A0AA82N565_SCHMA Loading...

Uncharacterized protein AlphaSync

AlphaFold DB , UniProt , Accession A0AA82N565, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 48 aa.

						>A0AA82N565_SCHMA|A0AA82N565
MVENRYMRSWGLLEVSNLYPSRISEALITVYDEVTRATSVLGGVSAGG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.4	Low	59.1	Low	243 Å²	243	145.7 Å²	145.7	100%	1.197	68%	0.682	S	S	*	*				0	63.9	0	-77.7	173	154.4	0	0	110.8
2	V	56.2	Low	59.4	Low	97 Å²	97	142.8 Å²	142.8	59%	0.588	67%	0.673	S	S	*	*			trans	-106	-26.8	178.7	176.2	0	0	0	0	111.6	N4 R5 Y6	V2-N4 VanDerWaalsContact C-N 3.3Å; V2-N4 PolarHBondContact O-N 3.18Å; V2-R5 PolarHBondContact O-N 3.25Å; V2-Y6 HydrophobicContact CG1-CD2 4.21Å; V2-Y6 HydrophobicContact CG1-CE2 3.63Å
3	E	56.2	Low	59.9	Low	171 Å²	171	140.5 Å²	140.5	80%	0.799	67%	0.667	S	S	*	*	H	α-helix	trans	-60.4	-34.3	-176.9	-66	-169.5	95.7	0	0	114	R5 Y6 M7	E3-R5 PolarHBondContact O-N 3.16Å; E3-Y6 PolarHBondContact O-N 3.49Å; E3-M7 PolarHBondContact O-N 3.44Å
4	N	58.6	Low	60.2	Low	131 Å²	131	139.7 Å²	139.7	70%	0.701	66%	0.663	S	S	*	*	H	α-helix	trans	-72.4	-15.9	-177.5	-151	36.7	0	0	0	113.8	V2	V2-N4 VanDerWaalsContact C-N 3.3Å; V2-N4 PolarHBondContact O-N 3.18Å
5	R	59.8	Low	60.4	Low	209 Å²	209	135.3 Å²	135.3	79%	0.789	65%	0.648	S	S	*	*	H	α-helix	trans	-78.7	-40.5	177.7	-168.8	-177.5	-74.7	-161.2	-1.3	111.2	V2 E3 R8 S9	V2-R5 PolarHBondContact O-N 3.25Å; E3-R5 PolarHBondContact O-N 3.16Å; R5-R8 PolarHBondContact O-N 3.25Å; R5-S9 PolarHBondContact O-N 2.92Å; R5-S9 PolarHBondContact O-OG 2.96Å
6	Y	60.6	Low	60.4	Low	145 Å²	145	131.9 Å²	131.9	57%	0.569	64%	0.643	S	S	*	*	H	α-helix	trans	-69	-43.1	179.8	-68.6	-71.7	0	0	0	111.9	V2 E3 R8 S9 W10	V2-Y6 HydrophobicContact CG1-CD2 4.21Å; V2-Y6 HydrophobicContact CG1-CE2 3.63Å; E3-Y6 PolarHBondContact O-N 3.49Å; Y6-R8 PolarHBondContact O-N 2.93Å; Y6-S9 WeakPolarHBondContact CA-OG 3.41Å; Y6-S9 PolarHBondContact O-N 2.83Å; Y6-S9 VanDerWaalsContact O-N 3.09Å; Y6-S9 PolarHBondContact O-OG 3.09Å; Y6-W10 PolarHBondContact O-N 3.26Å
7	M	60	Low	60.6	Low	148 Å²	148	130.8 Å²	130.8	73%	0.729	64%	0.641	S	S	*	*	H	α-helix	trans	-56.7	-39.5	176	-89.5	178.1	169.8	0	0	112.2	E3 W10 G11	E3-M7 PolarHBondContact O-N 3.44Å; M7-W10 PolarHBondContact O-N 3.46Å; M7-G11 PolarHBondContact O-N 3.43Å; M7-G11 VanDerWaalsContact O-N 3.16Å
8	R	60.5	Low	60.9	Low	199 Å²	199	129 Å²	129	75%	0.751	63%	0.634	S	S	*	*	H	α-helix	trans	-69.2	-35.5	177.3	-167.2	167.2	-179	174.5	-0.6	112.9	R5 Y6 L12	R5-R8 PolarHBondContact O-N 3.25Å; Y6-R8 PolarHBondContact O-N 2.93Å; R8-L12 WeakPolarHBondContact O-CG 3.47Å; R8-L12 PolarHBondContact O-N 3.2Å
