WeakPolarHBondContact O-CB 3.44Å; K8-N12 PolarHBondContact O-N 2.97Å
9	Q	76	Confident	76.5	Confident	108 Å²	108	121.6 Å²	121.6	51%	0.505	62%	0.616	S	S	.	*	H	α-helix	trans	-63.3	-45.2	177	-75.1	-171.3	-19.9	0	112.4	F5 T6 Y11 N12 S13	F5-Q9 HydrophobicContact CD1-CG 4.36Å; F5-Q9 HydrophobicContact CE1-CG 4.16Å; F5-Q9 HydrophobicContact CZ-CG 4.42Å; F5-Q9 VanDerWaalsContact CZ-NE2 3.33Å; F5-Q9 WeakPolarHBondContact O-CG 3.49Å; F5-Q9 PolarHBondContact O-N 3.38Å; T6-Q9 PolarHBondContact O-N 3.26Å; Q9-Y11 VanDerWaalsContact C-N 3.33Å; Q9-Y11 PolarHBondContact O-N 2.98Å; Q9-N12 PolarHBondContact O-N 3.01Å; Q9-S13 WeakPolarHBondContact O-CB 3.48Å; Q9-S13 PolarHBondContact O-N 3.38Å
10	K	77.6	Confident	76.8	Confident	153 Å²	153	119.8 Å²	119.8	67%	0.665	62%	0.615	S	S	*	*	H	α-helix	trans	-60.5	-44.8	175.7	-75.2	-171.7	178.7	-172.6	111.3	T6 L7 N12 S13 T14	T6-K10 WeakPolarHBondContact O-CG 3.41Å; T6-K10 PolarHBondContact O-N 3.4Å; L7-K10 PolarHBondContact O-N 3.13Å; K10-N12 PolarHBondContact O-N 3.43Å; K10-S13 PolarHBondContact O-N 2.98Å; K10-T14 PolarHBondContact O-N 3.47Å; K10-T14 PolarHBondContact O-OG1 3.1Å
11	Y	80.7	Confident	77.2	Confident	169 Å²	169	116 Å²	116	66%	0.663	60%	0.602	S	S	*	*	H	α-helix	trans	-60.6	-44.2	178.3	-170.7	-95.9	0	0	112.2	L7 K8 Q9 T14 L15	L7-Y11 WeakPolarHBondContact O-CB 3.48Å; L7-Y11 PolarHBondContact O-N 3.36Å; K8-Y11 PolarHBondContact O-N 3.38Å; Q9-Y11 VanDerWaalsContact C-N 3.33Å; Q9-Y11 PolarHBondContact O-N 2.98Å; Y11-T14 PolarHBondContact O-N 3.01Å; Y11-L15 WeakPolarHBondContact O-CB 3.47Å; Y11-L15 PolarHBondContact O-N 2.97Å
12	N	77.1	Confident	78.4	Confident	110 Å²	110	109.5 Å²	109.5	59%	0.588	58%	0.575	S	S	*	*	H	α-helix	trans	-68.9	-37.2	-179.5	-159.2	48.4	0	0	112.8	K8 Q9 K10 L15 S16	K8-N12 WeakPolarHBondContact O-CB 3.44Å; K8-N12 PolarHBondContact O-N 2.97Å; Q9-N12 PolarHBondContact O-N 3.01Å; K10-N12 PolarHBondContact O-N 3.43Å; N12-L15 PolarHBondContact O-N 2.99Å; N12-S16 PolarHBondContact O-N 3.42Å
13	S	80.1	Confident	79.3	Confident	59 Å²	59	107.4 Å²	107.4	41%	0.413	56%	0.564	S	S	.	*	H	α-helix	trans	-62.6	-49.5	173.9	-174.3	0	0	0	111	Q9 K10 L15 S16 H17	Q9-S13 WeakPolarHBondContact O-CB 3.48Å; Q9-S13 PolarHBondContact O-N 3.38Å; K10-S13 PolarHBondContact O-N 2.98Å; S13-L15 VanDerWaalsContact C-N 3.31Å; S13-L15 PolarHBondContact O-N 3.45Å; S13-S16 WeakPolarHBondContact O-CB 3.47Å; S13-S16 PolarHBondContact O-N 3.34Å; S13-S16 VanDerWaalsContact O-N 3.13Å; S13-H17 PolarHBondContact O-CD2 3.43Å; S13-H17 PolarHBondContact O-N 3.02Å
