A0AA82N7S5_SCHMA Loading...

Uncharacterized protein AlphaSync

AlphaFold DB , UniProt , Accession A0AA82N7S5, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 54 aa.

						>A0AA82N7S5_SCHMA|A0AA82N7S5
MDVSTSTVADLLQVLHVEYKYFQSQYAWLRRPCALLRYATENRYGTGDFVLHHY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.8	Low	76.7	Confident	236 Å²	236	104 Å²	104	100%	1.163	60%	0.603	S	S	*	*				0	104.9	0	-75.8	-179.4	177.9	0	0	106.1	V3	M1-V3 PolarHBondContact O-N 3.47Å
2	D	64.6	Low	78.2	Confident	168 Å²	168	104.7 Å²	104.7	90%	0.898	60%	0.601	S	S	*	*			trans	-82.4	108.8	179.1	-64.7	-42.6	0	0	0	108.4	S4	D2-S4 PolarHBondContact O-N 3.27Å
3	V	63.1	Low	79.6	Confident	102 Å²	102	107.2 Å²	107.2	62%	0.618	60%	0.604	S	S	*	*			trans	-64.7	115.1	172.1	179	0	0	0	0	106.6	M1 T7 V8	M1-V3 PolarHBondContact O-N 3.47Å; V3-T7 HydrophobicContact CG1-CG2 4.37Å; V3-V8 HydrophobicContact CG1-CG2 3.9Å
4	S	72.1	Confident	80.7	Confident	57 Å²	57	105.2 Å²	105.2	40%	0.399	60%	0.596	S	S	.	*			trans	-64.8	142.1	179	64.7	0	0	0	0	109.4	D2 S6 T7	D2-S4 PolarHBondContact O-N 3.27Å; S4-S6 PolarHBondContact O-N 3.1Å; S4-S6 PolarHBondContact OG-OG 2.85Å; S4-T7 WeakPolarHBondContact O-CB 3.4Å; S4-T7 PolarHBondContact O-N 3.07Å; S4-T7 PolarHBondContact OG-OG1 3.4Å
5	T	71.4	Confident	81.8	Confident	127 Å²	127	105.1 Å²	105.1	78%	0.779	59%	0.592	S	S	*	*	H	α-helix	trans	-53.9	-27.4	177.6	46.5	0	0	0	0	112.7	V8 A9	T5-V8 PolarHBondContact O-N 3.09Å; T5-A9 PolarHBondContact O-N 2.79Å; T5-A9 VanDerWaalsContact O-N 3.08Å
6	S	76.6	Confident	82.7	Confident	64 Å²	64	105.4 Å²	105.4	45%	0.448	59%	0.587	S	S	.	*	H	α-helix	trans	-60.6	-43.6	172.5	61	0	0	0	0	112.6	S4 V8 A9 D10	S4-S6 PolarHBondContact O-N 3.1Å; S4-S6 PolarHBondContact OG-OG 2.85Å; S6-V8 VanDerWaalsContact C-N 3.32Å; S6-V8 PolarHBondContact O-N 2.76Å; S6-A9 PolarHBondContact O-N 2.88Å; S6-D10 PolarHBondContact O-N 2.76Å
7	T	84.4	Confident	83.6	Confident	62 Å²	62	104.7 Å²	104.7	38%	0.38	59%	0.586	S	S	.	*	H	α-helix	trans	-65.4	-36.4	179.9	-49.5	0	0	0	0	111.9	V3 S4 L11	V3-T7 HydrophobicContact CG1-CG2 4.37Å; S4-T7 WeakPolarHBondContact O-CB 3.4Å; S4-T7 PolarHBondContact O-N 3.07Å; S4-T7 PolarHBondContact OG-OG1 3.4Å; T7-L11 VanDerWaalsContact O-CG 3.31Å; T7-L11 WeakPolarHBondContact O-CG 3.27Å; T7-L11 PolarHBondContact O-N 2.85Å; T7-L11 VanDerWaalsContact O-N 3.09Å
8	V	87.2	Confident	84.4	Confident	72 Å²	72	104.3 Å²	104.3	44%	0.436	58%	0.579	S	S	.	*	H	α-helix	trans	-68.1	-41.8	175.4	-179.9	0	0	0	0	110.8	V3 T5 S6 D10 L11 L12	V3-V8 HydrophobicContact CG1-CG2 3.9Å; T5-V8 PolarHBondContact O-N 3.09Å; S6-V8 VanDerWaalsContact C-N 3.32Å; S6-V8 PolarHBondContact O-N 2.76Å; V8-D10 VanDerWaalsContact C-N 3.34Å; V8-L11 PolarHBondContact O-N 3.34Å; V8-L12 HydrophobicContact CG1-CD1 4.21Å; V8-L12 HydrophobicContact CG1-CG 4.49Å; V8-L12 WeakPolarHBondContact O-CG 3.48Å; V8-L12 PolarHBondContact O-N 2.86Å
9	A	89.4	Confident	85	Confident	52 Å²	52	105.9 Å²	105.9	43%	0.43	58%	0.576	S	S	.	*	H	α-helix	trans	-61.9	-43.1	176.6	0	0	0	0	0	111.7	T5 S6 L11 L12 Q13	T5-A9 PolarHBondContact O-N 2.79Å; T5-A9 VanDerWaalsContact O-N 3.08Å; S6-A9 PolarHBondContact O-N 2.88Å; A9-L11 PolarHBondContact O-N 3.08Å; A9-L12 PolarHBondContact O-N 3.21Å; A9-Q13 WeakPolarHBondContact O-CB 3.35Å; A9-Q13 PolarHBondContact O-N 3.24Å
