A0AA82N7X7_SCHMA Loading...

Uncharacterized protein AlphaSync

AlphaFold DB , UniProt , Accession A0AA82N7X7, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 44 aa.

						>A0AA82N7X7_SCHMA|A0AA82N7X7
MTEGVTPLPLTWNYDLKLLYLGSVFERVHVQGNLALSHCSWRDA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	40.6	Very low	58.1	Low	238 Å²	238	127.7 Å²	127.7	100%	1.172	75%	0.748	S	S	*	*				0	84.5	0	42	-172.1	174	0	0	106.8
2	T	51.1	Low	58.7	Low	132 Å²	132	131.4 Å²	131.4	81%	0.81	74%	0.74	S	S	*	*			trans	-141.8	93.6	-176.9	-42.4	0	0	0	0	106.3
3	E	55.2	Low	59.2	Low	176 Å²	176	128.1 Å²	128.1	82%	0.822	72%	0.719	S	S	*	*			trans	21	97.5	151.9	-50.4	-172.2	120.4	0	0	116	V5	E3-V5 PolarHBondContact O-N 3.14Å
4	G	52.5	Low	59.8	Low	79 Å²	79	128.9 Å²	128.9	81%	0.814	71%	0.707	S	S	*	*			trans	-67.6	95	166.4	0	0	0	0	0	109.8	T6	G4-T6 PolarHBondContact O-N 3.2Å
5	V	63.5	Low	60.6	Low	125 Å²	125	127.5 Å²	127.5	76%	0.758	70%	0.698	S	S	*	*			trans	-77	97.2	164.7	-175.1	0	0	0	0	106.6	E3 P7	E3-V5 PolarHBondContact O-N 3.14Å; V5-P7 WeakPolarHBondContact O-CD 3.46Å
6	T	64.8	Low	61.3	Low	125 Å²	125	127.1 Å²	127.1	77%	0.767	69%	0.694	S	S	*	*			trans	-74.1	108.7	163.5	45.9	0	0	0	0	107.7	G4 L8	G4-T6 PolarHBondContact O-N 3.2Å; T6-L8 PolarHBondContact O-N 2.99Å; T6-L8 VanDerWaalsContact O-N 3.14Å
7	P	61.9	Low	62.1	Low	115 Å²	115	126.6 Å²	126.6	75%	0.747	68%	0.684	S	S	*	*			trans	-63.3	120	168.5	26.3	-31.3	0	0	0	107.6	V5	V5-P7 WeakPolarHBondContact O-CD 3.46Å
8	L	63.8	Low	63	Low	135 Å²	135	126.1 Å²	126.1	71%	0.707	68%	0.68	S	S	*	*			trans	-45.6	140	172.1	-76.7	147.3	0	0	0	109.6	T6 L10 W12	T6-L8 PolarHBondContact O-N 2.99Å; T6-L8 VanDerWaalsContact O-N 3.14Å; L8-L10 PolarHBondContact O-N 3.3Å; L8-W12 HydrophobicContact CD2-CZ3 4.32Å
9	P	61.2	Low	63.6	Low	68 Å²	68	125.3 Å²	125.3	44%	0.442	68%	0.675	S	S	.	*			trans	-60.7	117.8	-173.3	27	-34.5	0	0	0	109	T11 W12	P9-T11 WeakPolarHBondContact CB-OG1 3.1Å; P9-T11 PolarHBondContact O-N 3.41Å; P9-T11 PolarHBondContact O-OG1 3.28Å; P9-W12 PolarHBondContact O-N 3.12Å; P9-W12 VanDerWaalsContact O-N 3.15Å
10	L	62.1	Low	64.2	Low	125 Å²	125	127.7 Å²	127.7	65%	0.654	68%	0.675	S	S	*	*	T	Hydrogen-bonded Turn	trans	-50	-19.9	178.9	-73.1	155.2	0	0	0	112.5	L8 W12 N13 Y14	L8-L10 PolarHBondContact O-N 3.3Å; L10-W12 VanDerWaalsContact C-N 3.29Å; L10-W12 PolarHBondContact O-N 3.01Å; L10-N13 PolarHBondContact O-N 3.15Å; L10-N13 VanDerWaalsContact O-N 3.12Å; L10-Y14 HydrophobicContact CB-CD2 4.3Å; L10-Y14 HydrophobicContact CB-CE2 3.81Å; L10-Y14 WeakPolarHBondContact O-CD2 3Å; L10-Y14 PolarHBondContact O-N 3.12Å
