A0AA82N4D5_SCHMA Loading...

Uncharacterized protein AlphaSync

AlphaFold DB , UniProt , Accession A0AA82N4D5, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 53 aa.

						>A0AA82N4D5_SCHMA|A0AA82N4D5
MSEFSYCSTGSRTSTSTSTRWKVSLLFRCMPSMSSVLWMSWMSRWRLLWWMLQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	31.5	Very low	44.5	Very low	229 Å²	229	139.2 Å²	139.2	100%	1.128	80%	0.803	S	S	*	*				0	101.8	0	-81.9	163	149.8	0	0	108.3
2	S	43.7	Very low	45	Very low	119 Å²	119	146.6 Å²	146.6	83%	0.832	81%	0.808	S	S	*	*			trans	-144.3	75.9	160.4	-63.2	0	0	0	0	106	F4	S2-F4 VanDerWaalsContact C-N 3.27Å; S2-F4 PolarHBondContact O-N 3.34Å
3	E	43	Very low	45.6	Very low	169 Å²	169	145.9 Å²	145.9	79%	0.79	81%	0.811	S	S	*	*			trans	-64.4	95.3	165.8	-79	172.7	89	0	0	107.3	S5	E3-S5 PolarHBondContact O-N 3.14Å
4	F	52.2	Low	46.2	Very low	160 Å²	160	143.1 Å²	143.1	70%	0.702	81%	0.806	S	S	*	*			trans	-82.3	71	170.4	-146.4	-91.3	0	0	0	107.2	S2 Y6	S2-F4 VanDerWaalsContact C-N 3.27Å; S2-F4 PolarHBondContact O-N 3.34Å; F4-Y6 VanDerWaalsContact C-N 3.27Å; F4-Y6 AromaticContact CD1-CD2 3.54Å; F4-Y6 HydrophobicContact CD1-CD2 3.54Å; F4-Y6 AromaticContact CD1-CE2 3.31Å; F4-Y6 HydrophobicContact CD1-CE2 3.31Å; F4-Y6 HydrophobicContact CD1-CG 4.49Å; F4-Y6 AromaticContact CE1-CD2 3.97Å; F4-Y6 HydrophobicContact CE1-CD2 3.97Å; F4-Y6 AromaticContact CE1-CE2 3.39Å; F4-Y6 HydrophobicContact CE1-CE2 3.39Å; F4-Y6 AromaticContact CE1-CZ 3.7Å; F4-Y6 PolarHBondContact O-N 3.4Å
5	S	46	Very low	46.6	Very low	89 Å²	89	141.9 Å²	141.9	62%	0.622	80%	0.804	S	S	*	*			trans	-67.1	92	172.5	-60.6	0	0	0	0	107.9	E3 C7	E3-S5 PolarHBondContact O-N 3.14Å; S5-C7 PolarHBondContact O-N 3.23Å
6	Y	43.1	Very low	47	Very low	200 Å²	200	138.4 Å²	138.4	78%	0.784	79%	0.791	S	S	*	*			trans	-59.3	82.4	157.9	-89.9	-87.4	0	0	0	107.3	F4 S8	F4-Y6 VanDerWaalsContact C-N 3.27Å; F4-Y6 AromaticContact CD1-CD2 3.54Å; F4-Y6 HydrophobicContact CD1-CD2 3.54Å; F4-Y6 AromaticContact CD1-CE2 3.31Å; F4-Y6 HydrophobicContact CD1-CE2 3.31Å; F4-Y6 HydrophobicContact CD1-CG 4.49Å; F4-Y6 AromaticContact CE1-CD2 3.97Å; F4-Y6 HydrophobicContact CE1-CD2 3.97Å; F4-Y6 AromaticContact CE1-CE2 3.39Å; F4-Y6 HydrophobicContact CE1-CE2 3.39Å; F4-Y6 AromaticContact CE1-CZ 3.7Å; F4-Y6 PolarHBondContact O-N 3.4Å; Y6-S8 VanDerWaalsContact C-N 3.34Å; Y6-S8 PolarHBondContact O-N 2.98Å
7	C	46.3	Very low	47.3	Very low	124 Å²	124	137.2 Å²	137.2	84%	0.838	79%	0.787	S	S	*	*			trans	-64.1	102.6	166.6	-99.7	0	0	0	0	107.5	S5	S5-C7 PolarHBondContact O-N 3.23Å
