A0AA82N7X5_SCHMA Loading...

Uncharacterized protein AlphaSync

AlphaFold DB , UniProt , Accession A0AA82N7X5, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 39 aa.

						>A0AA82N7X5_SCHMA|A0AA82N7X5
MCSRFFRWWVIWTTSTWSTTTINNNWILIHVVPHSKKHE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59.1	Low	78.5	Confident	211 Å²	211	138.6 Å²	138.6	100%	1.039	64%	0.642	S	S	*	*				0	-6.4	0	-79.6	166.5	173	0	0	114.4	S3	M1-S3 PolarHBondContact O-N 3.5Å
2	C	62.1	Low	79.2	Confident	109 Å²	109	139.2 Å²	139.2	74%	0.736	64%	0.635	S	S	*	*	H	α-helix	trans	-74.9	-17.2	-174	-53	0	0	0	0	116	R4 F6	C2-R4 PolarHBondContact O-N 2.86Å; C2-F6 PolarHBondContact O-N 3.32Å
3	S	73.1	Confident	79.7	Confident	95 Å²	95	132.3 Å²	132.3	66%	0.664	61%	0.609	S	S	*	*	H	α-helix	trans	-72.9	-28.3	-175.4	60.5	0	0	0	0	114.4	M1 R7	M1-S3 PolarHBondContact O-N 3.5Å; S3-R7 WeakPolarHBondContact O-CB 3.07Å; S3-R7 PolarHBondContact O-N 3.37Å; S3-R7 VanDerWaalsContact O-N 3.15Å
4	R	76.6	Confident	80	Confident	194 Å²	194	128.3 Å²	128.3	73%	0.732	60%	0.599	S	S	*	*	H	α-helix	trans	-75.7	-38.2	-178.3	-61.1	-171.2	80.3	158.3	3.1	112.2	C2 R7 W8	C2-R4 PolarHBondContact O-N 2.86Å; R4-R7 PolarHBondContact O-N 3.09Å; R4-W8 WeakPolarHBondContact O-CB 2.82Å; R4-W8 PolarHBondContact O-N 3.39Å
5	F	78.7	Confident	79.9	Confident	153 Å²	153	124 Å²	124	67%	0.671	59%	0.589	S	S	*	*	H	α-helix	trans	-66	-44.1	176.1	-69	-73	0	0	0	111.6	R7 W8 W9	F5-R7 VanDerWaalsContact C-N 3.33Å; F5-R7 PolarHBondContact O-N 2.78Å; F5-W8 PolarHBondContact O-N 3.4Å; F5-W9 WeakPolarHBondContact O-CB 3.16Å; F5-W9 PolarHBondContact O-N 3.49Å
6	F	81.5	Confident	79.9	Confident	135 Å²	135	120.4 Å²	120.4	59%	0.592	58%	0.578	S	S	*	*	H	α-helix	trans	-60.6	-44.1	175.8	-172.9	-100.2	0	0	0	111.5	C2 W8 W9 V10	C2-F6 PolarHBondContact O-N 3.32Å; F6-W8 VanDerWaalsContact C-N 3.34Å; F6-W8 PolarHBondContact O-N 3.2Å; F6-W9 HydrophobicContact CE2-CE3 4.41Å; F6-W9 PolarHBondContact O-N 3.02Å; F6-V10 HydrophobicContact CD1-CG2 4.1Å; F6-V10 HydrophobicContact CE1-CG2 3.72Å; F6-V10 HydrophobicContact CE2-CG2 4.46Å; F6-V10 HydrophobicContact CZ-CG2 3.92Å; F6-V10 WeakPolarHBondContact O-CG2 3.13Å; F6-V10 PolarHBondContact O-N 3.37Å
