A0AA82N571_SCHMA Loading...

Uncharacterized protein AlphaSync

AlphaFold DB , UniProt , Accession A0AA82N571, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 36 aa.

						>A0AA82N571_SCHMA|A0AA82N571
MLVLVSVFQNPYMGKYHNDCLWDSVDIWLTDCIMHQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.7	Very low	53.5	Low	238 Å²	238	123.1 Å²	123.1	100%	1.172	66%	0.66	S	S	*	*				0	45.5	0	-66.4	171.3	173.8	0	111.7
2	L	52.6	Low	53.6	Low	145 Å²	145	129.3 Å²	129.3	76%	0.759	67%	0.669	S	S	*	*			trans	-118.7	-13.4	-179.6	-89.8	152.5	0	0	112.9	S6	L2-S6 PolarHBondContact O-OG 3.42Å
3	V	52.2	Low	53.6	Low	112 Å²	112	129.8 Å²	129.8	68%	0.679	67%	0.669	S	S	*	*	H	α-helix	trans	-77.6	-31.7	-172.8	177.4	0	0	0	112.4	V5 S6	V3-V5 PolarHBondContact O-N 3.49Å; V3-S6 PolarHBondContact O-N 3.39Å
4	L	54	Low	53.9	Low	142 Å²	142	121.2 Å²	121.2	74%	0.743	63%	0.629	S	S	*	*	H	α-helix	trans	-71.2	-25.5	-177.7	-93.5	133	0	0	114.3
5	V	53.5	Low	54.1	Low	94 Å²	94	122.3 Å²	122.3	57%	0.57	63%	0.627	S	S	*	*	H	α-helix	trans	-78.4	-29	-178.9	-179.2	0	0	0	111.2	V3	V3-V5 PolarHBondContact O-N 3.49Å
6	S	55.7	Low	54.4	Low	75 Å²	75	126.3 Å²	126.3	52%	0.524	63%	0.633	S	S	.	*	H	α-helix	trans	-76.8	-26.3	-177.2	-45.9	0	0	0	113.6	L2 V3 F8 Q9	L2-S6 PolarHBondContact O-OG 3.42Å; V3-S6 PolarHBondContact O-N 3.39Å; S6-F8 VanDerWaalsContact C-N 3.29Å; S6-F8 PolarHBondContact O-N 3.43Å; S6-Q9 PolarHBondContact O-N 3.44Å
7	V	57.2	Low	54.6	Low	51 Å²	51	125.2 Å²	125.2	31%	0.309	63%	0.625	S	S	.	*	T	Hydrogen-bonded Turn	trans	-71.2	-25.5	-179.5	-179	0	0	0	112
8	F	55.7	Low	54.9	Low	181 Å²	181	121.1 Å²	121.1	79%	0.794	61%	0.606	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.7	-8.9	178.8	-82	-85.2	0	0	114.4	S6	S6-F8 VanDerWaalsContact C-N 3.29Å; S6-F8 PolarHBondContact O-N 3.43Å
9	Q	53.2	Low	55.2	Low	149 Å²	149	119.3 Å²	119.3	70%	0.696	60%	0.598	S	S	*	*	S	Bend	trans	-82.8	-9.9	-172.7	-81.6	-175.8	-36	0	114.9	S6	S6-Q9 PolarHBondContact O-N 3.44Å
10	N	51.3	Low	55.6	Low	66 Å²	66	117.6 Å²	117.6	35%	0.353	60%	0.597	S	S	.	*			trans	-161.6	98.6	175.8	-151.3	-10.1	0	0	111.7	Y12 M13 G14	N10-Y12 PolarHBondContact O-N 3.39Å; N10-M13 HydrophobicContact CB-CB 4.09Å; N10-M13 WeakPolarHBondContact ND2-CG 3.46Å; N10-M13 PolarHBondContact ND2-SD 2.9Å; N10-M13 PolarHBondContact O-N 2.8Å; N10-G14 WeakPolarHBondContact O-CA 3.14Å; N10-G14 PolarHBondContact O-N 3.24Å
11	P	54.8	Low	56	Low	101 Å²	101	115.7 Å²	115.7	66%	0.656	59%	0.588	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.6	-17.2	-176.6	23.5	-32.2	0	0	113.5
12	Y	55.1	Low	56.9	Low	197 Å²	197	112.3 Å²	112.3	77%	0.773	56%	0.562	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.6	-31.6	178.8	-78.8	-86.7	0	0	114.5	N10	N10-Y12 PolarHBondContact O-N 3.39Å