8	S	46.7	Very low	47.6	Very low	108 Å²	108	133.1 Å²	133.1	76%	0.755	77%	0.768	S	S	*	*			trans	-14.3	124.5	165.1	-54.2	0	0	0	0	115.4	Y6 G10	Y6-S8 VanDerWaalsContact C-N 3.34Å; Y6-S8 PolarHBondContact O-N 2.98Å; S8-G10 PolarHBondContact O-N 3.49Å
9	T	45	Very low	48	Very low	162 Å²	162	130.6 Å²	130.6	99%	0.994	76%	0.755	S	S	*	*	S	Bend	trans	-55	72.5	165.1	-42.9	0	0	0	0	111.4
10	G	46.5	Very low	48.3	Very low	58 Å²	58	133.9 Å²	133.9	60%	0.598	75%	0.754	S	S	*	*			trans	-173.2	69.7	-176.5	0	0	0	0	0	110.8	S8	S8-G10 PolarHBondContact O-N 3.49Å
11	S	45.8	Very low	48.6	Very low	113 Å²	113	135.2 Å²	135.2	79%	0.79	75%	0.747	S	S	*	*			trans	149.9	70.5	154.9	-69	0	0	0	0	111.7
12	R	50.6	Low	49.9	Very low	228 Å²	228	130.8 Å²	130.8	86%	0.86	72%	0.722	S	S	*	*			trans	-136.1	54.6	155.7	-84.4	-166.6	175.1	170.8	-1.1	111.4	S14	R12-S14 PolarHBondContact O-N 3.25Å; R12-S14 VanDerWaalsContact O-N 3.1Å
13	T	52	Low	50.7	Low	138 Å²	138	128.9 Å²	128.9	85%	0.847	71%	0.705	S	S	*	*			trans	-72.5	67.1	145.2	35.5	0	0	0	0	108.8
14	S	54.5	Low	51.6	Low	106 Å²	106	124.1 Å²	124.1	74%	0.741	69%	0.69	S	S	*	*			trans	-170.5	55.5	171.4	-81.2	0	0	0	0	112.9	R12	R12-S14 PolarHBondContact O-N 3.25Å; R12-S14 VanDerWaalsContact O-N 3.1Å
15	T	51.5	Low	51.9	Low	126 Å²	126	121.4 Å²	121.4	77%	0.773	68%	0.683	S	S	*	*	S	Bend	trans	-166.2	132.3	156.6	-4.1	0	0	0	0	112
16	S	53.5	Low	52.6	Low	86 Å²	86	123 Å²	123	60%	0.601	68%	0.684	S	S	*	*	S	Bend	trans	104.4	27.9	165.8	-140.3	0	0	0	0	120.3
17	T	52.9	Low	53.3	Low	117 Å²	117	121.5 Å²	121.5	72%	0.718	68%	0.681	S	S	*	*	S	Bend	trans	-97.5	-14.7	148.3	49.2	0	0	0	0	112.3	T19 R20	T17-T19 PolarHBondContact O-N 3.33Å; T17-R20 PolarHBondContact O-N 2.89Å
18	S	51.6	Low	54.2	Low	64 Å²	64	125.5 Å²	125.5	45%	0.448	68%	0.679	S	S	.	*	T	Hydrogen-bonded Turn	trans	-72.3	-1.3	-178.9	173.8	0	0	0	0	115.2	W21	S18-W21 PolarHBondContact O-NE1 3.06Å; S18-W21 PolarHBondContact OG-NE1 3.47Å
19	T	55	Low	54.8	Low	85 Å²	85	125.2 Å²	125.2	52%	0.521	68%	0.676	S	S	.	*	T	Hydrogen-bonded Turn	trans	-98.6	-21.3	170.6	36.5	0	0	0	0	112.5	T17 V23	T17-T19 PolarHBondContact O-N 3.33Å; T19-V23 WeakPolarHBondContact O-CG2 3.39Å; T19-V23 PolarHBondContact O-N 3.39Å
20	R	53.7	Low	55.6	Low	197 Å²	197	123.8 Å²	123.8	74%	0.743	66%	0.659	S	S	*	*	H	α-helix	trans	-72	-43.6	-176.9	-71.2	-174.4	-178	176.1	0.4	113.7	T17 K22 V23 S24	T17-R20 PolarHBondContact O-N 2.89Å; R20-K22 PolarHBondContact O-N 3.04Å; R20-V23 PolarHBondContact O-N 3.36Å; R20-S24 PolarHBondContact O-N 3.44Å