7	R	83.7	Confident	79.8	Confident	172 Å²	172	124.8 Å²	124.8	65%	0.649	59%	0.587	S	S	*	*	H	α-helix	trans	-62.1	-41.7	176.8	-163.3	172.2	84.2	-177	9.4	112.3	S3 R4 F5 I11	S3-R7 WeakPolarHBondContact O-CB 3.07Å; S3-R7 PolarHBondContact O-N 3.37Å; S3-R7 VanDerWaalsContact O-N 3.15Å; R4-R7 PolarHBondContact O-N 3.09Å; F5-R7 VanDerWaalsContact C-N 3.33Å; F5-R7 PolarHBondContact O-N 2.78Å; R7-I11 HydrophobicContact CG-CD1 4.24Å; R7-I11 WeakPolarHBondContact O-CD1 3.16Å; R7-I11 VanDerWaalsContact O-CG1 3.25Å; R7-I11 WeakPolarHBondContact O-CG1 3.14Å; R7-I11 PolarHBondContact O-N 2.86Å; R7-I11 VanDerWaalsContact O-N 3.12Å
8	W	85.9	Confident	79.6	Confident	167 Å²	167	120.9 Å²	120.9	63%	0.633	58%	0.576	S	S	*	*	H	α-helix	trans	-64.6	-42.1	176.1	-175.7	82.1	0	0	0	111.9	R4 F5 F6 I11 W12	R4-W8 WeakPolarHBondContact O-CB 2.82Å; R4-W8 PolarHBondContact O-N 3.39Å; F5-W8 PolarHBondContact O-N 3.4Å; F6-W8 VanDerWaalsContact C-N 3.34Å; F6-W8 PolarHBondContact O-N 3.2Å; W8-I11 PolarHBondContact O-N 3.36Å; W8-W12 WeakPolarHBondContact O-CB 3.47Å; W8-W12 PolarHBondContact O-N 3.49Å
9	W	88	Confident	79.4	Confident	138 Å²	138	118.9 Å²	118.9	52%	0.523	57%	0.572	S	S	.	*	H	α-helix	trans	-63.7	-41.8	177.5	-175.6	78.8	0	0	0	112.8	F5 F6 W12 T13	F5-W9 WeakPolarHBondContact O-CB 3.16Å; F5-W9 PolarHBondContact O-N 3.49Å; F6-W9 HydrophobicContact CE2-CE3 4.41Å; F6-W9 PolarHBondContact O-N 3.02Å; W9-W12 PolarHBondContact O-N 2.89Å; W9-T13 HydrophobicContact CD2-CG2 4.14Å; W9-T13 HydrophobicContact CH2-CG2 4.42Å; W9-T13 HydrophobicContact CZ2-CG2 3.94Å; W9-T13 WeakPolarHBondContact O-CG2 3.21Å; W9-T13 PolarHBondContact O-N 2.83Å; W9-T13 PolarHBondContact O-OG1 3.34Å
10	V	87.6	Confident	79.2	Confident	55 Å²	55	116.7 Å²	116.7	33%	0.333	57%	0.566	S	S	.	*	H	α-helix	trans	-62.9	-44.4	175	173	0	0	0	0	111	F6 W12 T13 T14	F6-V10 HydrophobicContact CD1-CG2 4.1Å; F6-V10 HydrophobicContact CE1-CG2 3.72Å; F6-V10 HydrophobicContact CE2-CG2 4.46Å; F6-V10 HydrophobicContact CZ-CG2 3.92Å; F6-V10 WeakPolarHBondContact O-CG2 3.13Å; F6-V10 PolarHBondContact O-N 3.37Å; V10-W12 VanDerWaalsContact C-N 3.34Å; V10-W12 PolarHBondContact O-N 3.48Å; V10-T13 WeakPolarHBondContact CA-OG1 3.37Å; V10-T13 PolarHBondContact O-N 2.82Å; V10-T13 PolarHBondContact O-OG1 3.46Å; V10-T14 WeakPolarHBondContact O-CB 3.41Å; V10-T14 PolarHBondContact O-N 2.78Å; V10-T14 PolarHBondContact O-OG1 2.82Å