13	M	54.1	Low	57.3	Low	136 Å²	136	110.4 Å²	110.4	67%	0.67	55%	0.553	S	S	*	*	H	α-helix	trans	-87.3	-28.2	171.6	-67.7	-179.8	170.9	0	112	N10 K15 H17	N10-M13 HydrophobicContact CB-CB 4.09Å; N10-M13 WeakPolarHBondContact ND2-CG 3.46Å; N10-M13 PolarHBondContact ND2-SD 2.9Å; N10-M13 PolarHBondContact O-N 2.8Å; M13-K15 PolarHBondContact O-N 3.01Å; M13-H17 PolarHBondContact O-N 2.75Å
14	G	57.5	Low	57.9	Low	10 Å²	10	108 Å²	108	10%	0.103	54%	0.541	C	S	.	.	H	α-helix	trans	-69	-19.3	174.8	0	0	0	0	113.3	N10 N18	N10-G14 WeakPolarHBondContact O-CA 3.14Å; N10-G14 PolarHBondContact O-N 3.24Å; G14-N18 WeakPolarHBondContact O-CB 3.42Å; G14-N18 PolarHBondContact O-N 3.2Å; G14-N18 PolarHBondContact O-ND2 3.33Å
15	K	56.4	Low	58.6	Low	138 Å²	138	105.1 Å²	105.1	60%	0.6	53%	0.529	S	S	*	.	H	α-helix	trans	-70.8	-52.5	175.4	-160.2	177.1	-178.2	177.7	111.3	M13 H17 N18 D19	M13-K15 PolarHBondContact O-N 3.01Å; K15-H17 VanDerWaalsContact C-N 3.28Å; K15-H17 PolarHBondContact O-N 3.38Å; K15-N18 PolarHBondContact O-N 2.79Å; K15-D19 WeakPolarHBondContact O-CB 3.31Å; K15-D19 PolarHBondContact O-N 2.77Å
16	Y	58.7	Low	59.2	Low	185 Å²	185	105.2 Å²	105.2	73%	0.725	53%	0.526	S	S	*	.	H	α-helix	trans	-61	-37.4	173.4	-72.6	-78.2	0	0	112.7	C20	Y16-C20 PolarHBondContact O-N 3.27Å; Y16-C20 VanDerWaalsContact O-N 3.1Å; Y16-C20 PolarHBondContact O-SG 3.38Å
17	H	58	Low	59.9	Low	109 Å²	109	106.1 Å²	106.1	51%	0.505	53%	0.525	S	S	.	.	H	α-helix	trans	-70.8	-38.6	176.7	-168.2	76	0	0	112.7	M13 K15 L21	M13-H17 PolarHBondContact O-N 2.75Å; K15-H17 VanDerWaalsContact C-N 3.28Å; K15-H17 PolarHBondContact O-N 3.38Å; H17-L21 WeakPolarHBondContact O-CG 3.37Å; H17-L21 PolarHBondContact O-N 2.87Å; H17-L21 VanDerWaalsContact O-N 3.17Å
18	N	59.9	Low	60.6	Low	51 Å²	51	112.8 Å²	112.8	27%	0.273	54%	0.544	S	S	.	.	H	α-helix	trans	-67.1	-44.3	172.7	-94.2	-77.3	0	0	110.6	G14 K15 C20 L21 W22	G14-N18 WeakPolarHBondContact O-CB 3.42Å; G14-N18 PolarHBondContact O-N 3.2Å; G14-N18 PolarHBondContact O-ND2 3.33Å; K15-N18 PolarHBondContact O-N 2.79Å; N18-C20 VanDerWaalsContact C-N 3.27Å; N18-C20 PolarHBondContact O-N 3.17Å; N18-L21 CarbonylContact O-C 3.55Å; N18-L21 WeakPolarHBondContact O-CA 3.23Å; N18-L21 WeakPolarHBondContact O-CB 3.44Å; N18-L21 PolarHBondContact O-N 3.33Å; N18-W22 WeakPolarHBondContact O-CB 3.5Å; N18-W22 PolarHBondContact O-N 2.88Å
19	D	61.4	Low	61.1	Low	86 Å²	86	108.9 Å²	108.9	46%	0.46	53%	0.531	S	S	.	.	H	α-helix	trans	-58.3	-42.7	179.7	-65.3	-24.9	0	0	110	K15 L21 W22 D23	K15-D19 WeakPolarHBondContact O-CB 3.31Å; K15-D19 PolarHBondContact O-N 2.77Å; D19-L21 PolarHBondContact O-N 3.2Å; D19-W22 PolarHBondContact O-N 3.43Å; D19-D23 VanDerWaalsContact O-CB 3.29Å; D19-D23 WeakPolarHBondContact O-CB 3.48Å; D19-D23 PolarHBondContact O-N 3.33Å