21	W	55.3	Low	56.4	Low	161 Å²	161	124.4 Å²	124.4	61%	0.61	65%	0.653	S	S	*	*	H	α-helix	trans	-62	-38.7	175.1	61.6	-34.7	0	0	0	113.8	S18 S24 L25	S18-W21 PolarHBondContact O-NE1 3.06Å; S18-W21 PolarHBondContact OG-NE1 3.47Å; W21-S24 PolarHBondContact O-N 3.04Å; W21-L25 PolarHBondContact O-N 2.87Å
22	K	58.3	Low	57.6	Low	136 Å²	136	123 Å²	123	59%	0.591	64%	0.643	S	S	*	*	H	α-helix	trans	-62.9	-44.3	175.5	-73	-175.3	177.7	-176.9	0	112.3	R20 S24 L25 L26	R20-K22 PolarHBondContact O-N 3.04Å; K22-S24 VanDerWaalsContact C-N 3.34Å; K22-S24 PolarHBondContact O-N 3.45Å; K22-L25 PolarHBondContact O-N 3.43Å; K22-L26 PolarHBondContact O-N 3.2Å
23	V	60.6	Low	58.6	Low	80 Å²	80	118.6 Å²	118.6	49%	0.485	63%	0.634	S	S	.	*	H	α-helix	trans	-65.3	-39.6	177.2	177.8	0	0	0	0	110.9	T19 R20 L25 L26 F27	T19-V23 WeakPolarHBondContact O-CG2 3.39Å; T19-V23 PolarHBondContact O-N 3.39Å; R20-V23 PolarHBondContact O-N 3.36Å; V23-L25 VanDerWaalsContact C-N 3.31Å; V23-L25 PolarHBondContact O-N 2.84Å; V23-L26 PolarHBondContact O-N 3.25Å; V23-F27 HydrophobicContact CG1-CD2 4.05Å; V23-F27 HydrophobicContact CG1-CE2 4.2Å; V23-F27 PolarHBondContact O-N 2.88Å; V23-F27 VanDerWaalsContact O-N 3.15Å
24	S	63	Low	59.6	Low	68 Å²	68	116.4 Å²	116.4	48%	0.476	62%	0.624	S	S	.	*	H	α-helix	trans	-63.8	-35.2	177.9	-153.8	0	0	0	0	112.7	R20 W21 K22 F27 R28	R20-S24 PolarHBondContact O-N 3.44Å; W21-S24 PolarHBondContact O-N 3.04Å; K22-S24 VanDerWaalsContact C-N 3.34Å; K22-S24 PolarHBondContact O-N 3.45Å; S24-F27 PolarHBondContact O-N 2.9Å; S24-R28 PolarHBondContact O-N 3.03Å
25	L	58.8	Low	60.8	Low	104 Å²	104	113.9 Å²	113.9	55%	0.545	61%	0.606	S	S	.	*	H	α-helix	trans	-66.7	-40.4	174.5	-81.7	162.2	0	0	0	112.9	W21 K22 V23 F27 R28 C29	W21-L25 PolarHBondContact O-N 2.87Å; K22-L25 PolarHBondContact O-N 3.43Å; V23-L25 VanDerWaalsContact C-N 3.31Å; V23-L25 PolarHBondContact O-N 2.84Å; L25-F27 VanDerWaalsContact C-N 3.33Å; L25-F27 PolarHBondContact O-N 3.06Å; L25-R28 PolarHBondContact O-N 2.99Å; L25-C29 PolarHBondContact O-N 3.3Å
26	L	60.8	Low	62.2	Low	122 Å²	122	111.2 Å²	111.2	64%	0.639	59%	0.59	S	S	*	*	H	α-helix	trans	-64.1	-38.7	176	-70.4	174	0	0	0	111.9	K22 V23 R28 C29 M30	K22-L26 PolarHBondContact O-N 3.2Å; V23-L26 PolarHBondContact O-N 3.25Å; L26-R28 VanDerWaalsContact C-N 3.28Å; L26-R28 PolarHBondContact O-N 2.89Å; L26-C29 PolarHBondContact O-N 3.38Å; L26-M30 PolarHBondContact O-N 3.31Å; L26-M30 VanDerWaalsContact O-N 3.09Å