9	S	63.6	Low	61.1	Low	49 Å²	49	130.5 Å²	130.5	34%	0.343	63%	0.633	S	S	.	*	H	α-helix	trans	-72.4	-36.5	175.7	54.1	0	0	0	0	112.9	R5 Y6 L12 L13	R5-S9 PolarHBondContact O-N 2.92Å; R5-S9 PolarHBondContact O-OG 2.96Å; Y6-S9 WeakPolarHBondContact CA-OG 3.41Å; Y6-S9 PolarHBondContact O-N 2.83Å; Y6-S9 VanDerWaalsContact O-N 3.09Å; Y6-S9 PolarHBondContact O-OG 3.09Å; S9-L12 PolarHBondContact O-N 3.21Å; S9-L13 WeakPolarHBondContact O-CB 3.46Å; S9-L13 PolarHBondContact O-N 3.32Å
10	W	58.9	Low	61.4	Low	174 Å²	174	127.3 Å²	127.3	66%	0.659	62%	0.623	S	S	*	*	H	α-helix	trans	-63.6	-45.9	176.1	-77.5	107.1	0	0	0	111.4	Y6 M7 L12 L13 E14	Y6-W10 PolarHBondContact O-N 3.26Å; M7-W10 PolarHBondContact O-N 3.46Å; W10-L12 VanDerWaalsContact C-N 3.3Å; W10-L12 PolarHBondContact O-N 3.39Å; W10-L13 PolarHBondContact O-N 3.46Å; W10-E14 WeakPolarHBondContact O-CB 3.47Å; W10-E14 PolarHBondContact O-N 3.23Å
11	G	64.1	Low	61.9	Low	37 Å²	37	124.6 Å²	124.6	38%	0.381	62%	0.617	S	S	.	*	H	α-helix	trans	-60.7	-36.6	177	0	0	0	0	0	113.6	M7 V15	M7-G11 PolarHBondContact O-N 3.43Å; M7-G11 VanDerWaalsContact O-N 3.16Å; G11-V15 WeakPolarHBondContact O-CB 3.41Å; G11-V15 WeakPolarHBondContact O-CG2 3.48Å; G11-V15 PolarHBondContact O-N 3.02Å
12	L	63.3	Low	63.2	Low	110 Å²	110	122 Å²	122	58%	0.576	59%	0.594	S	S	*	*	H	α-helix	trans	-72.3	-40.7	175.3	-70.8	174.7	0	0	0	112.3	R8 S9 W10 S16	R8-L12 WeakPolarHBondContact O-CG 3.47Å; R8-L12 PolarHBondContact O-N 3.2Å; S9-L12 PolarHBondContact O-N 3.21Å; W10-L12 VanDerWaalsContact C-N 3.3Å; W10-L12 PolarHBondContact O-N 3.39Å; L12-S16 WeakPolarHBondContact O-CB 3.49Å; L12-S16 PolarHBondContact O-N 2.89Å; L12-S16 PolarHBondContact O-OG 3.21Å; L12-S16 VanDerWaalsContact O-OG 3.05Å
13	L	65.5	Low	64.2	Low	113 Å²	113	122.6 Å²	122.6	59%	0.592	59%	0.592	S	S	*	*	H	α-helix	trans	-63.4	-40.6	176.7	-90.2	155.8	0	0	0	112.1	S9 W10 S16 N17	S9-L13 WeakPolarHBondContact O-CB 3.46Å; S9-L13 PolarHBondContact O-N 3.32Å; W10-L13 PolarHBondContact O-N 3.46Å; L13-S16 CarbonylContact O-C 3.54Å; L13-S16 PolarHBondContact O-N 2.95Å; L13-N17 VanDerWaalsContact O-CB 3.3Å; L13-N17 WeakPolarHBondContact O-CB 3.34Å; L13-N17 PolarHBondContact O-N 3.17Å
14	E	64.2	Low	65.2	Low	130 Å²	130	117.3 Å²	117.3	61%	0.607	57%	0.574	S	S	*	*	H	α-helix	trans	-66.3	-46.2	179.6	-145.7	175.3	124.4	0	0	111	W10 N17 L18	W10-E14 WeakPolarHBondContact O-CB 3.47Å; W10-E14 PolarHBondContact O-N 3.23Å; E14-N17 PolarHBondContact O-N 3.41Å; E14-L18 HydrophobicContact CG-CD1 4.38Å; E14-L18 WeakPolarHBondContact O-CB 3.49Å; E14-L18 WeakPolarHBondContact O-CD1 3.15Å; E14-L18 WeakPolarHBondContact O-CG 2.93Å; E14-L18 PolarHBondContact O-N 3.34Å