11	I	87	Confident	79	Confident	96 Å²	96	114.6 Å²	114.6	49%	0.492	56%	0.561	S	S	.	*	H	α-helix	trans	-61.6	-45.2	177.7	-66.7	162.3	0	0	0	110.5	R7 W8 T14 S15	R7-I11 HydrophobicContact CG-CD1 4.24Å; R7-I11 WeakPolarHBondContact O-CD1 3.16Å; R7-I11 VanDerWaalsContact O-CG1 3.25Å; R7-I11 WeakPolarHBondContact O-CG1 3.14Å; R7-I11 PolarHBondContact O-N 2.86Å; R7-I11 VanDerWaalsContact O-N 3.12Å; W8-I11 PolarHBondContact O-N 3.36Å; I11-T14 PolarHBondContact O-N 3.36Å; I11-S15 WeakPolarHBondContact O-CB 3.12Å; I11-S15 PolarHBondContact O-N 3.47Å; I11-S15 PolarHBondContact O-OG 3.44Å; I11-S15 VanDerWaalsContact O-OG 3.12Å
12	W	86.9	Confident	80	Confident	145 Å²	145	110 Å²	110	55%	0.549	54%	0.539	S	S	.	.	H	α-helix	trans	-63.5	-45.7	-179.1	-178	54.3	0	0	0	112.7	W8 W9 V10 S15 T16	W8-W12 WeakPolarHBondContact O-CB 3.47Å; W8-W12 PolarHBondContact O-N 3.49Å; W9-W12 PolarHBondContact O-N 2.89Å; V10-W12 VanDerWaalsContact C-N 3.34Å; V10-W12 PolarHBondContact O-N 3.48Å; W12-S15 PolarHBondContact O-N 3.49Å; W12-T16 WeakPolarHBondContact O-CB 3.09Å; W12-T16 PolarHBondContact O-N 2.87Å; W12-T16 PolarHBondContact O-OG1 2.85Å
13	T	86.4	Confident	80.6	Confident	50 Å²	50	109.1 Å²	109.1	31%	0.307	53%	0.527	S	S	.	.	H	α-helix	trans	-64.3	-42.4	177.3	49	0	0	0	0	112	W9 V10 T16 W17	W9-T13 HydrophobicContact CD2-CG2 4.14Å; W9-T13 HydrophobicContact CH2-CG2 4.42Å; W9-T13 HydrophobicContact CZ2-CG2 3.94Å; W9-T13 WeakPolarHBondContact O-CG2 3.21Å; W9-T13 PolarHBondContact O-N 2.83Å; W9-T13 PolarHBondContact O-OG1 3.34Å; V10-T13 WeakPolarHBondContact CA-OG1 3.37Å; V10-T13 PolarHBondContact O-N 2.82Å; V10-T13 PolarHBondContact O-OG1 3.46Å; T13-T16 PolarHBondContact O-N 3.49Å; T13-W17 WeakPolarHBondContact O-CB 3.41Å; T13-W17 PolarHBondContact O-N 3.49Å
14	T	83	Confident	80.6	Confident	76 Å²	76	108.9 Å²	108.9	47%	0.466	52%	0.519	S	S	.	.	H	α-helix	trans	-65.8	-41.2	178.7	-44.4	0	0	0	0	112.1	V10 I11 S18	V10-T14 WeakPolarHBondContact O-CB 3.41Å; V10-T14 PolarHBondContact O-N 2.78Å; V10-T14 PolarHBondContact O-OG1 2.82Å; I11-T14 PolarHBondContact O-N 3.36Å; T14-S18 WeakPolarHBondContact O-CB 3.26Å; T14-S18 PolarHBondContact O-N 2.61Å; T14-S18 PolarHBondContact O-OG 3.43Å
15	S	78.7	Confident	80.6	Confident	64 Å²	64	104 Å²	104	45%	0.448	51%	0.507	S	S	.	.	H	α-helix	trans	-65.4	-40.6	175.8	-69.1	0	0	0	0	112.1	I11 W12 S18 T19	I11-S15 WeakPolarHBondContact O-CB 3.12Å; I11-S15 PolarHBondContact O-N 3.47Å; I11-S15 PolarHBondContact O-OG 3.44Å; I11-S15 VanDerWaalsContact O-OG 3.12Å; W12-S15 PolarHBondContact O-N 3.49Å; S15-S18 PolarHBondContact O-N 3.42Å; S15-T19 WeakPolarHBondContact O-CB 3.36Å; S15-T19 PolarHBondContact O-N 2.87Å; S15-T19 PolarHBondContact O-OG1 3.36Å