27	F	57.8	Low	63.6	Low	168 Å²	168	112.9 Å²	112.9	74%	0.737	59%	0.592	S	S	*	*	H	α-helix	trans	-65.1	-29	176	-97.5	-85.4	0	0	0	113.6	V23 S24 L25	V23-F27 HydrophobicContact CG1-CD2 4.05Å; V23-F27 HydrophobicContact CG1-CE2 4.2Å; V23-F27 PolarHBondContact O-N 2.88Å; V23-F27 VanDerWaalsContact O-N 3.15Å; S24-F27 PolarHBondContact O-N 2.9Å; L25-F27 VanDerWaalsContact C-N 3.33Å; L25-F27 PolarHBondContact O-N 3.06Å
28	R	64.5	Low	65.1	Low	208 Å²	208	115 Å²	115	79%	0.785	59%	0.586	S	S	*	*	H	α-helix	trans	-75.5	-30.3	176.3	-73.6	-177.7	175.6	-169.6	-1.8	113.1	S24 L25 L26	S24-R28 PolarHBondContact O-N 3.03Å; L25-R28 PolarHBondContact O-N 2.99Å; L26-R28 VanDerWaalsContact C-N 3.28Å; L26-R28 PolarHBondContact O-N 2.89Å
29	C	59.1	Low	66.8	Low	102 Å²	102	117.9 Å²	117.9	69%	0.689	60%	0.595	S	S	*	*	H	α-helix	trans	-96.4	-12.5	-175.1	-64.2	0	0	0	0	114	L25 L26 P31	L25-C29 PolarHBondContact O-N 3.3Å; L26-C29 PolarHBondContact O-N 3.38Å; C29-P31 WeakPolarHBondContact O-CD 3.43Å
30	M	61.6	Low	68.3	Low	132 Å²	132	116.6 Å²	116.6	65%	0.65	59%	0.589	S	S	*	*	S	Bend	trans	-73.8	108.1	167.9	-75.9	-156.3	86.4	0	0	108.2	L26 S32	L26-M30 PolarHBondContact O-N 3.31Å; L26-M30 VanDerWaalsContact O-N 3.09Å; M30-S32 PolarHBondContact O-N 2.98Å
31	P	63.8	Low	70	Confident	71 Å²	71	113.5 Å²	113.5	46%	0.461	58%	0.577	S	S	.	*			trans	-56.1	122	166.1	26.4	-33.5	0	0	0	106.5	C29 M33 V36	C29-P31 WeakPolarHBondContact O-CD 3.43Å; P31-M33 PolarHBondContact O-N 3.47Å; P31-V36 HydrophobicContact CB-CG2 3.94Å; P31-V36 HydrophobicContact CG-CG2 3.83Å
32	S	71.3	Confident	71.5	Confident	84 Å²	84	109.6 Å²	109.6	59%	0.587	57%	0.567	S	S	*	*			trans	-52.4	141.8	173.8	-49.3	0	0	0	0	108.1	M30 S34 S35 V36	M30-S32 PolarHBondContact O-N 2.98Å; S32-S34 CarbonylContact O-C 3.58Å; S32-S34 PolarHBondContact O-N 3.37Å; S32-S35 WeakPolarHBondContact O-CA 3.32Å; S32-S35 WeakPolarHBondContact O-CB 3.37Å; S32-S35 PolarHBondContact O-N 3.38Å; S32-V36 PolarHBondContact O-N 3.32Å
33	M	71.1	Confident	73	Confident	136 Å²	136	106.4 Å²	106.4	67%	0.67	56%	0.562	S	S	*	*	H	α-helix	trans	-46.4	-35.5	-178.8	-71.2	-71.7	121.6	0	0	112.1	P31 S35 V36 L37	P31-M33 PolarHBondContact O-N 3.47Å; M33-S35 PolarHBondContact O-N 2.89Å; M33-V36 PolarHBondContact O-N 2.72Å; M33-L37 WeakPolarHBondContact O-CG 3.35Å; M33-L37 PolarHBondContact O-N 2.92Å
34	S	73.6	Confident	74.4	Confident	92 Å²	92	110.3 Å²	110.3	64%	0.643	57%	0.568	S	S	*	*	H	α-helix	trans	-58.2	-40	173.2	-42.2	0	0	0	0	114.5	S32 L37 W38	S32-S34 CarbonylContact O-C 3.58Å; S32-S34 PolarHBondContact O-N 3.37Å; S34-L37 PolarHBondContact O-N 3.04Å; S34-W38 VanDerWaalsContact O-CB 3.29Å; S34-W38 WeakPolarHBondContact O-CB 3.49Å; S34-W38 PolarHBondContact O-N 3.49Å