15	V	62.3	Low	66.3	Low	73 Å²	73	117.4 Å²	117.4	44%	0.442	57%	0.571	S	S	.	*	H	α-helix	trans	-61.8	-47.1	173.8	174.4	0	0	0	0	110.6	G11 N17 L18 Y19	G11-V15 WeakPolarHBondContact O-CB 3.41Å; G11-V15 WeakPolarHBondContact O-CG2 3.48Å; G11-V15 PolarHBondContact O-N 3.02Å; V15-N17 PolarHBondContact O-N 2.94Å; V15-L18 PolarHBondContact O-N 3.41Å; V15-Y19 HydrophobicContact CG1-CD2 3.5Å; V15-Y19 HydrophobicContact CG1-CE2 3.57Å; V15-Y19 WeakPolarHBondContact O-CB 3.29Å; V15-Y19 VanDerWaalsContact O-CD2 3.29Å; V15-Y19 WeakPolarHBondContact O-CD2 3.17Å; V15-Y19 PolarHBondContact O-N 3.05Å
16	S	60.5	Low	67.4	Low	81 Å²	81	110.1 Å²	110.1	57%	0.566	56%	0.555	S	S	*	*	H	α-helix	trans	-67.1	-13.4	177.3	-71.2	0	0	0	0	113.9	L12 L13 P20	L12-S16 WeakPolarHBondContact O-CB 3.49Å; L12-S16 PolarHBondContact O-N 2.89Å; L12-S16 PolarHBondContact O-OG 3.21Å; L12-S16 VanDerWaalsContact O-OG 3.05Å; L13-S16 CarbonylContact O-C 3.54Å; L13-S16 PolarHBondContact O-N 2.95Å; S16-P20 VanDerWaalsContact C-CD 3.49Å; S16-P20 WeakPolarHBondContact O-CD 3.43Å; S16-P20 WeakPolarHBondContact O-CG 3.3Å
17	N	64.6	Low	68.6	Low	114 Å²	114	109 Å²	109	61%	0.61	56%	0.558	S	S	*	*	H	α-helix	trans	-93	-39.2	172.8	-158.3	20.2	0	0	0	111.1	L13 E14 V15 P20 S21	L13-N17 VanDerWaalsContact O-CB 3.3Å; L13-N17 WeakPolarHBondContact O-CB 3.34Å; L13-N17 PolarHBondContact O-N 3.17Å; E14-N17 PolarHBondContact O-N 3.41Å; V15-N17 PolarHBondContact O-N 2.94Å; N17-P20 WeakPolarHBondContact O-CD 2.82Å; N17-P20 WeakPolarHBondContact O-CG 3.35Å; N17-S21 PolarHBondContact O-N 3.01Å; N17-S21 PolarHBondContact O-OG 2.77Å
18	L	65.8	Low	69.8	Low	98 Å²	98	107.1 Å²	107.1	51%	0.513	55%	0.55	S	S	.	.	H	α-helix	trans	-68.4	-41.2	177.7	-78.4	154.5	0	0	0	113.2	E14 V15 S21 R22	E14-L18 HydrophobicContact CG-CD1 4.38Å; E14-L18 WeakPolarHBondContact O-CB 3.49Å; E14-L18 WeakPolarHBondContact O-CD1 3.15Å; E14-L18 WeakPolarHBondContact O-CG 2.93Å; E14-L18 PolarHBondContact O-N 3.34Å; V15-L18 PolarHBondContact O-N 3.41Å; L18-S21 PolarHBondContact O-N 3.29Å; L18-R22 PolarHBondContact O-N 3.31Å
19	Y	65.1	Low	71.2	Confident	158 Å²	158	101.6 Å²	101.6	62%	0.62	54%	0.538	S	S	*	.	H	α-helix	trans	-61.8	-51.4	179.8	-92.6	-99.5	0	0	0	113.4	V15 S21 R22 I23	V15-Y19 HydrophobicContact CG1-CD2 3.5Å; V15-Y19 HydrophobicContact CG1-CE2 3.57Å; V15-Y19 WeakPolarHBondContact O-CB 3.29Å; V15-Y19 VanDerWaalsContact O-CD2 3.29Å; V15-Y19 WeakPolarHBondContact O-CD2 3.17Å; V15-Y19 PolarHBondContact O-N 3.05Å; Y19-S21 VanDerWaalsContact C-N 3.31Å; Y19-S21 PolarHBondContact O-N 2.94Å; Y19-R22 PolarHBondContact O-N 3.46Å; Y19-I23 WeakPolarHBondContact O-CB 3.43Å; Y19-I23 WeakPolarHBondContact O-CD1 3.1Å; Y19-I23 WeakPolarHBondContact O-CG1 3.4Å; Y19-I23 PolarHBondContact O-N 2.79Å