14	T	80.9	Confident	80.1	Confident	86 Å²	86	105.6 Å²	105.6	53%	0.528	56%	0.555	S	S	.	*	H	α-helix	trans	-59.9	-41	177.1	-55.3	0	0	0	111.8	K10 Y11 S16 H17 C18	K10-T14 PolarHBondContact O-N 3.47Å; K10-T14 PolarHBondContact O-OG1 3.1Å; Y11-T14 PolarHBondContact O-N 3.01Å; T14-S16 VanDerWaalsContact C-N 3.34Å; T14-S16 PolarHBondContact O-N 3.46Å; T14-H17 PolarHBondContact O-N 2.93Å; T14-C18 WeakPolarHBondContact O-CB 3.46Å; T14-C18 PolarHBondContact O-N 2.97Å
15	L	82.1	Confident	80.8	Confident	92 Å²	92	107.9 Å²	107.9	48%	0.482	56%	0.556	S	S	.	*	H	α-helix	trans	-60.5	-43.7	175.9	-165.2	90.2	0	0	111.5	Y11 N12 S13 C18 Q19	Y11-L15 WeakPolarHBondContact O-CB 3.47Å; Y11-L15 PolarHBondContact O-N 2.97Å; N12-L15 PolarHBondContact O-N 2.99Å; S13-L15 VanDerWaalsContact C-N 3.31Å; S13-L15 PolarHBondContact O-N 3.45Å; L15-C18 PolarHBondContact O-N 3.42Å; L15-Q19 WeakPolarHBondContact O-CB 3.4Å; L15-Q19 PolarHBondContact O-N 3.31Å
16	S	80.6	Confident	81.2	Confident	80 Å²	80	104.5 Å²	104.5	56%	0.559	55%	0.548	S	S	*	.	H	α-helix	trans	-62.8	-42.9	177.2	-172.2	0	0	0	112.1	N12 S13 T14 Q19 S20	N12-S16 PolarHBondContact O-N 3.42Å; S13-S16 WeakPolarHBondContact O-CB 3.47Å; S13-S16 PolarHBondContact O-N 3.34Å; S13-S16 VanDerWaalsContact O-N 3.13Å; T14-S16 VanDerWaalsContact C-N 3.34Å; T14-S16 PolarHBondContact O-N 3.46Å; S16-Q19 PolarHBondContact O-N 2.84Å; S16-S20 WeakPolarHBondContact O-CB 3.44Å; S16-S20 PolarHBondContact O-N 3.35Å
17	H	81.7	Confident	81.7	Confident	131 Å²	131	108.5 Å²	108.5	61%	0.606	56%	0.557	S	S	*	*	H	α-helix	trans	-64.9	-43.3	176.1	-74.5	-69.6	0	0	111.8	S13 T14 S20 A21	S13-H17 PolarHBondContact O-CD2 3.43Å; S13-H17 PolarHBondContact O-N 3.02Å; T14-H17 PolarHBondContact O-N 2.93Å; H17-S20 PolarHBondContact O-N 3.26Å; H17-A21 WeakPolarHBondContact O-CB 3.46Å; H17-A21 PolarHBondContact O-N 3.46Å
18	C	81.7	Confident	82.3	Confident	76 Å²	76	107.4 Å²	107.4	51%	0.514	55%	0.551	S	S	.	*	H	α-helix	trans	-61.6	-44.6	174.1	-85	0	0	0	111.9	T14 L15 S20 A21 V22	T14-C18 WeakPolarHBondContact O-CB 3.46Å; T14-C18 PolarHBondContact O-N 2.97Å; L15-C18 PolarHBondContact O-N 3.42Å; C18-S20 VanDerWaalsContact C-N 3.34Å; C18-S20 PolarHBondContact O-N 2.99Å; C18-A21 PolarHBondContact O-N 2.89Å; C18-V22 WeakPolarHBondContact O-CB 3.24Å; C18-V22 VanDerWaalsContact O-CG2 3.26Å; C18-V22 WeakPolarHBondContact O-CG2 3.22Å; C18-V22 PolarHBondContact O-N 2.83Å
19	Q	84	Confident	82.8	Confident	124 Å²	124	106.6 Å²	106.6	58%	0.579	54%	0.544	S	S	*	.	H	α-helix	trans	-63.6	-41.6	179.2	-170.7	62.6	38.2	0	111.6	L15 S16 V22 N23	L15-Q19 WeakPolarHBondContact O-CB 3.4Å; L15-Q19 PolarHBondContact O-N 3.31Å; S16-Q19 PolarHBondContact O-N 2.84Å; Q19-V22 PolarHBondContact O-N 3.41Å; Q19-N23 VanDerWaalsContact O-CB 3.3Å; Q19-N23 WeakPolarHBondContact O-CB 3.5Å; Q19-N23 PolarHBondContact O-N 2.81Å