35	S	78.7	Confident	75.6	Confident	52 Å²	52	113.3 Å²	113.3	36%	0.364	57%	0.569	S	S	.	*	H	α-helix	trans	-67.6	-39.9	178.1	-172.7	0	0	0	0	111.7	S32 M33 W38 M39	S32-S35 WeakPolarHBondContact O-CA 3.32Å; S32-S35 WeakPolarHBondContact O-CB 3.37Å; S32-S35 PolarHBondContact O-N 3.38Å; M33-S35 PolarHBondContact O-N 2.89Å; S35-W38 PolarHBondContact O-N 2.82Å; S35-M39 WeakPolarHBondContact O-CG 3.43Å; S35-M39 PolarHBondContact O-N 3.43Å
36	V	80.4	Confident	77.2	Confident	70 Å²	70	117.2 Å²	117.2	42%	0.424	58%	0.576	S	S	.	*	H	α-helix	trans	-65.7	-44.4	176.4	-177.3	0	0	0	0	110.8	P31 S32 M33 W38 M39 S40	P31-V36 HydrophobicContact CB-CG2 3.94Å; P31-V36 HydrophobicContact CG-CG2 3.83Å; S32-V36 PolarHBondContact O-N 3.32Å; M33-V36 PolarHBondContact O-N 2.72Å; V36-W38 VanDerWaalsContact C-N 3.31Å; V36-W38 PolarHBondContact O-N 3.44Å; V36-M39 PolarHBondContact O-N 3.32Å; V36-S40 WeakPolarHBondContact O-CB 3.43Å; V36-S40 PolarHBondContact O-N 3.37Å
37	L	84.1	Confident	78.7	Confident	122 Å²	122	117 Å²	117	64%	0.639	58%	0.575	S	S	*	*	H	α-helix	trans	-62.1	-40.8	174.8	-68.3	176.2	0	0	0	111.4	M33 S34 S40 W41	M33-L37 WeakPolarHBondContact O-CG 3.35Å; M33-L37 PolarHBondContact O-N 2.92Å; S34-L37 PolarHBondContact O-N 3.04Å; L37-S40 PolarHBondContact O-N 3.24Å; L37-W41 WeakPolarHBondContact O-CB 3.45Å; L37-W41 PolarHBondContact O-N 3.05Å
38	W	84.6	Confident	80.4	Confident	160 Å²	160	114 Å²	114	61%	0.606	57%	0.566	S	S	*	*	H	α-helix	trans	-63.2	-44.5	176.4	-172	-95	0	0	0	112.6	S34 S35 V36 W41 M42	S34-W38 VanDerWaalsContact O-CB 3.29Å; S34-W38 WeakPolarHBondContact O-CB 3.49Å; S34-W38 PolarHBondContact O-N 3.49Å; S35-W38 PolarHBondContact O-N 2.82Å; V36-W38 VanDerWaalsContact C-N 3.31Å; V36-W38 PolarHBondContact O-N 3.44Å; W38-W41 PolarHBondContact O-N 3.28Å; W38-M42 HydrophobicContact CH2-CE 4.16Å; W38-M42 HydrophobicContact CZ2-CE 3.65Å; W38-M42 WeakPolarHBondContact O-CB 3.41Å; W38-M42 VanDerWaalsContact O-CG 3.28Å; W38-M42 WeakPolarHBondContact O-CG 3.4Å; W38-M42 PolarHBondContact O-N 3.29Å
39	M	86.2	Confident	81.7	Confident	126 Å²	126	112.3 Å²	112.3	62%	0.621	56%	0.56	S	S	*	*	H	α-helix	trans	-62.9	-41.9	175.6	-75.1	-177.4	156.8	0	0	112.2	S35 V36 S43	S35-M39 WeakPolarHBondContact O-CG 3.43Å; S35-M39 PolarHBondContact O-N 3.43Å; V36-M39 PolarHBondContact O-N 3.32Å; M39-S43 WeakPolarHBondContact O-CB 3.44Å; M39-S43 PolarHBondContact O-N 3.41Å; M39-S43 PolarHBondContact O-OG 3.5Å