20	P	66.3	Low	72.2	Confident	65 Å²	65	103.5 Å²	103.5	42%	0.422	55%	0.548	S	S	.	.	H	α-helix	trans	-67.2	-31.7	176.9	27.4	-35	0	0	0	112	S16 N17 I23 S24	S16-P20 VanDerWaalsContact C-CD 3.49Å; S16-P20 WeakPolarHBondContact O-CD 3.43Å; S16-P20 WeakPolarHBondContact O-CG 3.3Å; N17-P20 WeakPolarHBondContact O-CD 2.82Å; N17-P20 WeakPolarHBondContact O-CG 3.35Å; P20-I23 PolarHBondContact O-N 3.43Å; P20-S24 WeakPolarHBondContact O-CA 3.5Å; P20-S24 WeakPolarHBondContact O-CB 3.46Å; P20-S24 PolarHBondContact O-N 2.87Å
21	S	73	Confident	73.4	Confident	71 Å²	71	103.2 Å²	103.2	50%	0.497	55%	0.548	S	S	.	.	H	α-helix	trans	-62.5	-46.7	174.4	-64.7	0	0	0	0	111.8	N17 L18 Y19 S24 E25	N17-S21 PolarHBondContact O-N 3.01Å; N17-S21 PolarHBondContact O-OG 2.77Å; L18-S21 PolarHBondContact O-N 3.29Å; Y19-S21 VanDerWaalsContact C-N 3.31Å; Y19-S21 PolarHBondContact O-N 2.94Å; S21-S24 PolarHBondContact O-N 3.33Å; S21-E25 WeakPolarHBondContact O-CB 3.21Å; S21-E25 PolarHBondContact O-N 3.37Å
22	R	77.2	Confident	74.4	Confident	190 Å²	190	106 Å²	106	72%	0.717	55%	0.554	S	S	*	*	H	α-helix	trans	-66.5	-41.1	177.5	-74.8	-174.7	139	-99.1	-7	112.6	L18 Y19 S24 E25 A26	L18-R22 PolarHBondContact O-N 3.31Å; Y19-R22 PolarHBondContact O-N 3.46Å; R22-S24 VanDerWaalsContact C-N 3.33Å; R22-E25 PolarHBondContact O-N 3.44Å; R22-A26 WeakPolarHBondContact O-CB 3.39Å; R22-A26 PolarHBondContact O-N 2.98Å
23	I	77.1	Confident	75.5	Confident	108 Å²	108	107.4 Å²	107.4	55%	0.554	56%	0.557	S	S	*	*	H	α-helix	trans	-64.6	-41.7	175.8	-67.6	165.7	0	0	0	110	Y19 P20 A26 L27	Y19-I23 WeakPolarHBondContact O-CB 3.43Å; Y19-I23 WeakPolarHBondContact O-CD1 3.1Å; Y19-I23 WeakPolarHBondContact O-CG1 3.4Å; Y19-I23 PolarHBondContact O-N 2.79Å; P20-I23 PolarHBondContact O-N 3.43Å; I23-A26 PolarHBondContact O-N 2.89Å; I23-L27 VanDerWaalsContact O-CB 3.3Å; I23-L27 WeakPolarHBondContact O-CB 3.49Å; I23-L27 PolarHBondContact O-N 3.34Å
24	S	78.4	Confident	76.5	Confident	60 Å²	60	105.9 Å²	105.9	42%	0.42	55%	0.553	S	S	.	*	H	α-helix	trans	-65.9	-41.3	178.2	-168.5	0	0	0	0	111.5	P20 S21 R22 L27 I28	P20-S24 WeakPolarHBondContact O-CA 3.5Å; P20-S24 WeakPolarHBondContact O-CB 3.46Å; P20-S24 PolarHBondContact O-N 2.87Å; S21-S24 PolarHBondContact O-N 3.33Å; R22-S24 VanDerWaalsContact C-N 3.33Å; S24-L27 PolarHBondContact O-N 2.76Å; S24-I28 WeakPolarHBondContact O-CB 3.39Å; S24-I28 WeakPolarHBondContact O-CD1 3.41Å; S24-I28 WeakPolarHBondContact O-CG1 3.16Å; S24-I28 PolarHBondContact O-N 3.3Å