11	T	62.7	Low	64.6	Low	87 Å²	87	125.8 Å²	125.8	53%	0.534	67%	0.665	S	S	.	*	H	α-helix	trans	-52.1	-39.4	175.8	58	0	0	0	0	113.7	P9 N13 Y14 D15	P9-T11 WeakPolarHBondContact CB-OG1 3.1Å; P9-T11 PolarHBondContact O-N 3.41Å; P9-T11 PolarHBondContact O-OG1 3.28Å; T11-N13 VanDerWaalsContact C-N 3.35Å; T11-N13 PolarHBondContact O-N 3.48Å; T11-Y14 PolarHBondContact O-N 3.47Å; T11-D15 PolarHBondContact O-N 2.84Å; T11-D15 VanDerWaalsContact O-N 3.12Å
12	W	64.6	Low	66.1	Low	172 Å²	172	116 Å²	116	65%	0.652	63%	0.625	S	S	*	*	H	α-helix	trans	-69.9	-32.5	-180	-67.6	-8.1	0	0	0	112.5	L8 P9 L10 L16	L8-W12 HydrophobicContact CD2-CZ3 4.32Å; P9-W12 PolarHBondContact O-N 3.12Å; P9-W12 VanDerWaalsContact O-N 3.15Å; L10-W12 VanDerWaalsContact C-N 3.29Å; L10-W12 PolarHBondContact O-N 3.01Å; W12-L16 WeakPolarHBondContact O-CD1 3.35Å; W12-L16 PolarHBondContact O-N 3.3Å
13	N	65.3	Low	66.9	Low	88 Å²	88	111.6 Å²	111.6	47%	0.471	60%	0.6	S	S	.	*	H	α-helix	trans	-71	-37.3	177	-165.4	-88	0	0	0	111.7	L10 T11 K17	L10-N13 PolarHBondContact O-N 3.15Å; L10-N13 VanDerWaalsContact O-N 3.12Å; T11-N13 VanDerWaalsContact C-N 3.35Å; T11-N13 PolarHBondContact O-N 3.48Å; N13-K17 WeakPolarHBondContact O-CG 3.48Å; N13-K17 PolarHBondContact O-N 2.85Å; N13-K17 WeakPolarHBondContact OD1-CE 3.37Å; N13-K17 PolarHBondContact OD1-NZ 2.79Å; N13-K17 VanDerWaalsContact OD1-NZ 3.09Å
14	Y	67.9	Low	67.5	Low	140 Å²	140	105.9 Å²	105.9	55%	0.549	58%	0.577	S	S	.	*	H	α-helix	trans	-66.8	-40.4	176.2	-69.2	-69.1	0	0	0	112	L10 T11 K17 L18	L10-Y14 HydrophobicContact CB-CD2 4.3Å; L10-Y14 HydrophobicContact CB-CE2 3.81Å; L10-Y14 WeakPolarHBondContact O-CD2 3Å; L10-Y14 PolarHBondContact O-N 3.12Å; T11-Y14 PolarHBondContact O-N 3.47Å; Y14-K17 PolarHBondContact O-N 3.41Å; Y14-L18 WeakPolarHBondContact O-CG 3.39Å; Y14-L18 PolarHBondContact O-N 3.36Å
15	D	71.3	Confident	68.2	Low	108 Å²	108	108.7 Å²	108.7	58%	0.578	57%	0.567	S	S	*	*	H	α-helix	trans	-63.4	-46.7	-179.9	-162.8	-96.1	0	0	0	112.1	T11 K17 L18 L19	T11-D15 PolarHBondContact O-N 2.84Å; T11-D15 VanDerWaalsContact O-N 3.12Å; D15-K17 VanDerWaalsContact C-N 3.32Å; D15-K17 PolarHBondContact O-N 3.19Å; D15-L18 PolarHBondContact O-N 3.28Å; D15-L19 WeakPolarHBondContact O-CB 3.45Å; D15-L19 PolarHBondContact O-N 2.94Å