40	S	87.9	Confident	83.3	Confident	58 Å²	58	115.8 Å²	115.8	41%	0.406	56%	0.559	S	S	.	*	H	α-helix	trans	-65.1	-44	176.2	-175.1	0	0	0	0	111.6	V36 L37 S43 R44	V36-S40 WeakPolarHBondContact O-CB 3.43Å; V36-S40 PolarHBondContact O-N 3.37Å; L37-S40 PolarHBondContact O-N 3.24Å; S40-S43 PolarHBondContact O-N 3.34Å; S40-R44 WeakPolarHBondContact O-CG 3.29Å; S40-R44 PolarHBondContact O-N 3.34Å
41	W	88.6	Confident	84.6	Confident	131 Å²	131	117.4 Å²	117.4	50%	0.496	57%	0.567	S	S	.	*	H	α-helix	trans	-59	-53	175.2	-179.8	-104.2	0	0	0	111.2	L37 W38 S43 R44 W45	L37-W41 WeakPolarHBondContact O-CB 3.45Å; L37-W41 PolarHBondContact O-N 3.05Å; W38-W41 PolarHBondContact O-N 3.28Å; W41-S43 VanDerWaalsContact C-N 3.25Å; W41-S43 PolarHBondContact O-N 3.06Å; W41-R44 WeakPolarHBondContact O-CB 3.28Å; W41-R44 PolarHBondContact O-N 3.06Å; W41-W45 AromaticContact CD1-CD1 3.47Å; W41-W45 VanDerWaalsContact CD1-CD1 3.47Å; W41-W45 AromaticContact CD1-NE1 3.63Å; W41-W45 AromaticContact CD2-CD1 3.66Å; W41-W45 AromaticContact CD2-NE1 3.22Å; W41-W45 AromaticContact CE2-CD1 3.51Å; W41-W45 AromaticContact CE2-CE2 3.77Å; W41-W45 AromaticContact CE2-NE1 2.77Å; W41-W45 AromaticContact CE3-NE1 3.77Å; W41-W45 AromaticContact CG-CD1 3.71Å; W41-W45 AromaticContact CG-NE1 3.78Å; W41-W45 AromaticContact CH2-CZ2 3.83Å; W41-W45 HydrophobicContact CH2-CZ2 3.83Å; W41-W45 AromaticContact CH2-NE1 3.52Å; W41-W45 AromaticContact CZ2-CE2 3.52Å; W41-W45 AromaticContact CZ2-CZ2 3.51Å; W41-W45 HydrophobicContact CZ2-CZ2 3.51Å; W41-W45 AromaticContact CZ2-NE1 2.96Å; W41-W45 AromaticContact CZ3-NE1 3.9Å; W41-W45 AromaticContact NE1-CD1 3.33Å; W41-W45 VanDerWaalsContact NE1-CD1 3.33Å; W41-W45 AromaticContact NE1-NE1 3.02Å; W41-W45 PolarHBondContact O-N 3.33Å
42	M	86.4	Confident	86	Confident	79 Å²	79	121 Å²	121	39%	0.389	58%	0.581	S	S	.	*	H	α-helix	trans	-56.9	-38.7	177.5	-73.7	-72.8	129.3	0	0	112.6	W38 W45 R46	W38-M42 HydrophobicContact CH2-CE 4.16Å; W38-M42 HydrophobicContact CZ2-CE 3.65Å; W38-M42 WeakPolarHBondContact O-CB 3.41Å; W38-M42 VanDerWaalsContact O-CG 3.28Å; W38-M42 WeakPolarHBondContact O-CG 3.4Å; W38-M42 PolarHBondContact O-N 3.29Å; M42-W45 PolarHBondContact O-N 3.09Å; M42-R46 WeakPolarHBondContact O-CG 3Å; M42-R46 PolarHBondContact O-N 3.48Å
43	S	89.1	Confident	86.6	Confident	70 Å²	70	125.8 Å²	125.8	49%	0.49	59%	0.594	S	S	.	*	H	α-helix	trans	-65.2	-42	175.8	-58.1	0	0	0	0	111.8	M39 S40 W41 R46 L47	M39-S43 WeakPolarHBondContact O-CB 3.44Å; M39-S43 PolarHBondContact O-N 3.41Å; M39-S43 PolarHBondContact O-OG 3.5Å; S40-S43 PolarHBondContact O-N 3.34Å; W41-S43 VanDerWaalsContact C-N 3.25Å; W41-S43 PolarHBondContact O-N 3.06Å; S43-R46 PolarHBondContact O-N 3.4Å; S43-L47 WeakPolarHBondContact O-CG 3.32Å; S43-L47 PolarHBondContact O-N 3.49Å