10	D	91.2	Very high	85.7	Confident	97 Å²	97	105.3 Å²	105.3	52%	0.519	57%	0.567	S	S	.	*	H	α-helix	trans	-60.7	-45.8	176.8	-64.5	-29.2	0	0	0	111.3	S6 V8 L12 Q13 V14	S6-D10 PolarHBondContact O-N 2.76Å; V8-D10 VanDerWaalsContact C-N 3.34Å; D10-L12 PolarHBondContact O-N 3.35Å; D10-Q13 PolarHBondContact O-N 2.9Å; D10-V14 WeakPolarHBondContact O-CG2 3.42Å; D10-V14 PolarHBondContact O-N 2.9Å
11	L	93.3	Very high	86.2	Confident	107 Å²	107	106.7 Å²	106.7	56%	0.56	57%	0.566	S	S	*	*	H	α-helix	trans	-62	-43.6	177	-74.2	169.5	0	0	0	112.4	T7 V8 A9 Q13 V14 L15	T7-L11 VanDerWaalsContact O-CG 3.31Å; T7-L11 WeakPolarHBondContact O-CG 3.27Å; T7-L11 PolarHBondContact O-N 2.85Å; T7-L11 VanDerWaalsContact O-N 3.09Å; V8-L11 PolarHBondContact O-N 3.34Å; A9-L11 PolarHBondContact O-N 3.08Å; L11-Q13 VanDerWaalsContact C-N 3.26Å; L11-Q13 PolarHBondContact O-N 3.13Å; L11-V14 PolarHBondContact O-N 3.37Å; L11-L15 WeakPolarHBondContact O-CG 3.13Å; L11-L15 PolarHBondContact O-N 2.89Å
12	L	94.9	Very high	88.4	Confident	112 Å²	112	101.7 Å²	101.7	59%	0.586	54%	0.538	S	S	*	.	H	α-helix	trans	-62.7	-36.4	176.5	-74.4	173.7	0	0	0	111.7	V8 A9 D10 H16	V8-L12 HydrophobicContact CG1-CD1 4.21Å; V8-L12 HydrophobicContact CG1-CG 4.49Å; V8-L12 WeakPolarHBondContact O-CG 3.48Å; V8-L12 PolarHBondContact O-N 2.86Å; A9-L12 PolarHBondContact O-N 3.21Å; D10-L12 PolarHBondContact O-N 3.35Å; L12-H16 WeakPolarHBondContact O-CB 3.35Å; L12-H16 PolarHBondContact O-N 2.88Å
13	Q	95.7	Very high	89.9	Confident	137 Å²	137	97.7 Å²	97.7	64%	0.64	51%	0.514	S	S	*	.	H	α-helix	trans	-69.1	-41.4	177.6	-171.7	154.9	-0.1	0	0	112	A9 D10 L11 H16 V17	A9-Q13 WeakPolarHBondContact O-CB 3.35Å; A9-Q13 PolarHBondContact O-N 3.24Å; D10-Q13 PolarHBondContact O-N 2.9Å; L11-Q13 VanDerWaalsContact C-N 3.26Å; L11-Q13 PolarHBondContact O-N 3.13Å; Q13-H16 PolarHBondContact O-N 3.2Å; Q13-V17 WeakPolarHBondContact O-CG2 3.04Å; Q13-V17 PolarHBondContact O-N 3.3Å
14	V	95.2	Very high	91.4	Very high	80 Å²	80	96.4 Å²	96.4	49%	0.485	51%	0.509	S	S	.	.	H	α-helix	trans	-59.1	-50.1	173	172.8	0	0	0	0	110.7	D10 L11 H16 V17 E18	D10-V14 WeakPolarHBondContact O-CG2 3.42Å; D10-V14 PolarHBondContact O-N 2.9Å; L11-V14 PolarHBondContact O-N 3.37Å; V14-H16 VanDerWaalsContact C-N 3.26Å; V14-H16 PolarHBondContact O-N 3.23Å; V14-V17 PolarHBondContact O-N 3.4Å; V14-V17 VanDerWaalsContact O-N 3.14Å; V14-E18 PolarHBondContact O-N 3.47Å
15	L	96.7	Very high	92.4	Very high	103 Å²	103	97.1 Å²	97.1	54%	0.539	51%	0.506	S	S	.	.	H	α-helix	trans	-59.4	-37.8	177.6	-73.5	172.2	0	0	0	112.3	L11 E18 Y19	L11-L15 WeakPolarHBondContact O-CG 3.13Å; L11-L15 PolarHBondContact O-N 2.89Å; L15-E18 PolarHBondContact O-N 3.09Å; L15-Y19 VanDerWaalsContact O-CB 3.29Å; L15-Y19 WeakPolarHBondContact O-CB 3.18Å; L15-Y19 PolarHBondContact O-N 2.9Å
16	H	97.3	Very high	93.4	Very high	110 Å²	110	95.7 Å²	95.7	51%	0.509	49%	0.487	S	S	.	.	H	α-helix	trans	-65	-41.9	177.3	-170.7	78.9	0	0	0	112.3	L12 Q13 V14 Y19 K20	L12-H16 WeakPolarHBondContact O-CB 3.35Å; L12-H16 PolarHBondContact O-N 2.88Å; Q13-H16 PolarHBondContact O-N 3.2Å; V14-H16 VanDerWaalsContact C-N 3.26Å; V14-H16 PolarHBondContact O-N 3.23Å; H16-Y19 PolarHBondContact O-N 2.98Å; H16-K20 WeakPolarHBondContact O-CG 3.5Å; H16-K20 PolarHBondContact O-N 3.4Å