16	T	80.9	Confident	80.3	Confident	66 Å²	66	104.1 Å²	104.1	41%	0.405	50%	0.503	S	S	.	.	H	α-helix	trans	-65.6	-47.2	179.2	-50.6	0	0	0	0	110.3	W12 T13 S18 T19 T20	W12-T16 WeakPolarHBondContact O-CB 3.09Å; W12-T16 PolarHBondContact O-N 2.87Å; W12-T16 PolarHBondContact O-OG1 2.85Å; T13-T16 PolarHBondContact O-N 3.49Å; T16-S18 PolarHBondContact O-N 2.96Å; T16-T19 PolarHBondContact O-N 2.86Å; T16-T20 PolarHBondContact O-N 3.43Å; T16-T20 PolarHBondContact O-OG1 3.45Å; T16-T20 VanDerWaalsContact O-OG1 3.12Å
17	W	77.8	Confident	79.9	Confident	196 Å²	196	101.9 Å²	101.9	74%	0.742	50%	0.496	S	S	*	.	H	α-helix	trans	-60.4	-43.5	176.2	-171	-71.6	0	0	0	112.5	T13 T19 T20 T21	T13-W17 WeakPolarHBondContact O-CB 3.41Å; T13-W17 PolarHBondContact O-N 3.49Å; W17-T19 VanDerWaalsContact C-N 3.34Å; W17-T19 PolarHBondContact O-N 3.31Å; W17-T20 PolarHBondContact O-N 3.47Å; W17-T21 VanDerWaalsContact CD1-OG1 3.31Å; W17-T21 PolarHBondContact NE1-OG1 2.84Å; W17-T21 WeakPolarHBondContact O-CB 3.19Å; W17-T21 PolarHBondContact O-N 2.94Å; W17-T21 PolarHBondContact O-OG1 3.01Å
18	S	76.3	Confident	79.2	Confident	54 Å²	54	98.7 Å²	98.7	38%	0.378	49%	0.492	S	S	.	.	H	α-helix	trans	-62	-43.5	177.1	-62.3	0	0	0	0	111.1	T14 S15 T16 T21 I22	T14-S18 WeakPolarHBondContact O-CB 3.26Å; T14-S18 PolarHBondContact O-N 2.61Å; T14-S18 PolarHBondContact O-OG 3.43Å; S15-S18 PolarHBondContact O-N 3.42Å; T16-S18 PolarHBondContact O-N 2.96Å; S18-T21 PolarHBondContact O-N 3Å; S18-I22 WeakPolarHBondContact O-CB 3.4Å; S18-I22 WeakPolarHBondContact O-CD1 3.21Å; S18-I22 WeakPolarHBondContact O-CG1 3.43Å; S18-I22 PolarHBondContact O-N 3.36Å
19	T	75.5	Confident	78.4	Confident	84 Å²	84	95.5 Å²	95.5	52%	0.515	49%	0.486	S	S	.	.	H	α-helix	trans	-63.1	-44.2	177.2	-47.4	0	0	0	0	111.4	S15 T16 W17 T21 I22 N23	S15-T19 WeakPolarHBondContact O-CB 3.36Å; S15-T19 PolarHBondContact O-N 2.87Å; S15-T19 PolarHBondContact O-OG1 3.36Å; T16-T19 PolarHBondContact O-N 2.86Å; W17-T19 VanDerWaalsContact C-N 3.34Å; W17-T19 PolarHBondContact O-N 3.31Å; T19-T21 PolarHBondContact O-N 3.12Å; T19-I22 PolarHBondContact O-N 2.69Å; T19-N23 WeakPolarHBondContact O-CB 3.29Å; T19-N23 PolarHBondContact O-N 2.92Å