25	E	82.3	Confident	77.5	Confident	134 Å²	134	102.4 Å²	102.4	63%	0.626	54%	0.54	S	S	*	.	H	α-helix	trans	-64.3	-42.8	176.5	-171.7	175.5	85.6	0	0	111.4	S21 R22 I28 T29	S21-E25 WeakPolarHBondContact O-CB 3.21Å; S21-E25 PolarHBondContact O-N 3.37Å; R22-E25 PolarHBondContact O-N 3.44Å; E25-I28 PolarHBondContact O-N 3.48Å; E25-T29 WeakPolarHBondContact O-CB 3.43Å; E25-T29 PolarHBondContact O-N 2.94Å; E25-T29 PolarHBondContact O-OG1 3.4Å
26	A	82.9	Confident	78.6	Confident	55 Å²	55	107.4 Å²	107.4	46%	0.455	55%	0.551	S	S	.	*	H	α-helix	trans	-63.1	-42.5	173.5	0	0	0	0	0	111.7	R22 I23 T29 V30	R22-A26 WeakPolarHBondContact O-CB 3.39Å; R22-A26 PolarHBondContact O-N 2.98Å; I23-A26 PolarHBondContact O-N 2.89Å; A26-T29 PolarHBondContact O-N 3.46Å; A26-V30 WeakPolarHBondContact O-CB 3.3Å; A26-V30 VanDerWaalsContact O-CG2 3.27Å; A26-V30 WeakPolarHBondContact O-CG2 3.27Å; A26-V30 PolarHBondContact O-N 2.84Å
27	L	84	Confident	79.6	Confident	122 Å²	122	105.8 Å²	105.8	64%	0.639	54%	0.543	S	S	*	.	H	α-helix	trans	-64.7	-42.1	178.1	-162.4	90.7	0	0	0	111.6	I23 S24 T29 V30 Y31	I23-L27 VanDerWaalsContact O-CB 3.3Å; I23-L27 WeakPolarHBondContact O-CB 3.49Å; I23-L27 PolarHBondContact O-N 3.34Å; S24-L27 PolarHBondContact O-N 2.76Å; L27-T29 VanDerWaalsContact C-N 3.34Å; L27-V30 PolarHBondContact O-N 2.83Å; L27-Y31 VanDerWaalsContact O-CB 3.24Å; L27-Y31 WeakPolarHBondContact O-CB 3.49Å; L27-Y31 PolarHBondContact O-N 2.85Å
28	I	86	Confident	80.5	Confident	108 Å²	108	104.3 Å²	104.3	55%	0.554	54%	0.538	S	S	*	.	H	α-helix	trans	-63.3	-42.7	175.9	-69.5	162	0	0	0	110.1	S24 E25 Y31 D32	S24-I28 WeakPolarHBondContact O-CB 3.39Å; S24-I28 WeakPolarHBondContact O-CD1 3.41Å; S24-I28 WeakPolarHBondContact O-CG1 3.16Å; S24-I28 PolarHBondContact O-N 3.3Å; E25-I28 PolarHBondContact O-N 3.48Å; I28-Y31 PolarHBondContact O-N 3Å; I28-D32 WeakPolarHBondContact O-CB 3.31Å; I28-D32 PolarHBondContact O-N 3.46Å
29	T	89.2	Confident	81	Confident	83 Å²	83	103.6 Å²	103.6	51%	0.509	54%	0.541	S	S	.	.	H	α-helix	trans	-63.6	-47.3	177.7	-55	0	0	0	0	111.4	E25 A26 L27 Y31 D32 E33	E25-T29 WeakPolarHBondContact O-CB 3.43Å; E25-T29 PolarHBondContact O-N 2.94Å; E25-T29 PolarHBondContact O-OG1 3.4Å; A26-T29 PolarHBondContact O-N 3.46Å; L27-T29 VanDerWaalsContact C-N 3.34Å; T29-Y31 VanDerWaalsContact C-N 3.31Å; T29-Y31 PolarHBondContact O-N 2.89Å; T29-D32 PolarHBondContact O-N 2.99Å; T29-E33 PolarHBondContact O-N 3.32Å
30	V	86.3	Confident	81.6	Confident	89 Å²	89	100.4 Å²	100.4	54%	0.539	54%	0.538	S	S	.	.	H	α-helix	trans	-62.4	-40.9	176.2	171.4	0	0	0	0	110.8	A26 L27 E33 V34	A26-V30 WeakPolarHBondContact O-CB 3.3Å; A26-V30 VanDerWaalsContact O-CG2 3.27Å; A26-V30 WeakPolarHBondContact O-CG2 3.27Å; A26-V30 PolarHBondContact O-N 2.84Å; L27-V30 PolarHBondContact O-N 2.83Å; V30-E33 PolarHBondContact O-N 2.83Å; V30-V34 HydrophobicContact CG1-CG2 4.23Å; V30-V34 WeakPolarHBondContact O-CB 3.33Å; V30-V34 VanDerWaalsContact O-CG2 3.22Å; V30-V34 WeakPolarHBondContact O-CG2 3.31Å; V30-V34 PolarHBondContact O-N 3.37Å