17	V	97.4	Very high	94.1	Very high	94 Å²	94	95.6 Å²	95.6	57%	0.57	49%	0.49	S	S	*	.	H	α-helix	trans	-63.8	-46.8	176.8	172.2	0	0	0	0	110.6	Q13 V14 Y19 K20 Y21	Q13-V17 WeakPolarHBondContact O-CG2 3.04Å; Q13-V17 PolarHBondContact O-N 3.3Å; V14-V17 PolarHBondContact O-N 3.4Å; V14-V17 VanDerWaalsContact O-N 3.14Å; V17-Y19 PolarHBondContact O-N 2.9Å; V17-K20 PolarHBondContact O-N 2.9Å; V17-Y21 PolarHBondContact O-N 2.87Å
18	E	97.5	Very high	94.4	Very high	98 Å²	98	101 Å²	101	46%	0.458	50%	0.504	S	S	.	.	H	α-helix	trans	-60.8	-44.9	177	-70.7	-176.9	172.6	0	0	111.6	V14 L15 K20 Y21 F22	V14-E18 PolarHBondContact O-N 3.47Å; L15-E18 PolarHBondContact O-N 3.09Å; E18-K20 VanDerWaalsContact C-N 3.32Å; E18-K20 PolarHBondContact O-N 3.48Å; E18-Y21 WeakPolarHBondContact O-CB 3.35Å; E18-Y21 PolarHBondContact O-N 3.24Å; E18-Y21 VanDerWaalsContact O-N 3.17Å; E18-F22 HydrophobicContact CB-CE2 4.39Å; E18-F22 WeakPolarHBondContact O-CD2 3.43Å; E18-F22 PolarHBondContact O-N 3.37Å
19	Y	96.9	Very high	94.7	Very high	134 Å²	134	101.5 Å²	101.5	53%	0.525	50%	0.504	S	S	.	.	H	α-helix	trans	-57.4	-45	175.4	174.1	-96.7	0	0	0	111.8	L15 H16 V17 Y21 F22 Q23	L15-Y19 VanDerWaalsContact O-CB 3.29Å; L15-Y19 WeakPolarHBondContact O-CB 3.18Å; L15-Y19 PolarHBondContact O-N 2.9Å; H16-Y19 PolarHBondContact O-N 2.98Å; V17-Y19 PolarHBondContact O-N 2.9Å; Y19-Y21 VanDerWaalsContact C-N 3.32Å; Y19-Y21 PolarHBondContact O-N 3.11Å; Y19-F22 PolarHBondContact O-N 2.99Å; Y19-Q23 VanDerWaalsContact O-CB 3.27Å; Y19-Q23 WeakPolarHBondContact O-CB 3.48Å; Y19-Q23 PolarHBondContact O-N 3.34Å
20	K	97.8	Very high	94.6	Very high	93 Å²	93	106.5 Å²	106.5	40%	0.404	51%	0.511	S	S	.	.	H	α-helix	trans	-64.8	-36.5	177.9	-74.2	-68.6	174.2	-167	0	112.7	H16 V17 E18 S24	H16-K20 WeakPolarHBondContact O-CG 3.5Å; H16-K20 PolarHBondContact O-N 3.4Å; V17-K20 PolarHBondContact O-N 2.9Å; E18-K20 VanDerWaalsContact C-N 3.32Å; E18-K20 PolarHBondContact O-N 3.48Å; K20-S24 WeakPolarHBondContact O-CB 3.42Å; K20-S24 PolarHBondContact O-N 3.17Å; K20-S24 PolarHBondContact O-OG 2.98Å
21	Y	96.7	Very high	94.2	Very high	136 Å²	136	111.6 Å²	111.6	53%	0.533	52%	0.523	S	S	.	.	H	α-helix	trans	-61.4	-53.3	172.7	174.9	-99.2	0	0	0	110.9	V17 E18 Y19 Q23 S24 Q25	V17-Y21 PolarHBondContact O-N 2.87Å; E18-Y21 WeakPolarHBondContact O-CB 3.35Å; E18-Y21 PolarHBondContact O-N 3.24Å; E18-Y21 VanDerWaalsContact O-N 3.17Å; Y19-Y21 VanDerWaalsContact C-N 3.32Å; Y19-Y21 PolarHBondContact O-N 3.11Å; Y21-Q23 VanDerWaalsContact C-N 3.35Å; Y21-Q23 PolarHBondContact O-N 3.19Å; Y21-S24 WeakPolarHBondContact O-CB 3.32Å; Y21-S24 PolarHBondContact O-N 3.34Å; Y21-S24 VanDerWaalsContact O-N 3.12Å; Y21-Q25 HydrophobicContact CD1-CG 4.29Å; Y21-Q25 HydrophobicContact CE1-CG 3.89Å; Y21-Q25 HydrophobicContact CE2-CG 4.19Å; Y21-Q25 VanDerWaalsContact CE2-NE2 3.34Å; Y21-Q25 WeakPolarHBondContact O-CG 3.46Å; Y21-Q25 PolarHBondContact O-N 3.23Å; Y21-Q25 PolarHBondContact OH-NE2 3.49Å