44	R	90.3	Very high	87.3	Confident	161 Å²	161	125.3 Å²	125.3	61%	0.608	59%	0.591	S	S	*	*	H	α-helix	trans	-63.9	-43.4	174.9	-71.1	174.9	179.1	-125.1	-0.8	112.1	S40 W41 R46 L47 L48	S40-R44 WeakPolarHBondContact O-CG 3.29Å; S40-R44 PolarHBondContact O-N 3.34Å; W41-R44 WeakPolarHBondContact O-CB 3.28Å; W41-R44 PolarHBondContact O-N 3.06Å; R44-R46 VanDerWaalsContact C-N 3.31Å; R44-R46 PolarHBondContact O-N 3.39Å; R44-L47 PolarHBondContact O-N 3.15Å; R44-L48 WeakPolarHBondContact O-CG 3.18Å; R44-L48 PolarHBondContact O-N 3.26Å
45	W	89.6	Confident	88.1	Confident	131 Å²	131	127.1 Å²	127.1	50%	0.496	59%	0.588	S	S	.	*	H	α-helix	trans	-62.1	-39.3	177	-80.3	98.6	0	0	0	112.6	W41 M42 L48 W49	W41-W45 AromaticContact CD1-CD1 3.47Å; W41-W45 VanDerWaalsContact CD1-CD1 3.47Å; W41-W45 AromaticContact CD1-NE1 3.63Å; W41-W45 AromaticContact CD2-CD1 3.66Å; W41-W45 AromaticContact CD2-NE1 3.22Å; W41-W45 AromaticContact CE2-CD1 3.51Å; W41-W45 AromaticContact CE2-CE2 3.77Å; W41-W45 AromaticContact CE2-NE1 2.77Å; W41-W45 AromaticContact CE3-NE1 3.77Å; W41-W45 AromaticContact CG-CD1 3.71Å; W41-W45 AromaticContact CG-NE1 3.78Å; W41-W45 AromaticContact CH2-CZ2 3.83Å; W41-W45 HydrophobicContact CH2-CZ2 3.83Å; W41-W45 AromaticContact CH2-NE1 3.52Å; W41-W45 AromaticContact CZ2-CE2 3.52Å; W41-W45 AromaticContact CZ2-CZ2 3.51Å; W41-W45 HydrophobicContact CZ2-CZ2 3.51Å; W41-W45 AromaticContact CZ2-NE1 2.96Å; W41-W45 AromaticContact CZ3-NE1 3.9Å; W41-W45 AromaticContact NE1-CD1 3.33Å; W41-W45 VanDerWaalsContact NE1-CD1 3.33Å; W41-W45 AromaticContact NE1-NE1 3.02Å; W41-W45 PolarHBondContact O-N 3.33Å; M42-W45 PolarHBondContact O-N 3.09Å; W45-L48 PolarHBondContact O-N 3.35Å; W45-W49 VanDerWaalsContact O-CB 3.32Å; W45-W49 WeakPolarHBondContact O-CB 3.45Å; W45-W49 PolarHBondContact O-N 2.6Å
46	R	91.5	Very high	88.6	Confident	187 Å²	187	131.2 Å²	131.2	71%	0.706	60%	0.6	S	S	*	*	H	α-helix	trans	-62.6	-46.3	173	-76.5	-178.3	168.1	-147.8	-3.8	111.6	M42 S43 R44 L48 W49 W50	M42-R46 WeakPolarHBondContact O-CG 3Å; M42-R46 PolarHBondContact O-N 3.48Å; S43-R46 PolarHBondContact O-N 3.4Å; R44-R46 VanDerWaalsContact C-N 3.31Å; R44-R46 PolarHBondContact O-N 3.39Å; R46-L48 VanDerWaalsContact C-N 3.35Å; R46-L48 PolarHBondContact O-N 3.26Å; R46-W49 WeakPolarHBondContact O-CB 3.38Å; R46-W49 PolarHBondContact O-N 3.18Å; R46-W50 PolarHBondContact O-N 3.21Å