20	T	74.8	Confident	77.1	Confident	73 Å²	73	93.6 Å²	93.6	45%	0.448	48%	0.483	S	S	.	.	H	α-helix	trans	-64.1	-40	176.3	-56.6	0	0	0	0	111.9	T16 W17 N23 N24	T16-T20 PolarHBondContact O-N 3.43Å; T16-T20 PolarHBondContact O-OG1 3.45Å; T16-T20 VanDerWaalsContact O-OG1 3.12Å; W17-T20 PolarHBondContact O-N 3.47Å; T20-N23 PolarHBondContact O-N 3.44Å; T20-N24 VanDerWaalsContact O-CB 3.29Å; T20-N24 WeakPolarHBondContact O-CB 3.22Å; T20-N24 VanDerWaalsContact O-CG 3.25Å; T20-N24 PolarHBondContact O-N 2.96Å; T20-N24 PolarHBondContact O-ND2 2.95Å
21	T	76	Confident	75.8	Confident	73 Å²	73	94.8 Å²	94.8	45%	0.448	49%	0.49	S	S	.	.	H	α-helix	trans	-68	-43.8	178.4	-56	0	0	0	0	111	W17 S18 T19 N24 N25	W17-T21 VanDerWaalsContact CD1-OG1 3.31Å; W17-T21 PolarHBondContact NE1-OG1 2.84Å; W17-T21 WeakPolarHBondContact O-CB 3.19Å; W17-T21 PolarHBondContact O-N 2.94Å; W17-T21 PolarHBondContact O-OG1 3.01Å; S18-T21 PolarHBondContact O-N 3Å; T19-T21 PolarHBondContact O-N 3.12Å; T21-N24 PolarHBondContact O-N 3.23Å; T21-N25 WeakPolarHBondContact O-CB 3.39Å; T21-N25 PolarHBondContact O-N 3.36Å
22	I	79	Confident	74.4	Confident	114 Å²	114	94.2 Å²	94.2	59%	0.585	49%	0.491	S	S	*	.	H	α-helix	trans	-64.1	-44.3	176.1	-68.4	164.8	0	0	0	110.3	S18 T19 N25 W26	S18-I22 WeakPolarHBondContact O-CB 3.4Å; S18-I22 WeakPolarHBondContact O-CD1 3.21Å; S18-I22 WeakPolarHBondContact O-CG1 3.43Å; S18-I22 PolarHBondContact O-N 3.36Å; T19-I22 PolarHBondContact O-N 2.69Å; I22-N25 PolarHBondContact O-N 3.12Å; I22-W26 VanDerWaalsContact O-CB 3.22Å; I22-W26 WeakPolarHBondContact O-CB 3.37Å; I22-W26 PolarHBondContact O-N 3.12Å
23	N	75.1	Confident	72.7	Confident	92 Å²	92	91.2 Å²	91.2	49%	0.492	49%	0.49	S	S	.	.	H	α-helix	trans	-63.3	-45.2	176.5	-105.4	-8.8	0	0	0	111.9	T19 T20 N25 W26 I27	T19-N23 WeakPolarHBondContact O-CB 3.29Å; T19-N23 PolarHBondContact O-N 2.92Å; T20-N23 PolarHBondContact O-N 3.44Å; N23-N25 VanDerWaalsContact C-N 3.33Å; N23-N25 PolarHBondContact O-N 2.95Å; N23-W26 PolarHBondContact O-N 2.95Å; N23-I27 WeakPolarHBondContact O-CB 3.48Å; N23-I27 WeakPolarHBondContact O-CD1 3.39Å; N23-I27 WeakPolarHBondContact O-CG1 3.35Å; N23-I27 PolarHBondContact O-N 3.47Å
24	N	73.4	Confident	71.1	Confident	90 Å²	90	96.7 Å²	96.7	48%	0.481	51%	0.512	S	S	.	.	H	α-helix	trans	-64.6	-39.1	177.8	-75.9	-14.7	0	0	0	111.6	T20 T21 I27 L28	T20-N24 VanDerWaalsContact O-CB 3.29Å; T20-N24 WeakPolarHBondContact O-CB 3.22Å; T20-N24 VanDerWaalsContact O-CG 3.25Å; T20-N24 PolarHBondContact O-N 2.96Å; T20-N24 PolarHBondContact O-ND2 2.95Å; T21-N24 PolarHBondContact O-N 3.23Å; N24-I27 PolarHBondContact O-N 3.47Å; N24-L28 WeakPolarHBondContact O-CB 3.35Å; N24-L28 PolarHBondContact O-N 2.93Å