22	F	96	Very high	94.1	Very high	131 Å²	131	109 Å²	109	58%	0.575	51%	0.512	S	S	*	.	H	α-helix	trans	-62	-40.6	178.9	-72.3	-61.4	0	0	0	112.7	E18 Y19 S24 Q25 Y26	E18-F22 HydrophobicContact CB-CE2 4.39Å; E18-F22 WeakPolarHBondContact O-CD2 3.43Å; E18-F22 PolarHBondContact O-N 3.37Å; Y19-F22 PolarHBondContact O-N 2.99Å; F22-S24 VanDerWaalsContact C-N 3.26Å; F22-S24 PolarHBondContact O-N 3.05Å; F22-Q25 PolarHBondContact O-N 3.36Å; F22-Y26 WeakPolarHBondContact O-CB 3.48Å; F22-Y26 PolarHBondContact O-N 2.93Å
23	Q	96.1	Very high	93.8	Very high	84 Å²	84	105.9 Å²	105.9	39%	0.393	50%	0.5	S	S	.	.	H	α-helix	trans	-57.8	-41.4	175.2	-175	175.8	32.5	0	0	111.3	Y19 Y21 A27	Y19-Q23 VanDerWaalsContact O-CB 3.27Å; Y19-Q23 WeakPolarHBondContact O-CB 3.48Å; Y19-Q23 PolarHBondContact O-N 3.34Å; Y21-Q23 VanDerWaalsContact C-N 3.35Å; Y21-Q23 PolarHBondContact O-N 3.19Å; Q23-A27 WeakPolarHBondContact O-CB 3.45Å; Q23-A27 PolarHBondContact O-N 2.88Å
24	S	95.2	Very high	93.4	Very high	75 Å²	75	102.2 Å²	102.2	52%	0.524	49%	0.493	S	S	.	.	H	α-helix	trans	-69.4	-43.1	178.1	-56.7	0	0	0	0	111.9	K20 Y21 F22 Y26 A27 W28	K20-S24 WeakPolarHBondContact O-CB 3.42Å; K20-S24 PolarHBondContact O-N 3.17Å; K20-S24 PolarHBondContact O-OG 2.98Å; Y21-S24 WeakPolarHBondContact O-CB 3.32Å; Y21-S24 PolarHBondContact O-N 3.34Å; Y21-S24 VanDerWaalsContact O-N 3.12Å; F22-S24 VanDerWaalsContact C-N 3.26Å; F22-S24 PolarHBondContact O-N 3.05Å; S24-Y26 PolarHBondContact O-N 3.31Å; S24-A27 PolarHBondContact O-N 2.96Å; S24-W28 WeakPolarHBondContact O-CB 3.14Å; S24-W28 PolarHBondContact O-N 3.01Å
25	Q	93.4	Very high	93	Very high	72 Å²	72	104.2 Å²	104.2	34%	0.336	50%	0.5	S	S	.	.	H	α-helix	trans	-61.4	-43.6	176.1	-66.7	-62.6	-12.8	0	0	111.8	Y21 F22 W28 L29	Y21-Q25 HydrophobicContact CD1-CG 4.29Å; Y21-Q25 HydrophobicContact CE1-CG 3.89Å; Y21-Q25 HydrophobicContact CE2-CG 4.19Å; Y21-Q25 VanDerWaalsContact CE2-NE2 3.34Å; Y21-Q25 WeakPolarHBondContact O-CG 3.46Å; Y21-Q25 PolarHBondContact O-N 3.23Å; Y21-Q25 PolarHBondContact OH-NE2 3.49Å; F22-Q25 PolarHBondContact O-N 3.36Å; Q25-W28 PolarHBondContact O-N 3.45Å; Q25-L29 WeakPolarHBondContact O-CG 3.47Å; Q25-L29 PolarHBondContact O-N 3.17Å
26	Y	92.5	Very high	92.6	Very high	97 Å²	97	104.8 Å²	104.8	38%	0.38	50%	0.503	S	S	.	.	H	α-helix	trans	-62.4	-46.2	175.6	178.6	-94.2	0	0	0	111.9	F22 S24 W28 L29 R30 H53	F22-Y26 WeakPolarHBondContact O-CB 3.48Å; F22-Y26 PolarHBondContact O-N 2.93Å; S24-Y26 PolarHBondContact O-N 3.31Å; Y26-W28 VanDerWaalsContact C-N 3.27Å; Y26-W28 PolarHBondContact O-N 2.95Å; Y26-L29 PolarHBondContact O-N 3.31Å; Y26-R30 PolarHBondContact O-N 3.05Å; Y26-H53 PolarHBondContact OH-CE1 3.41Å; Y26-H53 VanDerWaalsContact OH-CE1 3.23Å; Y26-H53 PolarHBondContact OH-ND1 3.18Å
27	A	90.6	Very high	91.9	Very high	62 Å²	62	103.2 Å²	103.2	51%	0.512	49%	0.493	S	S	.	.	H	α-helix	trans	-60.4	-38.5	177.2	0	0	0	0	0	112	Q23 S24	Q23-A27 WeakPolarHBondContact O-CB 3.45Å; Q23-A27 PolarHBondContact O-N 2.88Å; S24-A27 PolarHBondContact O-N 2.96Å
28	W	90.7	Very high	91.2	Very high	176 Å²	176	105.8 Å²	105.8	67%	0.667	49%	0.493	S	S	*	.	H	α-helix	trans	-65.2	-45.6	175.1	-179.2	82.2	0	0	0	112.1	S24 Q25 Y26 R30 P32	S24-W28 WeakPolarHBondContact O-CB 3.14Å; S24-W28 PolarHBondContact O-N 3.01Å; Q25-W28 PolarHBondContact O-N 3.45Å; Y26-W28 VanDerWaalsContact C-N 3.27Å; Y26-W28 PolarHBondContact O-N 2.95Å; W28-R30 VanDerWaalsContact C-N 3.29Å; W28-R30 PolarHBondContact O-N 3.22Å; W28-P32 WeakPolarHBondContact O-CD 3.38Å