31	Y	82.4	Confident	81.9	Confident	169 Å²	169	102.8 Å²	102.8	66%	0.663	55%	0.546	S	S	*	.	H	α-helix	trans	-63.3	-46.3	177.3	-174.3	-93.8	0	0	0	111.5	L27 I28 T29 E33 V34 T35	L27-Y31 VanDerWaalsContact O-CB 3.24Å; L27-Y31 WeakPolarHBondContact O-CB 3.49Å; L27-Y31 PolarHBondContact O-N 2.85Å; I28-Y31 PolarHBondContact O-N 3Å; T29-Y31 VanDerWaalsContact C-N 3.31Å; T29-Y31 PolarHBondContact O-N 2.89Å; Y31-E33 PolarHBondContact O-N 3.41Å; Y31-V34 PolarHBondContact O-N 2.83Å; Y31-T35 VanDerWaalsContact O-CB 3.31Å; Y31-T35 WeakPolarHBondContact O-CB 3.22Å; Y31-T35 PolarHBondContact O-N 3.4Å; Y31-T35 PolarHBondContact O-OG1 2.79Å
32	D	85.6	Confident	81.6	Confident	96 Å²	96	101.1 Å²	101.1	51%	0.513	54%	0.541	S	S	.	.	H	α-helix	trans	-60.7	-43.5	177	-169.7	-98.9	0	0	0	111.8	I28 T29 T35 R36	I28-D32 WeakPolarHBondContact O-CB 3.31Å; I28-D32 PolarHBondContact O-N 3.46Å; T29-D32 PolarHBondContact O-N 2.99Å; D32-T35 PolarHBondContact O-N 3.35Å; D32-R36 WeakPolarHBondContact O-CB 3.36Å; D32-R36 PolarHBondContact O-N 3.36Å
33	E	87.7	Confident	80.7	Confident	139 Å²	139	94.3 Å²	94.3	65%	0.65	53%	0.529	S	S	*	.	H	α-helix	trans	-65.3	-44.7	177.9	-168.2	176.5	137.8	0	0	111.9	T29 V30 Y31 R36 A37	T29-E33 PolarHBondContact O-N 3.32Å; V30-E33 PolarHBondContact O-N 2.83Å; Y31-E33 PolarHBondContact O-N 3.41Å; E33-R36 PolarHBondContact O-N 2.9Å; E33-A37 VanDerWaalsContact O-CB 3.31Å; E33-A37 WeakPolarHBondContact O-CB 3.24Å; E33-A37 PolarHBondContact O-N 3.46Å
34	V	85.5	Confident	79.8	Confident	81 Å²	81	93.9 Å²	93.9	49%	0.491	53%	0.531	S	S	.	.	H	α-helix	trans	-65.4	-41.1	176.2	170.9	0	0	0	0	110.9	V30 Y31 A37 T38	V30-V34 HydrophobicContact CG1-CG2 4.23Å; V30-V34 WeakPolarHBondContact O-CB 3.33Å; V30-V34 VanDerWaalsContact O-CG2 3.22Å; V30-V34 WeakPolarHBondContact O-CG2 3.31Å; V30-V34 PolarHBondContact O-N 3.37Å; Y31-V34 PolarHBondContact O-N 2.83Å; V34-A37 PolarHBondContact O-N 3.45Å; V34-T38 VanDerWaalsContact O-CB 3.25Å; V34-T38 WeakPolarHBondContact O-CB 3.44Å; V34-T38 PolarHBondContact O-N 3.27Å; V34-T38 PolarHBondContact O-OG1 3.32Å
35	T	85.1	Confident	78.6	Confident	56 Å²	56	95.6 Å²	95.6	34%	0.344	54%	0.543	S	S	.	.	H	α-helix	trans	-63.8	-44.4	175.6	-65.1	0	0	0	0	110.7	Y31 D32 T38 S39	Y31-T35 VanDerWaalsContact O-CB 3.31Å; Y31-T35 WeakPolarHBondContact O-CB 3.22Å; Y31-T35 PolarHBondContact O-N 3.4Å; Y31-T35 PolarHBondContact O-OG1 2.79Å; D32-T35 PolarHBondContact O-N 3.35Å; T35-T38 PolarHBondContact O-N 3.31Å; T35-S39 WeakPolarHBondContact O-CB 3.45Å; T35-S39 PolarHBondContact O-N 2.78Å; T35-S39 PolarHBondContact O-OG 2.78Å