25	N	76.9	Confident	69.6	Low	90 Å²	90	97.8 Å²	97.8	48%	0.481	52%	0.522	S	S	.	.	H	α-helix	trans	-70	-38.4	177	-158.3	32.8	0	0	0	111.5	T21 I22 N23 L28 I29	T21-N25 WeakPolarHBondContact O-CB 3.39Å; T21-N25 PolarHBondContact O-N 3.36Å; I22-N25 PolarHBondContact O-N 3.12Å; N23-N25 VanDerWaalsContact C-N 3.33Å; N23-N25 PolarHBondContact O-N 2.95Å; N25-L28 PolarHBondContact O-N 3.31Å; N25-I29 WeakPolarHBondContact O-CB 3.5Å; N25-I29 WeakPolarHBondContact O-CD1 3.48Å; N25-I29 WeakPolarHBondContact O-CG1 3.46Å; N25-I29 PolarHBondContact O-N 2.74Å
26	W	71.2	Confident	68.4	Low	156 Å²	156	103.5 Å²	103.5	59%	0.591	54%	0.539	S	S	*	.	H	α-helix	trans	-62.8	-46.4	173.1	-175.2	-89.3	0	0	0	111.1	I22 N23 L28 I29 H30	I22-W26 VanDerWaalsContact O-CB 3.22Å; I22-W26 WeakPolarHBondContact O-CB 3.37Å; I22-W26 PolarHBondContact O-N 3.12Å; N23-W26 PolarHBondContact O-N 2.95Å; W26-L28 PolarHBondContact O-N 2.87Å; W26-I29 PolarHBondContact O-N 3.15Å; W26-H30 AromaticContact CD1-CD2 3.67Å; W26-H30 AromaticContact CD2-CD2 3.47Å; W26-H30 VanDerWaalsContact CD2-CD2 3.47Å; W26-H30 AromaticContact CD2-NE2 3.53Å; W26-H30 AromaticContact CE2-CD2 3.3Å; W26-H30 AromaticContact CE2-CE1 3.85Å; W26-H30 AromaticContact CE2-NE2 3.13Å; W26-H30 AromaticContact CE3-NE2 3.82Å; W26-H30 AromaticContact CG-CD2 3.74Å; W26-H30 AromaticContact CH2-NE2 3.41Å; W26-H30 WeakPolarHBondContact CH2-NE2 3.41Å; W26-H30 AromaticContact CZ2-CD2 3.8Å; W26-H30 AromaticContact CZ2-CE1 3.58Å; W26-H30 AromaticContact CZ2-NE2 3.09Å; W26-H30 WeakPolarHBondContact CZ2-NE2 3.4Å; W26-H30 AromaticContact CZ3-NE2 3.76Å; W26-H30 AromaticContact NE1-CD2 3.4Å; W26-H30 PolarHBondContact NE1-CD2 3.25Å; W26-H30 AromaticContact NE1-CG 3.86Å; W26-H30 AromaticContact NE1-NE2 3.66Å; W26-H30 VanDerWaalsContact O-CB 3.26Å; W26-H30 WeakPolarHBondContact O-CB 3.35Å; W26-H30 PolarHBondContact O-CD2 3.44Å; W26-H30 PolarHBondContact O-N 3.43Å
27	I	74.9	Confident	66.7	Low	88 Å²	88	109.6 Å²	109.6	45%	0.451	56%	0.56	S	S	.	*	H	α-helix	trans	-61.3	-45.4	175.6	-68.6	162.8	0	0	0	110.2	N23 N24 I29 H30 V31	N23-I27 WeakPolarHBondContact O-CB 3.48Å; N23-I27 WeakPolarHBondContact O-CD1 3.39Å; N23-I27 WeakPolarHBondContact O-CG1 3.35Å; N23-I27 PolarHBondContact O-N 3.47Å; N24-I27 PolarHBondContact O-N 3.47Å; I27-I29 PolarHBondContact O-N 2.97Å; I27-H30 PolarHBondContact O-N 3.25Å; I27-V31 HydrophobicContact CG2-CG2 3.8Å; I27-V31 WeakPolarHBondContact O-CB 3.38Å; I27-V31 WeakPolarHBondContact O-CG2 3.47Å; I27-V31 PolarHBondContact O-N 3.44Å