20	S	83.2	Confident	83.2	Confident	84 Å²	84	105.9 Å²	105.9	59%	0.587	54%	0.543	S	S	*	.	H	α-helix	trans	-63.1	-42.6	175.6	-170.2	0	0	0	111.6	S16 H17 C18 L24	S16-S20 WeakPolarHBondContact O-CB 3.44Å; S16-S20 PolarHBondContact O-N 3.35Å; H17-S20 PolarHBondContact O-N 3.26Å; C18-S20 VanDerWaalsContact C-N 3.34Å; C18-S20 PolarHBondContact O-N 2.99Å; S20-L24 WeakPolarHBondContact O-CB 3.4Å; S20-L24 PolarHBondContact O-N 3.41Å
21	A	83.9	Confident	83.4	Confident	42 Å²	42	101.1 Å²	101.1	35%	0.347	53%	0.527	S	S	.	.	H	α-helix	trans	-64.5	-48.7	176.7	0	0	0	0	111.1	H17 C18 N23 L24 Y25	H17-A21 WeakPolarHBondContact O-CB 3.46Å; H17-A21 PolarHBondContact O-N 3.46Å; C18-A21 PolarHBondContact O-N 2.89Å; A21-N23 VanDerWaalsContact C-N 3.31Å; A21-N23 PolarHBondContact O-N 3.42Å; A21-L24 PolarHBondContact O-N 2.84Å; A21-Y25 WeakPolarHBondContact O-CB 3.3Å; A21-Y25 WeakPolarHBondContact O-CD2 3.26Å; A21-Y25 PolarHBondContact O-N 3.18Å
22	V	86	Confident	83.7	Confident	88 Å²	88	100.9 Å²	100.9	53%	0.533	53%	0.529	S	S	.	.	H	α-helix	trans	-58.9	-42.6	177.8	171	0	0	0	111.1	C18 Q19 Y25 S26	C18-V22 WeakPolarHBondContact O-CB 3.24Å; C18-V22 VanDerWaalsContact O-CG2 3.26Å; C18-V22 WeakPolarHBondContact O-CG2 3.22Å; C18-V22 PolarHBondContact O-N 2.83Å; Q19-V22 PolarHBondContact O-N 3.41Å; V22-Y25 PolarHBondContact O-N 3.38Å; V22-S26 VanDerWaalsContact O-CB 3.24Å; V22-S26 WeakPolarHBondContact O-CB 3.45Å; V22-S26 PolarHBondContact O-N 2.89Å
23	N	85.5	Confident	83.8	Confident	108 Å²	108	105.1 Å²	105.1	58%	0.578	54%	0.537	S	S	*	.	H	α-helix	trans	-65.1	-42	177.4	-166.9	40.4	0	0	111.8	Q19 A21 S26 Y27	Q19-N23 VanDerWaalsContact O-CB 3.3Å; Q19-N23 WeakPolarHBondContact O-CB 3.5Å; Q19-N23 PolarHBondContact O-N 2.81Å; A21-N23 VanDerWaalsContact C-N 3.31Å; A21-N23 PolarHBondContact O-N 3.42Å; N23-S26 PolarHBondContact O-N 3.46Å; N23-Y27 VanDerWaalsContact O-CB 3.26Å; N23-Y27 WeakPolarHBondContact O-CB 3.22Å; N23-Y27 PolarHBondContact O-N 2.83Å
24	L	85.3	Confident	83.7	Confident	103 Å²	103	107.6 Å²	107.6	54%	0.539	55%	0.553	S	S	.	*	H	α-helix	trans	-63.4	-45.8	175.7	-173.1	70.4	0	0	111.5	S20 A21 Y27 I28	S20-L24 WeakPolarHBondContact O-CB 3.4Å; S20-L24 PolarHBondContact O-N 3.41Å; A21-L24 PolarHBondContact O-N 2.84Å; L24-Y27 PolarHBondContact O-N 3.38Å; L24-I28 HydrophobicContact CD1-CD1 4.5Å; L24-I28 HydrophobicContact CG-CD1 4.02Å; L24-I28 VanDerWaalsContact O-CG1 3.24Å; L24-I28 WeakPolarHBondContact O-CG1 3.46Å; L24-I28 PolarHBondContact O-N 2.92Å