16	L	72.5	Confident	68.3	Low	121 Å²	121	109.3 Å²	109.3	63%	0.634	56%	0.561	S	S	*	*	H	α-helix	trans	-60.4	-38.7	174.5	-96.4	127.6	0	0	0	113	W12 Y20	W12-L16 WeakPolarHBondContact O-CD1 3.35Å; W12-L16 PolarHBondContact O-N 3.3Å; L16-Y20 WeakPolarHBondContact O-CB 3.42Å; L16-Y20 PolarHBondContact O-N 3.39Å
17	K	75.6	Confident	68.2	Low	118 Å²	118	111.5 Å²	111.5	51%	0.513	56%	0.556	S	S	.	*	H	α-helix	trans	-66.3	-42.5	175.8	-78.5	176.5	178.3	168.8	0	111.7	N13 Y14 D15 Y20 L21	N13-K17 WeakPolarHBondContact O-CG 3.48Å; N13-K17 PolarHBondContact O-N 2.85Å; N13-K17 WeakPolarHBondContact OD1-CE 3.37Å; N13-K17 PolarHBondContact OD1-NZ 2.79Å; N13-K17 VanDerWaalsContact OD1-NZ 3.09Å; Y14-K17 PolarHBondContact O-N 3.41Å; D15-K17 VanDerWaalsContact C-N 3.32Å; D15-K17 PolarHBondContact O-N 3.19Å; K17-Y20 PolarHBondContact O-N 3.22Å; K17-L21 WeakPolarHBondContact O-CB 3.42Å; K17-L21 WeakPolarHBondContact O-CD1 3.44Å; K17-L21 WeakPolarHBondContact O-CG 3.41Å; K17-L21 PolarHBondContact O-N 3.09Å
18	L	76.8	Confident	68.3	Low	118 Å²	118	110.6 Å²	110.6	62%	0.618	55%	0.547	S	S	*	.	H	α-helix	trans	-65.4	-41	176.6	-73.3	171	0	0	0	111.5	Y14 D15 L21 G22	Y14-L18 WeakPolarHBondContact O-CG 3.39Å; Y14-L18 PolarHBondContact O-N 3.36Å; D15-L18 PolarHBondContact O-N 3.28Å; L18-L21 PolarHBondContact O-N 2.83Å; L18-G22 PolarHBondContact O-N 2.93Å
19	L	75.5	Confident	68.2	Low	111 Å²	111	110.6 Å²	110.6	58%	0.581	54%	0.544	S	S	*	.	H	α-helix	trans	-62.1	-43	174.3	-177.1	66	0	0	0	111.9	D15 S23	D15-L19 WeakPolarHBondContact O-CB 3.45Å; D15-L19 PolarHBondContact O-N 2.94Å; L19-S23 WeakPolarHBondContact O-CB 3.34Å; L19-S23 PolarHBondContact O-N 2.95Å; L19-S23 PolarHBondContact O-OG 3.19Å
20	Y	75.5	Confident	68.2	Low	172 Å²	172	111.9 Å²	111.9	68%	0.675	55%	0.55	S	S	*	.	H	α-helix	trans	-65.7	-46.8	176.1	-175.1	-98.2	0	0	0	111.6	L16 K17 S23 V24	L16-Y20 WeakPolarHBondContact O-CB 3.42Å; L16-Y20 PolarHBondContact O-N 3.39Å; K17-Y20 PolarHBondContact O-N 3.22Å; Y20-S23 PolarHBondContact O-N 3.04Å; Y20-V24 HydrophobicContact CD1-CG2 4.06Å; Y20-V24 HydrophobicContact CE1-CG2 3.72Å; Y20-V24 HydrophobicContact CE2-CG2 4.37Å; Y20-V24 WeakPolarHBondContact O-CB 3.08Å; Y20-V24 VanDerWaalsContact O-CG2 3.25Å; Y20-V24 WeakPolarHBondContact O-CG2 3.13Å; Y20-V24 PolarHBondContact O-N 2.79Å