29	L	93.2	Very high	90.5	Very high	82 Å²	82	103.7 Å²	103.7	43%	0.429	49%	0.493	S	S	.	.	H	α-helix	trans	-67.8	-25.3	179.4	-77.3	169.4	0	0	0	113.8	Q25 Y26 R31 P32 C33	Q25-L29 WeakPolarHBondContact O-CG 3.47Å; Q25-L29 PolarHBondContact O-N 3.17Å; Y26-L29 PolarHBondContact O-N 3.31Å; L29-R31 VanDerWaalsContact C-N 3.31Å; L29-R31 PolarHBondContact O-N 2.99Å; L29-P32 VanDerWaalsContact O-CD 3.28Å; L29-P32 WeakPolarHBondContact O-CD 3.14Å; L29-C33 WeakPolarHBondContact O-CB 3.28Å; L29-C33 PolarHBondContact O-N 2.8Å; L29-C33 PolarHBondContact O-SG 3.12Å; L29-C33 VanDerWaalsContact O-SG 3.34Å
30	R	88.3	Confident	89.8	Confident	156 Å²	156	99.4 Å²	99.4	59%	0.589	48%	0.481	S	S	*	.	H	α-helix	trans	-56.1	-41.9	-175	-169.4	176.5	-178.2	173.6	3.2	113.3	Y26 W28 A34	Y26-R30 PolarHBondContact O-N 3.05Å; W28-R30 VanDerWaalsContact C-N 3.29Å; W28-R30 PolarHBondContact O-N 3.22Å; R30-A34 WeakPolarHBondContact O-CB 3.49Å; R30-A34 PolarHBondContact O-N 3.38Å; R30-A34 VanDerWaalsContact O-N 3.11Å
31	R	83.6	Confident	89	Confident	205 Å²	205	97.3 Å²	97.3	77%	0.774	47%	0.472	S	S	*	.	H	α-helix	trans	-70.1	-52.7	-179.4	-78.3	-177.2	179.8	-175.2	0.3	112.6	L29 C33 A34 L35	L29-R31 VanDerWaalsContact C-N 3.31Å; L29-R31 PolarHBondContact O-N 2.99Å; R31-C33 VanDerWaalsContact C-N 3.29Å; R31-C33 PolarHBondContact O-N 2.96Å; R31-A34 PolarHBondContact O-N 3.25Å; R31-L35 WeakPolarHBondContact O-CG 3.37Å; R31-L35 PolarHBondContact O-N 3.4Å
32	P	90.3	Very high	88.2	Confident	51 Å²	51	95.8 Å²	95.8	33%	0.331	47%	0.474	S	S	.	.	H	α-helix	trans	-52.1	-44.7	172.9	-28.1	33	0	0	0	113.4	W28 L29 A34 L35 L36	W28-P32 WeakPolarHBondContact O-CD 3.38Å; L29-P32 VanDerWaalsContact O-CD 3.28Å; L29-P32 WeakPolarHBondContact O-CD 3.14Å; P32-A34 PolarHBondContact O-N 3.35Å; P32-L35 PolarHBondContact O-N 3.33Å; P32-L36 WeakPolarHBondContact O-CB 3.27Å; P32-L36 WeakPolarHBondContact O-CG 3.39Å; P32-L36 PolarHBondContact O-N 2.93Å
33	C	89.1	Confident	87.2	Confident	48 Å²	48	98.7 Å²	98.7	32%	0.324	48%	0.481	S	S	.	.	H	α-helix	trans	-62.9	-42	178.4	-69.4	0	0	0	0	112.4	L29 R31 L36 R37 L51	L29-C33 WeakPolarHBondContact O-CB 3.28Å; L29-C33 PolarHBondContact O-N 2.8Å; L29-C33 PolarHBondContact O-SG 3.12Å; L29-C33 VanDerWaalsContact O-SG 3.34Å; R31-C33 VanDerWaalsContact C-N 3.29Å; R31-C33 PolarHBondContact O-N 2.96Å; C33-L36 PolarHBondContact O-N 3.23Å; C33-R37 WeakPolarHBondContact O-CB 3.41Å; C33-R37 PolarHBondContact O-N 3.14Å; C33-L51 HydrophobicContact CB-CD1 4.23Å
34	A	86.7	Confident	86.2	Confident	59 Å²	59	103.2 Å²	103.2	49%	0.488	50%	0.495	S	S	.	.	H	α-helix	trans	-64.4	-40.4	176.1	0	0	0	0	0	112.3	R30 R31 P32 R37 Y38	R30-A34 WeakPolarHBondContact O-CB 3.49Å; R30-A34 PolarHBondContact O-N 3.38Å; R30-A34 VanDerWaalsContact O-N 3.11Å; R31-A34 PolarHBondContact O-N 3.25Å; P32-A34 PolarHBondContact O-N 3.35Å; A34-R37 PolarHBondContact O-N 2.89Å; A34-Y38 WeakPolarHBondContact O-CB 3.46Å; A34-Y38 PolarHBondContact O-N 2.83Å