36	R	85	Confident	77.2	Confident	178 Å²	178	93.5 Å²	93.5	67%	0.672	55%	0.549	S	S	*	.	H	α-helix	trans	-61.8	-46.3	175.3	-176.4	-176.4	-80.5	178.5	-2.9	111.2	D32 E33 T38 S39 V40	D32-R36 WeakPolarHBondContact O-CB 3.36Å; D32-R36 PolarHBondContact O-N 3.36Å; E33-R36 PolarHBondContact O-N 2.9Å; R36-T38 VanDerWaalsContact C-N 3.33Å; R36-T38 PolarHBondContact O-N 2.93Å; R36-S39 PolarHBondContact O-N 3.46Å; R36-V40 VanDerWaalsContact O-CG2 3.3Å; R36-V40 WeakPolarHBondContact O-CG2 3.27Å; R36-V40 PolarHBondContact O-N 2.7Å
37	A	83.1	Confident	75.5	Confident	47 Å²	47	94.2 Å²	94.2	39%	0.388	56%	0.562	S	S	.	*	H	α-helix	trans	-61.2	-42.1	176.1	0	0	0	0	0	111.6	E33 V34 V40 L41	E33-A37 VanDerWaalsContact O-CB 3.31Å; E33-A37 WeakPolarHBondContact O-CB 3.24Å; E33-A37 PolarHBondContact O-N 3.46Å; V34-A37 PolarHBondContact O-N 3.45Å; A37-V40 PolarHBondContact O-N 2.84Å; A37-L41 WeakPolarHBondContact O-CB 3.3Å; A37-L41 VanDerWaalsContact O-CG 3.27Å; A37-L41 WeakPolarHBondContact O-CG 3.38Å; A37-L41 PolarHBondContact O-N 3.44Å
38	T	82.8	Confident	73.4	Confident	83 Å²	83	94.5 Å²	94.5	51%	0.509	60%	0.595	S	S	.	*	H	α-helix	trans	-68.2	-38.1	177.4	-56	0	0	0	0	111.7	V34 T35 R36 V40 L41 G42	V34-T38 VanDerWaalsContact O-CB 3.25Å; V34-T38 WeakPolarHBondContact O-CB 3.44Å; V34-T38 PolarHBondContact O-N 3.27Å; V34-T38 PolarHBondContact O-OG1 3.32Å; T35-T38 PolarHBondContact O-N 3.31Å; R36-T38 VanDerWaalsContact C-N 3.33Å; R36-T38 PolarHBondContact O-N 2.93Å; T38-V40 VanDerWaalsContact C-N 3.34Å; T38-L41 PolarHBondContact O-N 2.84Å; T38-G42 WeakPolarHBondContact O-CA 3.42Å; T38-G42 PolarHBondContact O-N 3.28Å
39	S	75.8	Confident	72.8	Confident	83 Å²	83	93.9 Å²	93.9	58%	0.58	60%	0.597	S	S	*	*	H	α-helix	trans	-65.4	-38.6	173.2	-73.9	0	0	0	0	111.7	T35 R36 G43	T35-S39 WeakPolarHBondContact O-CB 3.45Å; T35-S39 PolarHBondContact O-N 2.78Å; T35-S39 PolarHBondContact O-OG 2.78Å; R36-S39 PolarHBondContact O-N 3.46Å; S39-G43 WeakPolarHBondContact O-CA 3.25Å; S39-G43 PolarHBondContact O-N 3.29Å
40	V	77.5	Confident	71.9	Confident	91 Å²	91	94.4 Å²	94.4	55%	0.552	60%	0.601	S	S	*	*	H	α-helix	trans	-65.5	-47.7	173.7	172.7	0	0	0	0	110.2	R36 A37 T38 G43 V44	R36-V40 VanDerWaalsContact O-CG2 3.3Å; R36-V40 WeakPolarHBondContact O-CG2 3.27Å; R36-V40 PolarHBondContact O-N 2.7Å; A37-V40 PolarHBondContact O-N 2.84Å; T38-V40 VanDerWaalsContact C-N 3.34Å; V40-G43 PolarHBondContact O-N 3Å; V40-V44 WeakPolarHBondContact O-CB 3.18Å; V40-V44 WeakPolarHBondContact O-CG2 3.47Å; V40-V44 PolarHBondContact O-N 3.41Å