21	L	72.1	Confident	68	Low	88 Å²	88	112.7 Å²	112.7	46%	0.461	55%	0.55	S	S	.	*	H	α-helix	trans	-58.3	-48.9	174.9	-82.6	156.4	0	0	0	110.9	K17 L18 S23 V24 F25	K17-L21 WeakPolarHBondContact O-CB 3.42Å; K17-L21 WeakPolarHBondContact O-CD1 3.44Å; K17-L21 WeakPolarHBondContact O-CG 3.41Å; K17-L21 PolarHBondContact O-N 3.09Å; L18-L21 PolarHBondContact O-N 2.83Å; L21-S23 PolarHBondContact O-N 3.5Å; L21-V24 PolarHBondContact O-N 3.49Å; L21-F25 HydrophobicContact CD2-CE2 4.22Å; L21-F25 WeakPolarHBondContact O-CB 3.45Å; L21-F25 VanDerWaalsContact O-CD2 3.24Å; L21-F25 WeakPolarHBondContact O-CD2 3.47Å; L21-F25 PolarHBondContact O-N 3.29Å
22	G	71.5	Confident	67.8	Low	34 Å²	34	110 Å²	110	35%	0.351	54%	0.541	S	S	.	.	H	α-helix	trans	-57	-46.5	176.3	0	0	0	0	0	112.1	L18 V24 F25 E26	L18-G22 PolarHBondContact O-N 2.93Å; G22-V24 VanDerWaalsContact C-N 3.34Å; G22-V24 PolarHBondContact O-N 2.73Å; G22-F25 PolarHBondContact O-N 3.49Å; G22-E26 WeakPolarHBondContact O-CB 3.45Å; G22-E26 WeakPolarHBondContact O-CG 3.25Å; G22-E26 PolarHBondContact O-N 3.41Å
23	S	67.8	Low	67.4	Low	39 Å²	39	106 Å²	106	27%	0.273	53%	0.532	S	S	.	.	H	α-helix	trans	-66.3	-32.7	178	-60.3	0	0	0	0	113.5	L19 Y20 L21 R27	L19-S23 WeakPolarHBondContact O-CB 3.34Å; L19-S23 PolarHBondContact O-N 2.95Å; L19-S23 PolarHBondContact O-OG 3.19Å; Y20-S23 PolarHBondContact O-N 3.04Å; L21-S23 PolarHBondContact O-N 3.5Å; S23-R27 WeakPolarHBondContact O-CB 3.06Å; S23-R27 PolarHBondContact O-N 3.43Å
24	V	69.8	Low	66.7	Low	55 Å²	55	107.4 Å²	107.4	33%	0.333	54%	0.539	S	S	.	.	H	α-helix	trans	-73.7	-43.9	174.5	171	0	0	0	0	109.9	Y20 L21 G22 E26 R27 V28	Y20-V24 HydrophobicContact CD1-CG2 4.06Å; Y20-V24 HydrophobicContact CE1-CG2 3.72Å; Y20-V24 HydrophobicContact CE2-CG2 4.37Å; Y20-V24 WeakPolarHBondContact O-CB 3.08Å; Y20-V24 VanDerWaalsContact O-CG2 3.25Å; Y20-V24 WeakPolarHBondContact O-CG2 3.13Å; Y20-V24 PolarHBondContact O-N 2.79Å; L21-V24 PolarHBondContact O-N 3.49Å; G22-V24 VanDerWaalsContact C-N 3.34Å; G22-V24 PolarHBondContact O-N 2.73Å; V24-E26 VanDerWaalsContact C-N 3.35Å; V24-E26 PolarHBondContact O-N 2.78Å; V24-R27 PolarHBondContact O-N 3.3Å; V24-V28 HydrophobicContact CG1-CG2 4.25Å; V24-V28 WeakPolarHBondContact O-CB 3Å; V24-V28 VanDerWaalsContact O-CG2 3.26Å; V24-V28 WeakPolarHBondContact O-CG2 3.24Å; V24-V28 PolarHBondContact O-N 2.73Å