35	L	87.3	Confident	84.8	Confident	122 Å²	122	101.6 Å²	101.6	64%	0.639	49%	0.491	S	S	*	.	H	α-helix	trans	-65	-42.9	175.9	-72	173.1	0	0	0	111.9	R31 P32 Y38 A39	R31-L35 WeakPolarHBondContact O-CG 3.37Å; R31-L35 PolarHBondContact O-N 3.4Å; P32-L35 PolarHBondContact O-N 3.33Å; L35-Y38 PolarHBondContact O-N 2.96Å; L35-A39 WeakPolarHBondContact O-CB 3.35Å; L35-A39 PolarHBondContact O-N 3.33Å
36	L	87.2	Confident	83.4	Confident	116 Å²	116	103.7 Å²	103.7	61%	0.607	51%	0.508	S	S	*	.	H	α-helix	trans	-62	-45	175.3	-75.3	170.4	0	0	0	111.1	P32 C33 A39 T40	P32-L36 WeakPolarHBondContact O-CB 3.27Å; P32-L36 WeakPolarHBondContact O-CG 3.39Å; P32-L36 PolarHBondContact O-N 2.93Å; C33-L36 PolarHBondContact O-N 3.23Å; L36-A39 PolarHBondContact O-N 2.99Å; L36-T40 WeakPolarHBondContact O-CG2 3.38Å; L36-T40 PolarHBondContact O-N 3.48Å; L36-T40 PolarHBondContact O-OG1 3.05Å
37	R	82.5	Confident	81.7	Confident	76 Å²	76	100.7 Å²	100.7	29%	0.287	51%	0.507	S	S	.	.	H	α-helix	trans	-58.4	-49.1	174.6	-178.4	172.6	171.9	144.3	2.7	111.2	C33 A34 A39 T40 E41 D48 F49	C33-R37 WeakPolarHBondContact O-CB 3.41Å; C33-R37 PolarHBondContact O-N 3.14Å; A34-R37 PolarHBondContact O-N 2.89Å; R37-A39 VanDerWaalsContact C-N 3.31Å; R37-A39 PolarHBondContact O-N 3.45Å; R37-T40 WeakPolarHBondContact CA-OG1 3.47Å; R37-T40 PolarHBondContact O-N 3.27Å; R37-T40 PolarHBondContact O-OG1 3.47Å; R37-E41 HydrophobicContact CG-CG 4.16Å; R37-E41 WeakPolarHBondContact CG-OE1 3.39Å; R37-E41 IonicContact CZ-OE1 3.48Å; R37-E41 IonicContact NE-OE1 2.76Å; R37-E41 PolarHBondContact NE-OE1 3.21Å; R37-E41 IonicContact NH2-OE1 3.34Å; R37-E41 PolarHBondContact NH2-OE1 3.49Å; R37-E41 WeakPolarHBondContact O-CB 3.47Å; R37-E41 WeakPolarHBondContact O-CG 3.12Å; R37-E41 PolarHBondContact O-N 3.4Å; R37-D48 IonicContact CZ-OD1 3.35Å; R37-D48 IonicContact NH1-OD1 3.08Å; R37-D48 PolarHBondContact NH1-OD1 2.97Å; R37-D48 VanDerWaalsContact NH1-OD1 3.08Å; R37-D48 IonicContact NH2-OD1 2.76Å; R37-D48 PolarHBondContact NH2-OD1 3.32Å; R37-F49 VanDerWaalsContact NH1-C 3.31Å; R37-F49 PolarHBondContact NH1-O 2.93Å
38	Y	82.6	Confident	80.2	Confident	148 Å²	148	103.3 Å²	103.3	58%	0.58	51%	0.513	S	S	*	.	H	α-helix	trans	-59.3	-41.9	176.5	178.7	-105	0	0	0	112.4	A34 L35 N42	A34-Y38 WeakPolarHBondContact O-CB 3.46Å; A34-Y38 PolarHBondContact O-N 2.83Å; L35-Y38 PolarHBondContact O-N 2.96Å; Y38-N42 VanDerWaalsContact CD1-ND2 3.35Å; Y38-N42 WeakPolarHBondContact CD1-ND2 3.38Å; Y38-N42 WeakPolarHBondContact CE1-ND2 3.41Å; Y38-N42 WeakPolarHBondContact CE2-ND2 3.38Å; Y38-N42 WeakPolarHBondContact O-CB 3.4Å; Y38-N42 VanDerWaalsContact O-CG 3.32Å; Y38-N42 PolarHBondContact O-N 3.29Å; Y38-N42 VanDerWaalsContact O-N 3.07Å; Y38-N42 PolarHBondContact O-ND2 3.42Å
39	A	83.4	Confident	78.5	Confident	55 Å²	55	101.5 Å²	101.5	46%	0.455	51%	0.51	S	S	.	.	H	α-helix	trans	-66	-38.2	177.9	0	0	0	0	0	112.6	L35 L36 R37 R43	L35-A39 WeakPolarHBondContact O-CB 3.35Å; L35-A39 PolarHBondContact O-N 3.33Å; L36-A39 PolarHBondContact O-N 2.99Å; R37-A39 VanDerWaalsContact C-N 3.31Å; R37-A39 PolarHBondContact O-N 3.45Å; A39-R43 WeakPolarHBondContact O-CB 3.45Å; A39-R43 PolarHBondContact O-N 3.05Å