41	L	74.1	Confident	71.1	Confident	115 Å²	115	94.7 Å²	94.7	60%	0.602	61%	0.605	S	S	*	*	H	α-helix	trans	-69	-41.9	-179.7	-69.9	172.8	0	0	0	113	A37 T38 V44 S45	A37-L41 WeakPolarHBondContact O-CB 3.3Å; A37-L41 VanDerWaalsContact O-CG 3.27Å; A37-L41 WeakPolarHBondContact O-CG 3.38Å; A37-L41 PolarHBondContact O-N 3.44Å; T38-L41 PolarHBondContact O-N 2.84Å; L41-V44 PolarHBondContact O-N 2.85Å; L41-S45 WeakPolarHBondContact O-CB 3.42Å; L41-S45 PolarHBondContact O-N 2.7Å; L41-S45 PolarHBondContact O-OG 3.49Å
42	G	65.1	Low	70.5	Confident	37 Å²	37	90.4 Å²	90.4	38%	0.381	60%	0.601	S	S	.	*	H	α-helix	trans	-68.4	-34.9	175.4	0	0	0	0	0	112	T38 S45 A46	T38-G42 WeakPolarHBondContact O-CA 3.42Å; T38-G42 PolarHBondContact O-N 3.28Å; G42-S45 PolarHBondContact O-N 2.88Å; G42-A46 WeakPolarHBondContact O-CB 3.46Å; G42-A46 PolarHBondContact O-N 3.44Å
43	G	59.1	Low	69.5	Low	46 Å²	46	90 Å²	90	47%	0.474	61%	0.607	S	S	.	*	H	α-helix	trans	-66.5	-37.6	170	0	0	0	0	0	112.7	S39 V40 A46 G47	S39-G43 WeakPolarHBondContact O-CA 3.25Å; S39-G43 PolarHBondContact O-N 3.29Å; V40-G43 PolarHBondContact O-N 3Å; G43-A46 PolarHBondContact O-N 3.33Å; G43-G47 PolarHBondContact O-N 2.71Å
44	V	57.7	Low	68.3	Low	99 Å²	99	86.7 Å²	86.7	60%	0.6	60%	0.604	S	S	*	*	H	α-helix	trans	-66.9	-38.5	171.8	170.1	0	0	0	0	110.9	V40 L41 A46 G47	V40-V44 WeakPolarHBondContact O-CB 3.18Å; V40-V44 WeakPolarHBondContact O-CG2 3.47Å; V40-V44 PolarHBondContact O-N 3.41Å; L41-V44 PolarHBondContact O-N 2.85Å; V44-A46 VanDerWaalsContact C-N 3.32Å; V44-A46 PolarHBondContact O-N 3.4Å; V44-G47 PolarHBondContact O-N 3.45Å
45	S	54.6	Low	67.1	Low	96 Å²	96	87.1 Å²	87.1	67%	0.671	61%	0.612	S	S	*	*	H	α-helix	trans	-73.4	-21.8	179.6	-49.7	0	0	0	0	113.5	L41 G42	L41-S45 WeakPolarHBondContact O-CB 3.42Å; L41-S45 PolarHBondContact O-N 2.7Å; L41-S45 PolarHBondContact O-OG 3.49Å; G42-S45 PolarHBondContact O-N 2.88Å
46	A	52.6	Low	65.7	Low	91 Å²	91	89.5 Å²	89.5	75%	0.752	63%	0.633	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.7	-4.9	177.9	0	0	0	0	0	113.3	G42 G43 V44	G42-A46 WeakPolarHBondContact O-CB 3.46Å; G42-A46 PolarHBondContact O-N 3.44Å; G43-A46 PolarHBondContact O-N 3.33Å; V44-A46 VanDerWaalsContact C-N 3.32Å; V44-A46 PolarHBondContact O-N 3.4Å
47	G	46.5	Very low	64.1	Low	69 Å²	69	82.2 Å²	82.2	71%	0.711	63%	0.629	S	S	*	*	T	Hydrogen-bonded Turn	trans	-125.8	0.6	-166.6	0	0	0	0	0	117.6	G43 V44	G43-G47 PolarHBondContact O-N 2.71Å; V44-G47 PolarHBondContact O-N 3.45Å
48	G	40.6	Very low	62.4	Low	129 Å²	129	85.4 Å²	85.4	100%	1.33	65%	0.651	S	S	*	*			trans	-158.9	0	178.8	0	0	0	0	0	112.6

Retrieved 48 of 48 residues in 21.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).