25	F	65.7	Low	66	Low	139 Å²	139	103.6 Å²	103.6	61%	0.61	54%	0.536	S	S	*	.	H	α-helix	trans	-60.9	-43.7	174.4	-91.6	-76.8	0	0	0	111	L21 G22 R27 V28 H29	L21-F25 HydrophobicContact CD2-CE2 4.22Å; L21-F25 WeakPolarHBondContact O-CB 3.45Å; L21-F25 VanDerWaalsContact O-CD2 3.24Å; L21-F25 WeakPolarHBondContact O-CD2 3.47Å; L21-F25 PolarHBondContact O-N 3.29Å; G22-F25 PolarHBondContact O-N 3.49Å; F25-R27 PolarHBondContact O-N 2.85Å; F25-V28 PolarHBondContact O-N 2.97Å; F25-H29 WeakPolarHBondContact O-CB 3.07Å; F25-H29 PolarHBondContact O-N 2.73Å
26	E	65.3	Low	65.1	Low	137 Å²	137	104.2 Å²	104.2	64%	0.64	54%	0.539	S	S	*	.	H	α-helix	trans	-63.3	-41.2	173.9	-75.3	-167.4	131.6	0	0	111.4	G22 V24 H29 V30	G22-E26 WeakPolarHBondContact O-CB 3.45Å; G22-E26 WeakPolarHBondContact O-CG 3.25Å; G22-E26 PolarHBondContact O-N 3.41Å; V24-E26 VanDerWaalsContact C-N 3.35Å; V24-E26 PolarHBondContact O-N 2.78Å; E26-H29 PolarHBondContact O-N 3.2Å; E26-V30 WeakPolarHBondContact O-CA 3.46Å; E26-V30 WeakPolarHBondContact O-CB 3.48Å; E26-V30 WeakPolarHBondContact O-CG2 3.3Å; E26-V30 PolarHBondContact O-N 2.89Å
27	R	63.4	Low	64.1	Low	172 Å²	172	102.1 Å²	102.1	65%	0.649	53%	0.534	S	S	*	.	H	α-helix	trans	-64.9	-40.4	174.6	-88.7	-176.2	-108.1	-133.8	-4.5	113.5	S23 V24 F25 Q31	S23-R27 WeakPolarHBondContact O-CB 3.06Å; S23-R27 PolarHBondContact O-N 3.43Å; V24-R27 PolarHBondContact O-N 3.3Å; F25-R27 PolarHBondContact O-N 2.85Å; R27-Q31 VanDerWaalsContact O-CB 3.28Å; R27-Q31 WeakPolarHBondContact O-CB 3.4Å; R27-Q31 PolarHBondContact O-N 2.77Å
28	V	64.5	Low	63.2	Low	95 Å²	95	104.6 Å²	104.6	58%	0.576	55%	0.547	S	S	*	.	H	α-helix	trans	-71.8	-39.9	178.7	173.2	0	0	0	0	110.5	V24 F25 G32	V24-V28 HydrophobicContact CG1-CG2 4.25Å; V24-V28 WeakPolarHBondContact O-CB 3Å; V24-V28 VanDerWaalsContact O-CG2 3.26Å; V24-V28 WeakPolarHBondContact O-CG2 3.24Å; V24-V28 PolarHBondContact O-N 2.73Å; F25-V28 PolarHBondContact O-N 2.97Å; V28-G32 WeakPolarHBondContact O-CA 3.15Å; V28-G32 PolarHBondContact O-N 3.49Å
29	H	60.6	Low	62.1	Low	136 Å²	136	103.9 Å²	103.9	63%	0.63	55%	0.551	S	S	*	*	H	α-helix	trans	-72.4	-37.9	177.3	-147.6	121.1	0	0	0	110.7	F25 E26 G32 N33	F25-H29 WeakPolarHBondContact O-CB 3.07Å; F25-H29 PolarHBondContact O-N 2.73Å; E26-H29 PolarHBondContact O-N 3.2Å; H29-G32 PolarHBondContact O-N 2.76Å; H29-N33 WeakPolarHBondContact O-CA 3.43Å; H29-N33 WeakPolarHBondContact O-CB 3.47Å; H29-N33 PolarHBondContact O-N 2.8Å