47	L	92.1	Very high	89.1	Confident	116 Å²	116	134.8 Å²	134.8	61%	0.607	61%	0.611	S	S	*	*	H	α-helix	trans	-62.3	-40.9	177.8	-69.8	171.5	0	0	0	112.4	S43 R44 W50 M51	S43-L47 WeakPolarHBondContact O-CG 3.32Å; S43-L47 PolarHBondContact O-N 3.49Å; R44-L47 PolarHBondContact O-N 3.15Å; L47-W50 PolarHBondContact O-N 3.46Å; L47-M51 WeakPolarHBondContact O-CG 3.41Å; L47-M51 PolarHBondContact O-N 2.94Å; L47-M51 VanDerWaalsContact O-N 3.14Å
48	L	92.8	Very high	89.4	Confident	106 Å²	106	135.6 Å²	135.6	56%	0.555	61%	0.609	S	S	*	*	H	α-helix	trans	-64.4	-41	175	-72.4	170.9	0	0	0	111.7	R44 W45 R46 W50 M51 L52	R44-L48 WeakPolarHBondContact O-CG 3.18Å; R44-L48 PolarHBondContact O-N 3.26Å; W45-L48 PolarHBondContact O-N 3.35Å; R46-L48 VanDerWaalsContact C-N 3.35Å; R46-L48 PolarHBondContact O-N 3.26Å; L48-W50 VanDerWaalsContact C-N 3.34Å; L48-W50 PolarHBondContact O-N 3.1Å; L48-M51 PolarHBondContact O-N 2.74Å; L48-L52 PolarHBondContact O-N 2.77Å
49	W	92.8	Very high	89.7	Confident	173 Å²	173	134 Å²	134	66%	0.655	61%	0.609	S	S	*	*	H	α-helix	trans	-60.1	-43.7	175.1	-175.5	-95.7	0	0	0	111.9	W45 R46 M51 L52 Q53	W45-W49 VanDerWaalsContact O-CB 3.32Å; W45-W49 WeakPolarHBondContact O-CB 3.45Å; W45-W49 PolarHBondContact O-N 2.6Å; R46-W49 WeakPolarHBondContact O-CB 3.38Å; R46-W49 PolarHBondContact O-N 3.18Å; W49-M51 VanDerWaalsContact C-N 3.3Å; W49-M51 PolarHBondContact O-N 3.05Å; W49-L52 PolarHBondContact O-N 2.86Å; W49-Q53 PolarHBondContact O-N 2.96Å
50	W	92.2	Very high	89.9	Confident	174 Å²	174	134.6 Å²	134.6	66%	0.659	61%	0.608	S	S	*	*	H	α-helix	trans	-65	-29	176.2	-74.4	116.7	0	0	0	114	R46 L47 L48	R46-W50 PolarHBondContact O-N 3.21Å; L47-W50 PolarHBondContact O-N 3.46Å; L48-W50 VanDerWaalsContact C-N 3.34Å; L48-W50 PolarHBondContact O-N 3.1Å
51	M	90	Very high	90.1	Very high	167 Å²	167	140.5 Å²	140.5	82%	0.823	62%	0.624	S	S	*	*	H	α-helix	trans	-83.6	-22.7	178.1	-71.3	-75.7	173.4	0	0	113.1	L47 L48 W49	L47-M51 WeakPolarHBondContact O-CG 3.41Å; L47-M51 PolarHBondContact O-N 2.94Å; L47-M51 VanDerWaalsContact O-N 3.14Å; L48-M51 PolarHBondContact O-N 2.74Å; W49-M51 VanDerWaalsContact C-N 3.3Å; W49-M51 PolarHBondContact O-N 3.05Å
52	L	91.8	Very high	90.2	Very high	145 Å²	145	141.3 Å²	141.3	76%	0.759	64%	0.635	S	S	*	*	H	α-helix	trans	-80.1	-24.7	177.6	-172.2	67.4	0	0	0	112.2	L48 W49	L48-L52 PolarHBondContact O-N 2.77Å; W49-L52 PolarHBondContact O-N 2.86Å
53	Q	84.1	Confident	90.6	Very high	186 Å²	186	146.9 Å²	146.9	87%	0.869	66%	0.657	S	S	*	*			trans	-81.4	0	176.8	-174.6	171.6	-10	0	0	111.4	W49	W49-Q53 PolarHBondContact O-N 2.96Å

Retrieved 53 of 53 residues in 40.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).