25	Y	86.6	Confident	82.9	Confident	175 Å²	175	112.7 Å²	112.7	69%	0.686	58%	0.575	S	S	*	*	H	α-helix	trans	-62.4	-43.2	176.1	-87.8	-75	0	0	111.9	A21 V22 I28 Y29	A21-Y25 WeakPolarHBondContact O-CB 3.3Å; A21-Y25 WeakPolarHBondContact O-CD2 3.26Å; A21-Y25 PolarHBondContact O-N 3.18Å; V22-Y25 PolarHBondContact O-N 3.38Å; Y25-I28 PolarHBondContact O-N 2.92Å; Y25-Y29 WeakPolarHBondContact O-CB 3.2Å; Y25-Y29 PolarHBondContact O-N 3.37Å
26	S	85.3	Confident	83	Confident	57 Å²	57	113.7 Å²	113.7	40%	0.399	58%	0.579	S	S	.	*	H	α-helix	trans	-63.8	-44	176.8	-173.9	0	0	0	111.1	V22 N23 Y29 I30	V22-S26 VanDerWaalsContact O-CB 3.24Å; V22-S26 WeakPolarHBondContact O-CB 3.45Å; V22-S26 PolarHBondContact O-N 2.89Å; N23-S26 PolarHBondContact O-N 3.46Å; S26-Y29 PolarHBondContact O-N 3.34Å; S26-I30 WeakPolarHBondContact O-CB 3.26Å; S26-I30 VanDerWaalsContact O-CG1 3.23Å; S26-I30 WeakPolarHBondContact O-CG1 3.24Å; S26-I30 PolarHBondContact O-N 2.88Å
27	Y	86.7	Confident	83.1	Confident	151 Å²	151	115.5 Å²	115.5	59%	0.592	58%	0.58	S	S	*	*	H	α-helix	trans	-59.3	-48.9	175	179.5	-101.2	0	0	111.8	N23 L24 Y29 I30 V31	N23-Y27 VanDerWaalsContact O-CB 3.26Å; N23-Y27 WeakPolarHBondContact O-CB 3.22Å; N23-Y27 PolarHBondContact O-N 2.83Å; L24-Y27 PolarHBondContact O-N 3.38Å; Y27-Y29 VanDerWaalsContact C-N 3.3Å; Y27-Y29 PolarHBondContact O-N 3.37Å; Y27-I30 PolarHBondContact O-N 3.26Å; Y27-V31 HydrophobicContact CD1-CG2 4.21Å; Y27-V31 HydrophobicContact CD2-CG2 4.21Å; Y27-V31 HydrophobicContact CE1-CG2 3.86Å; Y27-V31 HydrophobicContact CE2-CG2 3.85Å; Y27-V31 HydrophobicContact CG-CG2 4.38Å; Y27-V31 WeakPolarHBondContact O-CB 3.38Å; Y27-V31 VanDerWaalsContact O-CG2 3.22Å; Y27-V31 WeakPolarHBondContact O-CG2 3.37Å; Y27-V31 PolarHBondContact O-N 2.87Å
28	I	87.4	Confident	83.2	Confident	92 Å²	92	114.6 Å²	114.6	47%	0.472	58%	0.579	S	S	.	*	H	α-helix	trans	-60.1	-41.8	177.4	-68.1	165	0	0	110.9	L24 Y25 K32	L24-I28 HydrophobicContact CD1-CD1 4.5Å; L24-I28 HydrophobicContact CG-CD1 4.02Å; L24-I28 VanDerWaalsContact O-CG1 3.24Å; L24-I28 WeakPolarHBondContact O-CG1 3.46Å; L24-I28 PolarHBondContact O-N 2.92Å; Y25-I28 PolarHBondContact O-N 2.92Å; I28-K32 WeakPolarHBondContact O-CB 3.23Å; I28-K32 PolarHBondContact O-N 3.42Å
29	Y	86.2	Confident	83.2	Confident	150 Å²	150	116.9 Å²	116.9	59%	0.588	58%	0.583	S	S	*	*	H	α-helix	trans	-66.8	-44.2	179.5	-171.7	-96	0	0	112.4	Y25 S26 Y27 K32 W33	Y25-Y29 WeakPolarHBondContact O-CB 3.2Å; Y25-Y29 PolarHBondContact O-N 3.37Å; S26-Y29 PolarHBondContact O-N 3.34Å; Y27-Y29 VanDerWaalsContact C-N 3.3Å; Y27-Y29 PolarHBondContact O-N 3.37Å; Y29-K32 PolarHBondContact O-N 2.93Å; Y29-W33 AromaticContact CE1-CE3 3.74Å; Y29-W33 HydrophobicContact CE1-CE3 3.74Å; Y29-W33 HydrophobicContact CE1-CZ3 4.03Å; Y29-W33 PolarHBondContact O-N 3.39Å; Y29-W33 VanDerWaalsContact O-N 3.13Å