30	V	60.9	Low	61	Low	94 Å²	94	102.4 Å²	102.4	57%	0.57	55%	0.55	S	S	*	.	H	α-helix	trans	-71.4	-37.2	174.1	173.6	0	0	0	0	110.8	E26 L34	E26-V30 WeakPolarHBondContact O-CA 3.46Å; E26-V30 WeakPolarHBondContact O-CB 3.48Å; E26-V30 WeakPolarHBondContact O-CG2 3.3Å; E26-V30 PolarHBondContact O-N 2.89Å; V30-L34 WeakPolarHBondContact O-CA 3.12Å; V30-L34 WeakPolarHBondContact O-CB 3.48Å; V30-L34 PolarHBondContact O-N 2.74Å
31	Q	59.9	Low	60	Low	142 Å²	142	105.7 Å²	105.7	66%	0.664	56%	0.561	S	S	*	*	H	α-helix	trans	-70.3	-38.6	171.2	-85.9	-175.1	21.5	0	0	112.5	R27 A35	R27-Q31 VanDerWaalsContact O-CB 3.28Å; R27-Q31 WeakPolarHBondContact O-CB 3.4Å; R27-Q31 PolarHBondContact O-N 2.77Å; Q31-A35 WeakPolarHBondContact O-CB 2.96Å; Q31-A35 PolarHBondContact O-N 2.75Å
32	G	57.7	Low	58.9	Low	32 Å²	32	112.8 Å²	112.8	33%	0.33	58%	0.582	S	S	.	*	H	α-helix	trans	-65.3	-40.3	174.5	0	0	0	0	0	111.7	V28 H29 L36	V28-G32 WeakPolarHBondContact O-CA 3.15Å; V28-G32 PolarHBondContact O-N 3.49Å; H29-G32 PolarHBondContact O-N 2.76Å; G32-L36 WeakPolarHBondContact O-CB 3.26Å; G32-L36 WeakPolarHBondContact O-CD1 3.17Å; G32-L36 WeakPolarHBondContact O-CG 3.46Å; G32-L36 PolarHBondContact O-N 2.81Å
33	N	54.9	Low	57.8	Low	87 Å²	87	117.6 Å²	117.6	47%	0.465	60%	0.6	S	S	.	*	H	α-helix	trans	-81.4	-26.6	179.1	-155	9.3	0	0	0	112.3	H29 S37	H29-N33 WeakPolarHBondContact O-CA 3.43Å; H29-N33 WeakPolarHBondContact O-CB 3.47Å; H29-N33 PolarHBondContact O-N 2.8Å; N33-S37 WeakPolarHBondContact O-CA 3.34Å; N33-S37 WeakPolarHBondContact O-CB 3.49Å; N33-S37 PolarHBondContact O-N 2.81Å; N33-S37 PolarHBondContact O-OG 3.14Å
34	L	50.9	Low	56.4	Low	117 Å²	117	123.5 Å²	123.5	61%	0.613	65%	0.651	S	S	*	*	H	α-helix	trans	-73.9	-36.6	168.9	-173.1	67.5	0	0	0	110.8	V30 H38	V30-L34 WeakPolarHBondContact O-CA 3.12Å; V30-L34 WeakPolarHBondContact O-CB 3.48Å; V30-L34 PolarHBondContact O-N 2.74Å; L34-H38 VanDerWaalsContact O-CB 3.3Å; L34-H38 WeakPolarHBondContact O-CB 3.28Å; L34-H38 PolarHBondContact O-N 3.33Å
35	A	54.2	Low	55.7	Low	60 Å²	60	127 Å²	127	50%	0.496	67%	0.667	S	S	.	*	H	α-helix	trans	-67.4	-39.9	171.9	0	0	0	0	0	111.7	Q31 H38 C39	Q31-A35 WeakPolarHBondContact O-CB 2.96Å; Q31-A35 PolarHBondContact O-N 2.75Å; A35-H38 PolarHBondContact O-N 3.24Å; A35-C39 PolarHBondContact O-N 3.49Å