40	T	82.1	Confident	76.6	Confident	44 Å²	44	100.6 Å²	100.6	27%	0.27	51%	0.507	S	S	.	.	H	α-helix	trans	-72.1	-41.1	176.8	54.9	0	0	0	0	111.7	L36 R37 N42 R43 Y44	L36-T40 WeakPolarHBondContact O-CG2 3.38Å; L36-T40 PolarHBondContact O-N 3.48Å; L36-T40 PolarHBondContact O-OG1 3.05Å; R37-T40 WeakPolarHBondContact CA-OG1 3.47Å; R37-T40 PolarHBondContact O-N 3.27Å; R37-T40 PolarHBondContact O-OG1 3.47Å; T40-N42 VanDerWaalsContact C-N 3.31Å; T40-N42 PolarHBondContact O-N 3.08Å; T40-R43 PolarHBondContact O-N 2.91Å; T40-R43 VanDerWaalsContact O-N 3.1Å; T40-Y44 PolarHBondContact O-N 3.49Å
41	E	82	Confident	75	Confident	49 Å²	49	99 Å²	99	23%	0.229	51%	0.51	C	S	.	.	H	α-helix	trans	-60.2	-40.2	176.5	-69	178.3	169.7	0	0	111.5	R37 R43 G45 T46	R37-E41 HydrophobicContact CG-CG 4.16Å; R37-E41 WeakPolarHBondContact CG-OE1 3.39Å; R37-E41 IonicContact CZ-OE1 3.48Å; R37-E41 IonicContact NE-OE1 2.76Å; R37-E41 PolarHBondContact NE-OE1 3.21Å; R37-E41 IonicContact NH2-OE1 3.34Å; R37-E41 PolarHBondContact NH2-OE1 3.49Å; R37-E41 WeakPolarHBondContact O-CB 3.47Å; R37-E41 WeakPolarHBondContact O-CG 3.12Å; R37-E41 PolarHBondContact O-N 3.4Å; E41-R43 VanDerWaalsContact C-N 3.34Å; E41-R43 PolarHBondContact O-N 2.94Å; E41-G45 CarbonylContact O-C 3.47Å; E41-G45 VanDerWaalsContact O-CA 3.27Å; E41-G45 WeakPolarHBondContact O-CA 3.29Å; E41-G45 PolarHBondContact O-N 3Å; E41-G45 VanDerWaalsContact O-N 3.09Å; E41-T46 HydrophobicContact CB-CG2 4.2Å; E41-T46 VanDerWaalsContact CD-CG2 3.46Å; E41-T46 HydrophobicContact CG-CG2 3.67Å
42	N	78.6	Confident	73	Confident	104 Å²	104	95.6 Å²	95.6	56%	0.556	50%	0.502	S	S	*	.	H	α-helix	trans	-70	-27.4	175.8	-73.3	-46.1	0	0	0	113.9	Y38 T40	Y38-N42 VanDerWaalsContact CD1-ND2 3.35Å; Y38-N42 WeakPolarHBondContact CD1-ND2 3.38Å; Y38-N42 WeakPolarHBondContact CE1-ND2 3.41Å; Y38-N42 WeakPolarHBondContact CE2-ND2 3.38Å; Y38-N42 WeakPolarHBondContact O-CB 3.4Å; Y38-N42 VanDerWaalsContact O-CG 3.32Å; Y38-N42 PolarHBondContact O-N 3.29Å; Y38-N42 VanDerWaalsContact O-N 3.07Å; Y38-N42 PolarHBondContact O-ND2 3.42Å; T40-N42 VanDerWaalsContact C-N 3.31Å; T40-N42 PolarHBondContact O-N 3.08Å
43	R	76.1	Confident	70.6	Confident	191 Å²	191	99.5 Å²	99.5	72%	0.721	52%	0.516	S	S	*	.	H	α-helix	trans	-94.6	-34.6	-174.7	-171.2	169.4	-177.3	156.9	1.3	113.6	A39 T40 E41	A39-R43 WeakPolarHBondContact O-CB 3.45Å; A39-R43 PolarHBondContact O-N 3.05Å; T40-R43 PolarHBondContact O-N 2.91Å; T40-R43 VanDerWaalsContact O-N 3.1Å; E41-R43 VanDerWaalsContact C-N 3.34Å; E41-R43 PolarHBondContact O-N 2.94Å
44	Y	74.5	Confident	68.5	Low	180 Å²	180	110.7 Å²	110.7	71%	0.706	55%	0.553	S	S	*	*	H	α-helix	trans	-123.8	1.8	-171.2	-59.3	-74.4	0	0	0	113.7	T40	T40-Y44 PolarHBondContact O-N 3.49Å
45	G	66	Low	67.6	Low	41 Å²	41	113.3 Å²	113.3	42%	0.423	56%	0.557	S	S	.	*			trans	81.5	167.4	-168.1	0	0	0	0	0	111.7	E41 G47	E41-G45 CarbonylContact O-C 3.47Å; E41-G45 VanDerWaalsContact O-CA 3.27Å; E41-G45 WeakPolarHBondContact O-CA 3.29Å; E41-G45 PolarHBondContact O-N 3Å; E41-G45 VanDerWaalsContact O-N 3.09Å; G45-G47 VanDerWaalsContact C-N 3.32Å; G45-G47 PolarHBondContact O-N 3.2Å
46	T	64.7	Low	66.6	Low	115 Å²	115	112.8 Å²	112.8	71%	0.706	55%	0.552	S	S	*	*			trans	-70.6	78.9	-170.1	-8.3	0	0	0	0	112.8	E41	E41-T46 HydrophobicContact CB-CG2 4.2Å; E41-T46 VanDerWaalsContact CD-CG2 3.46Å; E41-T46 HydrophobicContact CG-CG2 3.67Å