20	C	61.9	Low	61.8	Low	85 Å²	85	104.9 Å²	104.9	57%	0.574	52%	0.517	S	S	*	.	H	α-helix	trans	-63.3	-36.1	173	-74	0	0	0	114.2	Y16 N18 S24	Y16-C20 PolarHBondContact O-N 3.27Å; Y16-C20 VanDerWaalsContact O-N 3.1Å; Y16-C20 PolarHBondContact O-SG 3.38Å; N18-C20 VanDerWaalsContact C-N 3.27Å; N18-C20 PolarHBondContact O-N 3.17Å; C20-S24 WeakPolarHBondContact O-CB 3.14Å; C20-S24 PolarHBondContact O-N 2.81Å; C20-S24 PolarHBondContact O-OG 3.48Å
21	L	64.7	Low	62.5	Low	79 Å²	79	106.3 Å²	106.3	41%	0.414	52%	0.524	S	S	.	.	H	α-helix	trans	-72.5	-40.6	176.9	-73.3	171.4	0	0	111.4	H17 N18 D19 S24 V25	H17-L21 WeakPolarHBondContact O-CG 3.37Å; H17-L21 PolarHBondContact O-N 2.87Å; H17-L21 VanDerWaalsContact O-N 3.17Å; N18-L21 CarbonylContact O-C 3.55Å; N18-L21 WeakPolarHBondContact O-CA 3.23Å; N18-L21 WeakPolarHBondContact O-CB 3.44Å; N18-L21 PolarHBondContact O-N 3.33Å; D19-L21 PolarHBondContact O-N 3.2Å; L21-S24 PolarHBondContact O-N 3.46Å; L21-V25 WeakPolarHBondContact O-CB 3.35Å; L21-V25 VanDerWaalsContact O-CG2 3.23Å; L21-V25 WeakPolarHBondContact O-CG2 3.46Å; L21-V25 PolarHBondContact O-N 3.1Å
22	W	67.4	Low	62.6	Low	167 Å²	167	104.7 Å²	104.7	63%	0.633	52%	0.515	S	S	*	.	H	α-helix	trans	-63.9	-47.1	175.1	-86.4	90.5	0	0	110.6	N18 D19 S24 V25 D26	N18-W22 WeakPolarHBondContact O-CB 3.5Å; N18-W22 PolarHBondContact O-N 2.88Å; D19-W22 PolarHBondContact O-N 3.43Å; W22-S24 VanDerWaalsContact C-N 3.29Å; W22-S24 PolarHBondContact O-N 2.8Å; W22-V25 PolarHBondContact O-N 3.39Å; W22-V25 VanDerWaalsContact O-N 3.13Å; W22-D26 WeakPolarHBondContact O-CB 3.39Å; W22-D26 PolarHBondContact O-N 3.31Å
23	D	61.1	Low	62.9	Low	105 Å²	105	101 Å²	101	56%	0.561	51%	0.507	S	S	*	.	H	α-helix	trans	-61	-40.9	176.4	-146.4	-88	0	0	110.6	D19 V25 D26 I27	D19-D23 VanDerWaalsContact O-CB 3.29Å; D19-D23 WeakPolarHBondContact O-CB 3.48Å; D19-D23 PolarHBondContact O-N 3.33Å; D23-V25 PolarHBondContact O-N 3.02Å; D23-D26 PolarHBondContact O-N 3Å; D23-I27 WeakPolarHBondContact O-CB 3.24Å; D23-I27 WeakPolarHBondContact O-CD1 3.39Å; D23-I27 WeakPolarHBondContact O-CG1 3.45Å; D23-I27 PolarHBondContact O-N 3.37Å; D23-I27 WeakPolarHBondContact OD1-CD1 3.37Å
24	S	64.4	Low	63.1	Low	62 Å²	62	101.4 Å²	101.4	43%	0.434	51%	0.509	S	S	.	.	H	α-helix	trans	-64.6	-39.7	174.6	-61.8	0	0	0	112.9	C20 L21 W22 W28	C20-S24 WeakPolarHBondContact O-CB 3.14Å; C20-S24 PolarHBondContact O-N 2.81Å; C20-S24 PolarHBondContact O-OG 3.48Å; L21-S24 PolarHBondContact O-N 3.46Å; W22-S24 VanDerWaalsContact C-N 3.29Å; W22-S24 PolarHBondContact O-N 2.8Å; S24-W28 WeakPolarHBondContact O-CB 3.34Å; S24-W28 VanDerWaalsContact O-CD1 3.23Å; S24-W28 PolarHBondContact O-N 2.78Å