36	L	51.2	Low	55.2	Low	122 Å²	122	126.3 Å²	126.3	64%	0.639	67%	0.67	S	S	*	*	H	α-helix	trans	-74.9	-31.3	174.7	-69.5	168	0	0	0	112.9	G32 H38 C39	G32-L36 WeakPolarHBondContact O-CB 3.26Å; G32-L36 WeakPolarHBondContact O-CD1 3.17Å; G32-L36 WeakPolarHBondContact O-CG 3.46Å; G32-L36 PolarHBondContact O-N 2.81Å; L36-H38 VanDerWaalsContact C-N 3.28Å; L36-H38 PolarHBondContact O-N 3.22Å; L36-C39 WeakPolarHBondContact O-CB 3.44Å; L36-C39 PolarHBondContact O-N 3.43Å
37	S	53.3	Low	54.7	Low	77 Å²	77	125.7 Å²	125.7	54%	0.538	67%	0.671	S	S	.	*	H	α-helix	trans	-75.7	-15.4	172.4	-63.8	0	0	0	0	113.1	N33	N33-S37 WeakPolarHBondContact O-CA 3.34Å; N33-S37 WeakPolarHBondContact O-CB 3.49Å; N33-S37 PolarHBondContact O-N 2.81Å; N33-S37 PolarHBondContact O-OG 3.14Å
38	H	56.2	Low	54.1	Low	170 Å²	170	123 Å²	123	79%	0.787	67%	0.673	S	S	*	*	S	Bend	trans	-93.2	-7.6	169.9	-147.1	-153	0	0	0	112.5	L34 A35 L36 S40	L34-H38 VanDerWaalsContact O-CB 3.3Å; L34-H38 WeakPolarHBondContact O-CB 3.28Å; L34-H38 PolarHBondContact O-N 3.33Å; A35-H38 PolarHBondContact O-N 3.24Å; L36-H38 VanDerWaalsContact C-N 3.28Å; L36-H38 PolarHBondContact O-N 3.22Å; H38-S40 PolarHBondContact O-N 2.91Å; H38-S40 VanDerWaalsContact O-N 3.14Å
39	C	53.6	Low	53.5	Low	102 Å²	102	124.8 Å²	124.8	69%	0.689	68%	0.679	S	S	*	*			trans	-83.5	63.3	160.6	-69.8	0	0	0	0	109.7	A35 L36	A35-C39 PolarHBondContact O-N 3.49Å; L36-C39 WeakPolarHBondContact O-CB 3.44Å; L36-C39 PolarHBondContact O-N 3.43Å
40	S	52.9	Low	53	Low	80 Å²	80	124 Å²	124	56%	0.559	68%	0.682	S	S	*	*	S	Bend	trans	-129.2	128.4	160.3	-75.1	0	0	0	0	107.1	H38	H38-S40 PolarHBondContact O-N 2.91Å; H38-S40 VanDerWaalsContact O-N 3.14Å
41	W	53.6	Low	52.5	Low	242 Å²	242	126.1 Å²	126.1	92%	0.917	69%	0.69	S	S	*	*			trans	58.6	74	150.7	84.6	-65	0	0	0	119.6
42	R	48.6	Very low	51.9	Low	236 Å²	236	124.9 Å²	124.9	89%	0.891	69%	0.692	S	S	*	*			trans	-168.3	117.3	146.6	-102.5	-175.5	-166.2	-176.1	1.5	104.9
43	D	48.5	Very low	51.4	Low	136 Å²	136	132.7 Å²	132.7	73%	0.727	72%	0.722	S	S	*	*			cis	-166.3	136.4	37.3	-108.1	-73.7	0	0	0	103
44	A	38.9	Very low	51.1	Low	163 Å²	163	136.8 Å²	136.8	100%	1.347	75%	0.746	S	S	*	*				45.1	0	67.3	0	0	0	0	0	112.8

Retrieved 44 of 44 residues in 39.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).