28	L	68.4	Low	64.9	Low	106 Å²	106	109.4 Å²	109.4	56%	0.555	57%	0.567	S	S	*	*	H	α-helix	trans	-59.6	-47.5	175.5	-89.4	154.5	0	0	0	112	N24 N25 W26 H30 V32	N24-L28 WeakPolarHBondContact O-CB 3.35Å; N24-L28 PolarHBondContact O-N 2.93Å; N25-L28 PolarHBondContact O-N 3.31Å; W26-L28 PolarHBondContact O-N 2.87Å; L28-H30 VanDerWaalsContact C-N 3.34Å; L28-H30 PolarHBondContact O-N 3.42Å; L28-V32 HydrophobicContact CD2-CG2 4.47Å; L28-V32 WeakPolarHBondContact O-CB 3.39Å; L28-V32 WeakPolarHBondContact O-CG2 3.25Å; L28-V32 PolarHBondContact O-N 2.95Å
29	I	69.2	Low	63.4	Low	100 Å²	100	119.5 Å²	119.5	51%	0.513	61%	0.608	S	S	.	*	H	α-helix	trans	-70.1	-29.5	-178.9	-65.6	164.2	0	0	0	112.1	N25 W26 I27 P33	N25-I29 WeakPolarHBondContact O-CB 3.5Å; N25-I29 WeakPolarHBondContact O-CD1 3.48Å; N25-I29 WeakPolarHBondContact O-CG1 3.46Å; N25-I29 PolarHBondContact O-N 2.74Å; W26-I29 PolarHBondContact O-N 3.15Å; I27-I29 PolarHBondContact O-N 2.97Å; I29-P33 WeakPolarHBondContact O-CD 3.48Å; I29-P33 WeakPolarHBondContact O-CG 3.48Å
30	H	59.6	Low	62.8	Low	98 Å²	98	121.3 Å²	121.3	45%	0.454	61%	0.613	S	S	.	*	H	α-helix	trans	-90.3	-29.8	179.5	-81.4	-91.9	0	0	0	113.8	W26 I27 L28 P33	W26-H30 AromaticContact CD1-CD2 3.67Å; W26-H30 AromaticContact CD2-CD2 3.47Å; W26-H30 VanDerWaalsContact CD2-CD2 3.47Å; W26-H30 AromaticContact CD2-NE2 3.53Å; W26-H30 AromaticContact CE2-CD2 3.3Å; W26-H30 AromaticContact CE2-CE1 3.85Å; W26-H30 AromaticContact CE2-NE2 3.13Å; W26-H30 AromaticContact CE3-NE2 3.82Å; W26-H30 AromaticContact CG-CD2 3.74Å; W26-H30 AromaticContact CH2-NE2 3.41Å; W26-H30 WeakPolarHBondContact CH2-NE2 3.41Å; W26-H30 AromaticContact CZ2-CD2 3.8Å; W26-H30 AromaticContact CZ2-CE1 3.58Å; W26-H30 AromaticContact CZ2-NE2 3.09Å; W26-H30 WeakPolarHBondContact CZ2-NE2 3.4Å; W26-H30 AromaticContact CZ3-NE2 3.76Å; W26-H30 AromaticContact NE1-CD2 3.4Å; W26-H30 PolarHBondContact NE1-CD2 3.25Å; W26-H30 AromaticContact NE1-CG 3.86Å; W26-H30 AromaticContact NE1-NE2 3.66Å; W26-H30 VanDerWaalsContact O-CB 3.26Å; W26-H30 WeakPolarHBondContact O-CB 3.35Å; W26-H30 PolarHBondContact O-CD2 3.44Å; W26-H30 PolarHBondContact O-N 3.43Å; I27-H30 PolarHBondContact O-N 3.25Å; L28-H30 VanDerWaalsContact C-N 3.34Å; L28-H30 PolarHBondContact O-N 3.42Å; H30-P33 WeakPolarHBondContact O-CD 3.41Å