25	V	67.6	Low	62.9	Low	80 Å²	80	108.8 Å²	108.8	49%	0.485	54%	0.541	S	S	.	.	H	α-helix	trans	-69.7	-39.8	177	168.7	0	0	0	110.9	L21 W22 D23 W28 L29	L21-V25 WeakPolarHBondContact O-CB 3.35Å; L21-V25 VanDerWaalsContact O-CG2 3.23Å; L21-V25 WeakPolarHBondContact O-CG2 3.46Å; L21-V25 PolarHBondContact O-N 3.1Å; W22-V25 PolarHBondContact O-N 3.39Å; W22-V25 VanDerWaalsContact O-N 3.13Å; D23-V25 PolarHBondContact O-N 3.02Å; V25-W28 PolarHBondContact O-N 3.47Å; V25-L29 HydrophobicContact CG1-CD1 3.7Å; V25-L29 WeakPolarHBondContact O-CB 3.38Å; V25-L29 VanDerWaalsContact O-CD1 3.31Å; V25-L29 WeakPolarHBondContact O-CD1 3.13Å; V25-L29 PolarHBondContact O-N 2.77Å
26	D	66.3	Low	62.5	Low	96 Å²	96	113.2 Å²	113.2	51%	0.513	56%	0.564	S	S	.	*	H	α-helix	trans	-67.7	-41.2	179.1	-140.5	-81.4	0	0	110.9	W22 D23 L29 T30	W22-D26 WeakPolarHBondContact O-CB 3.39Å; W22-D26 PolarHBondContact O-N 3.31Å; D23-D26 PolarHBondContact O-N 3Å; D26-L29 PolarHBondContact O-N 3.02Å; D26-T30 VanDerWaalsContact O-CB 3.24Å; D26-T30 WeakPolarHBondContact O-CB 3.34Å; D26-T30 PolarHBondContact O-N 2.74Å; D26-T30 PolarHBondContact O-OG1 2.84Å
27	I	72	Confident	62.7	Low	95 Å²	95	109.6 Å²	109.6	49%	0.487	56%	0.555	S	S	.	*	H	α-helix	trans	-61.1	-47.4	171.3	-68.6	164.4	0	0	110.2	D23 L29 T30 D31	D23-I27 WeakPolarHBondContact O-CB 3.24Å; D23-I27 WeakPolarHBondContact O-CD1 3.39Å; D23-I27 WeakPolarHBondContact O-CG1 3.45Å; D23-I27 PolarHBondContact O-N 3.37Å; D23-I27 WeakPolarHBondContact OD1-CD1 3.37Å; I27-L29 PolarHBondContact O-N 3.39Å; I27-T30 PolarHBondContact O-N 2.87Å; I27-D31 VanDerWaalsContact O-CB 3.26Å; I27-D31 WeakPolarHBondContact O-CB 3.46Å; I27-D31 PolarHBondContact O-N 3.45Å
28	W	70.1	Confident	62.9	Low	190 Å²	190	109.6 Å²	109.6	72%	0.72	56%	0.558	S	S	*	*	H	α-helix	trans	-62.4	-41.7	177.7	-95.7	74.3	0	0	112.7	S24 V25 C32	S24-W28 WeakPolarHBondContact O-CB 3.34Å; S24-W28 VanDerWaalsContact O-CD1 3.23Å; S24-W28 PolarHBondContact O-N 2.78Å; V25-W28 PolarHBondContact O-N 3.47Å; W28-C32 WeakPolarHBondContact O-CB 3.44Å; W28-C32 PolarHBondContact O-N 3.13Å
29	L	66.2	Low	63.1	Low	100 Å²	100	112.9 Å²	112.9	52%	0.524	57%	0.574	S	S	.	*	H	α-helix	trans	-65.4	-45.4	175.5	-103.1	88.2	0	0	111	V25 D26 I27 C32 I33	V25-L29 HydrophobicContact CG1-CD1 3.7Å; V25-L29 WeakPolarHBondContact O-CB 3.38Å; V25-L29 VanDerWaalsContact O-CD1 3.31Å; V25-L29 WeakPolarHBondContact O-CD1 3.13Å; V25-L29 PolarHBondContact O-N 2.77Å; D26-L29 PolarHBondContact O-N 3.02Å; I27-L29 PolarHBondContact O-N 3.39Å; L29-C32 PolarHBondContact O-N 3.42Å; L29-I33 WeakPolarHBondContact O-CB 3.15Å; L29-I33 WeakPolarHBondContact O-CD1 3.26Å; L29-I33 WeakPolarHBondContact O-CG1 3.32Å; L29-I33 PolarHBondContact O-N 2.99Å