30	I	84.9	Confident	83.2	Confident	94 Å²	94	116.4 Å²	116.4	48%	0.482	58%	0.583	S	S	.	*	H	α-helix	trans	-62.8	-48.2	176.5	-68.1	165.3	0	0	110.1	S26 Y27 K32 W33 C34	S26-I30 WeakPolarHBondContact O-CB 3.26Å; S26-I30 VanDerWaalsContact O-CG1 3.23Å; S26-I30 WeakPolarHBondContact O-CG1 3.24Å; S26-I30 PolarHBondContact O-N 2.88Å; Y27-I30 PolarHBondContact O-N 3.26Å; I30-K32 VanDerWaalsContact C-N 3.3Å; I30-K32 PolarHBondContact O-N 3.48Å; I30-W33 PolarHBondContact O-N 3.32Å; I30-W33 VanDerWaalsContact O-N 3.12Å; I30-C34 PolarHBondContact O-N 3Å; I30-C34 PolarHBondContact O-SG 3.12Å
31	V	82.3	Confident	83.2	Confident	53 Å²	53	118.6 Å²	118.6	32%	0.321	58%	0.582	S	S	.	*	H	α-helix	trans	-60.4	-41.1	178.4	171.5	0	0	0	111.2	Y27 W33 C34 I35	Y27-V31 HydrophobicContact CD1-CG2 4.21Å; Y27-V31 HydrophobicContact CD2-CG2 4.21Å; Y27-V31 HydrophobicContact CE1-CG2 3.86Å; Y27-V31 HydrophobicContact CE2-CG2 3.85Å; Y27-V31 HydrophobicContact CG-CG2 4.38Å; Y27-V31 WeakPolarHBondContact O-CB 3.38Å; Y27-V31 VanDerWaalsContact O-CG2 3.22Å; Y27-V31 WeakPolarHBondContact O-CG2 3.37Å; Y27-V31 PolarHBondContact O-N 2.87Å; V31-W33 VanDerWaalsContact C-N 3.26Å; V31-W33 PolarHBondContact O-N 3.38Å; V31-C34 PolarHBondContact O-N 3.36Å; V31-I35 HydrophobicContact CG1-CD1 4.22Å; V31-I35 PolarHBondContact O-N 3.13Å
32	K	85.2	Confident	83.1	Confident	164 Å²	164	124.1 Å²	124.1	71%	0.713	60%	0.599	S	S	*	*	H	α-helix	trans	-67.3	-24.1	178.5	-172.4	173.1	-178.7	-178.8	113.5	I28 Y29 I30	I28-K32 WeakPolarHBondContact O-CB 3.23Å; I28-K32 PolarHBondContact O-N 3.42Å; Y29-K32 PolarHBondContact O-N 2.93Å; I30-K32 VanDerWaalsContact C-N 3.3Å; I30-K32 PolarHBondContact O-N 3.48Å
33	W	80	Confident	82.9	Confident	199 Å²	199	126.8 Å²	126.8	75%	0.754	60%	0.604	S	S	*	*	H	α-helix	trans	-90.4	-24.3	176.1	-158.1	-7.4	0	0	112.5	Y29 I30 V31	Y29-W33 AromaticContact CE1-CE3 3.74Å; Y29-W33 HydrophobicContact CE1-CE3 3.74Å; Y29-W33 HydrophobicContact CE1-CZ3 4.03Å; Y29-W33 PolarHBondContact O-N 3.39Å; Y29-W33 VanDerWaalsContact O-N 3.13Å; I30-W33 PolarHBondContact O-N 3.32Å; I30-W33 VanDerWaalsContact O-N 3.12Å; V31-W33 VanDerWaalsContact C-N 3.26Å; V31-W33 PolarHBondContact O-N 3.38Å
34	C	77.6	Confident	82.7	Confident	110 Å²	110	128.4 Å²	128.4	74%	0.743	61%	0.607	S	S	*	*	H	α-helix	trans	-78.1	-20.1	177.7	-75.7	0	0	0	114.7	I30 V31	I30-C34 PolarHBondContact O-N 3Å; I30-C34 PolarHBondContact O-SG 3.12Å; V31-C34 PolarHBondContact O-N 3.36Å
35	I	64.9	Low	82.5	Confident	193 Å²	193	130.7 Å²	130.7	99%	0.99	61%	0.613	S	S	*	*			trans	-95.7	0	174.4	-60.5	170.9	0	0	108.8	V31	V31-I35 HydrophobicContact CG1-CD1 4.22Å; V31-I35 PolarHBondContact O-N 3.13Å

Retrieved 35 of 35 residues in 25.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).