47	G	55.9	Low	65.4	Low	35 Å²	35	112.7 Å²	112.7	36%	0.361	55%	0.549	S	S	.	.			trans	-78.4	114	167.6	0	0	0	0	0	109.7	G45 F49	G45-G47 VanDerWaalsContact C-N 3.32Å; G45-G47 PolarHBondContact O-N 3.2Å; G47-F49 WeakPolarHBondContact O-CD2 3.45Å; G47-F49 PolarHBondContact O-N 3.36Å
48	D	58.9	Low	64.4	Low	117 Å²	117	114.8 Å²	114.8	63%	0.626	57%	0.565	S	S	*	*			trans	-71.9	86.7	-173.4	-160.8	15.1	0	0	0	112	R37 V50	R37-D48 IonicContact CZ-OD1 3.35Å; R37-D48 IonicContact NH1-OD1 3.08Å; R37-D48 PolarHBondContact NH1-OD1 2.97Å; R37-D48 VanDerWaalsContact NH1-OD1 3.08Å; R37-D48 IonicContact NH2-OD1 2.76Å; R37-D48 PolarHBondContact NH2-OD1 3.32Å; D48-V50 VanDerWaalsContact C-N 3.31Å; D48-V50 VanDerWaalsContact CG-CG2 3.42Å; D48-V50 PolarHBondContact O-N 3.09Å; D48-V50 VanDerWaalsContact O-N 3.13Å; D48-V50 WeakPolarHBondContact OD1-CG2 3.41Å; D48-V50 WeakPolarHBondContact OD2-CG2 3.5Å
49	F	55.4	Low	63.3	Low	138 Å²	138	112.8 Å²	112.8	61%	0.605	56%	0.564	S	S	*	*			trans	-81.9	79.6	168	-60.8	-80.8	0	0	0	108.8	R37 G47 L51	R37-F49 VanDerWaalsContact NH1-C 3.31Å; R37-F49 PolarHBondContact NH1-O 2.93Å; G47-F49 WeakPolarHBondContact O-CD2 3.45Å; G47-F49 PolarHBondContact O-N 3.36Å; F49-L51 PolarHBondContact O-N 3.39Å
50	V	52.5	Low	61.9	Low	63 Å²	63	116.6 Å²	116.6	38%	0.382	57%	0.571	S	S	.	*			trans	-79	98.7	169.3	-170.1	0	0	0	0	107.9	D48 H52	D48-V50 VanDerWaalsContact C-N 3.31Å; D48-V50 VanDerWaalsContact CG-CG2 3.42Å; D48-V50 PolarHBondContact O-N 3.09Å; D48-V50 VanDerWaalsContact O-N 3.13Å; D48-V50 WeakPolarHBondContact OD1-CG2 3.41Å; D48-V50 WeakPolarHBondContact OD2-CG2 3.5Å; V50-H52 HydrophobicContact CG1-CB 4.26Å; V50-H52 WeakPolarHBondContact CG1-CD2 3.31Å; V50-H52 WeakPolarHBondContact CG1-NE2 3.43Å; V50-H52 PolarHBondContact O-N 2.99Å
51	L	54.9	Low	60.5	Low	123 Å²	123	121.8 Å²	121.8	64%	0.644	59%	0.593	S	S	*	*			trans	-62.8	86.9	149.4	-100.6	141.8	0	0	0	105.6	C33 F49 H53	C33-L51 HydrophobicContact CB-CD1 4.23Å; F49-L51 PolarHBondContact O-N 3.39Å; L51-H53 PolarHBondContact O-N 3.14Å; L51-H53 VanDerWaalsContact O-N 3.09Å
52	H	42.3	Very low	58.8	Low	132 Å²	132	127.4 Å²	127.4	61%	0.611	62%	0.621	S	S	*	*			trans	-57.3	119.2	177	-87.6	-88.6	0	0	0	107.4	V50 Y54	V50-H52 HydrophobicContact CG1-CB 4.26Å; V50-H52 WeakPolarHBondContact CG1-CD2 3.31Å; V50-H52 WeakPolarHBondContact CG1-NE2 3.43Å; V50-H52 PolarHBondContact O-N 2.99Å; H52-Y54 HydrophobicContact CB-CD2 4.14Å; H52-Y54 HydrophobicContact CB-CE2 3.92Å; H52-Y54 PolarHBondContact O-N 2.78Å
53	H	40.3	Very low	57.2	Low	133 Å²	133	129.3 Å²	129.3	62%	0.616	63%	0.626	S	S	*	*			trans	-53	103.3	168.9	-91.6	-91.6	0	0	0	108.5	Y26 L51	Y26-H53 PolarHBondContact OH-CE1 3.41Å; Y26-H53 VanDerWaalsContact OH-CE1 3.23Å; Y26-H53 PolarHBondContact OH-ND1 3.18Å; L51-H53 PolarHBondContact O-N 3.14Å; L51-H53 VanDerWaalsContact O-N 3.09Å
54	Y	44.6	Very low	55.5	Low	284 Å²	284	123.7 Å²	123.7	100%	1.114	62%	0.617	S	S	*	*			trans	-112.2	0	161.8	-78.7	-79.7	0	0	0	108	H52	H52-Y54 HydrophobicContact CB-CD2 4.14Å; H52-Y54 HydrophobicContact CB-CE2 3.92Å; H52-Y54 PolarHBondContact O-N 2.78Å

Retrieved 54 of 54 residues in 31.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).