31	V	60.6	Low	62.2	Low	80 Å²	80	123.8 Å²	123.8	49%	0.485	62%	0.621	S	S	.	*	H	α-helix	trans	-82.4	-37.8	178	176.2	0	0	0	0	111.2	I27 H34 S35	I27-V31 HydrophobicContact CG2-CG2 3.8Å; I27-V31 WeakPolarHBondContact O-CB 3.38Å; I27-V31 WeakPolarHBondContact O-CG2 3.47Å; I27-V31 PolarHBondContact O-N 3.44Å; V31-H34 PolarHBondContact O-N 2.87Å; V31-H34 VanDerWaalsContact O-N 3.09Å; V31-S35 PolarHBondContact O-N 3.4Å
32	V	57.7	Low	61.4	Low	84 Å²	84	126.7 Å²	126.7	51%	0.509	63%	0.631	S	S	.	*	T	Hydrogen-bonded Turn	trans	-60.7	-36.4	179.3	169	0	0	0	0	114.7	L28 H34	L28-V32 HydrophobicContact CD2-CG2 4.47Å; L28-V32 WeakPolarHBondContact O-CB 3.39Å; L28-V32 WeakPolarHBondContact O-CG2 3.25Å; L28-V32 PolarHBondContact O-N 2.95Å; V32-H34 VanDerWaalsContact C-N 3.33Å; V32-H34 PolarHBondContact O-N 3.49Å
33	P	52	Low	60.4	Low	82 Å²	82	127.4 Å²	127.4	53%	0.532	63%	0.634	S	S	.	*	T	Hydrogen-bonded Turn	trans	-76.8	-16.2	174.7	28.2	-34	0	0	0	113.5	I29 H30	I29-P33 WeakPolarHBondContact O-CD 3.48Å; I29-P33 WeakPolarHBondContact O-CG 3.48Å; H30-P33 WeakPolarHBondContact O-CD 3.41Å
34	H	51.5	Low	59.5	Low	165 Å²	165	129.6 Å²	129.6	76%	0.764	64%	0.643	S	S	*	*	G	3₁₀ helix	trans	-83.9	-20	177.5	-150.7	-78.8	0	0	0	113	V31 V32 K36	V31-H34 PolarHBondContact O-N 2.87Å; V31-H34 VanDerWaalsContact O-N 3.09Å; V32-H34 VanDerWaalsContact C-N 3.33Å; V32-H34 PolarHBondContact O-N 3.49Å; H34-K36 VanDerWaalsContact C-N 3.33Å
35	S	52.4	Low	58.6	Low	98 Å²	98	132.3 Å²	132.3	69%	0.685	65%	0.653	S	S	*	*	G	3₁₀ helix	trans	-84.6	-0.1	175.9	-61.8	0	0	0	0	114.4	V31	V31-S35 PolarHBondContact O-N 3.4Å
36	K	53.5	Low	57.3	Low	184 Å²	184	135.3 Å²	135.3	80%	0.8	67%	0.666	S	S	*	*	G	3₁₀ helix	trans	-105.2	8.7	-176.9	-73.8	-89.2	-175.4	174.1	0	114.5	H34	H34-K36 VanDerWaalsContact C-N 3.33Å
37	K	44.6	Very low	56.2	Low	194 Å²	194	133.7 Å²	133.7	84%	0.843	67%	0.671	S	S	*	*	S	Bend	trans	-121.1	39	-176.6	-104.3	-170	-179.7	-174.8	0	113.9
38	H	41.2	Very low	54.6	Low	192 Å²	192	137.5 Å²	137.5	89%	0.889	69%	0.69	S	S	*	*			trans	-139.9	58.7	175.5	-147.1	-83.1	0	0	0	110.9
39	E	44.7	Very low	53.4	Low	267 Å²	267	140.4 Å²	140.4	100%	1.248	70%	0.702	S	S	*	*			trans	-144.2	0	158.2	-163.8	177.5	139.9	0	0	108.7

Retrieved 39 of 39 residues in 64.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).