30	T	68.6	Low	63.2	Low	64 Å²	64	114.5 Å²	114.5	39%	0.393	58%	0.581	S	S	.	*	H	α-helix	trans	-64.9	-43.5	-178.7	-57.6	0	0	0	111	D26 I27 I33 M34	D26-T30 VanDerWaalsContact O-CB 3.24Å; D26-T30 WeakPolarHBondContact O-CB 3.34Å; D26-T30 PolarHBondContact O-N 2.74Å; D26-T30 PolarHBondContact O-OG1 2.84Å; I27-T30 PolarHBondContact O-N 2.87Å; T30-I33 PolarHBondContact O-N 3Å; T30-M34 HydrophobicContact CG2-CG 4.27Å; T30-M34 WeakPolarHBondContact O-CB 3.39Å; T30-M34 WeakPolarHBondContact O-CG 3.29Å; T30-M34 PolarHBondContact O-N 2.92Å
31	D	65.6	Low	63.3	Low	96 Å²	96	116.3 Å²	116.3	51%	0.513	58%	0.581	S	S	.	*	H	α-helix	trans	-62.7	-48.4	176.3	-163.6	-60.1	0	0	110.7	I27 I33 M34 H35	I27-D31 VanDerWaalsContact O-CB 3.26Å; I27-D31 WeakPolarHBondContact O-CB 3.46Å; I27-D31 PolarHBondContact O-N 3.45Å; D31-I33 VanDerWaalsContact C-N 3.34Å; D31-I33 PolarHBondContact O-N 3.23Å; D31-M34 PolarHBondContact O-N 3.34Å; D31-H35 WeakPolarHBondContact O-CB 3.34Å; D31-H35 PolarHBondContact O-N 3.37Å
32	C	56.7	Low	63.2	Low	67 Å²	67	118.8 Å²	118.8	45%	0.453	59%	0.592	S	S	.	*	H	α-helix	trans	-62.8	-34.8	176.2	-86.6	0	0	0	114	W28 L29 Q36	W28-C32 WeakPolarHBondContact O-CB 3.44Å; W28-C32 PolarHBondContact O-N 3.13Å; L29-C32 PolarHBondContact O-N 3.42Å; C32-Q36 WeakPolarHBondContact O-CG 3.36Å; C32-Q36 PolarHBondContact O-N 2.84Å
33	I	61.8	Low	62.9	Low	119 Å²	119	115.4 Å²	115.4	61%	0.61	59%	0.589	S	S	*	*	H	α-helix	trans	-74.6	-34.4	177.8	-69.2	164.1	0	0	111	L29 T30 D31	L29-I33 WeakPolarHBondContact O-CB 3.15Å; L29-I33 WeakPolarHBondContact O-CD1 3.26Å; L29-I33 WeakPolarHBondContact O-CG1 3.32Å; L29-I33 PolarHBondContact O-N 2.99Å; T30-I33 PolarHBondContact O-N 3Å; D31-I33 VanDerWaalsContact C-N 3.34Å; D31-I33 PolarHBondContact O-N 3.23Å
34	M	59.3	Low	63	Low	145 Å²	145	116.2 Å²	116.2	71%	0.714	59%	0.591	S	S	*	*	H	α-helix	trans	-78.5	-20.5	178.8	-69.8	-73.5	-153.7	0	113.3	T30 D31	T30-M34 HydrophobicContact CG2-CG 4.27Å; T30-M34 WeakPolarHBondContact O-CB 3.39Å; T30-M34 WeakPolarHBondContact O-CG 3.29Å; T30-M34 PolarHBondContact O-N 2.92Å; D31-M34 PolarHBondContact O-N 3.34Å
35	H	53.6	Low	62.9	Low	166 Å²	166	120.7 Å²	120.7	77%	0.769	61%	0.605	S	S	*	*	T	Hydrogen-bonded Turn	trans	-107.2	12.8	-179.4	-94.5	-146.5	0	0	114.9	D31	D31-H35 WeakPolarHBondContact O-CB 3.34Å; D31-H35 PolarHBondContact O-N 3.37Å
36	Q	46.8	Very low	62.4	Low	230 Å²	230	124.4 Å²	124.4	100%	1.075	62%	0.615	S	S	*	*			trans	-103.7	0	165.7	-78.5	-167.2	7.2	0	111.7	C32	C32-Q36 WeakPolarHBondContact O-CG 3.36Å; C32-Q36 PolarHBondContact O-N 2.84Å

Retrieved 36 of 36 residues in 25.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).