A0AA82N810_SCHMA Loading...

Uncharacterized protein AlphaSync

AlphaFold DB , UniProt , Accession A0AA82N810, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 49 aa.

						>A0AA82N810_SCHMA|A0AA82N810
IKDRWEVFMEKQEHEEFWFNFFELILHWLESCYFKGSLWRAALFPSETN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	I	76	Confident	84.7	Confident	163 Å²	163	130.5 Å²	130.5	84%	0.836	60%	0.597	S	S	*	*				0	-49.3	0	-68.4	166.9	0	0	0	110.3	D3 R4 W5	I1-D3 PolarHBondContact O-N 3.37Å; I1-R4 PolarHBondContact O-N 3.02Å; I1-R4 VanDerWaalsContact O-N 3.13Å; I1-W5 PolarHBondContact O-N 3.19Å
2	K	78.2	Confident	84.5	Confident	152 Å²	152	126.1 Å²	126.1	66%	0.661	58%	0.578	S	S	*	*	H	α-helix	trans	-48.1	-52.4	176.6	-168.1	-179.3	175.1	-166.6	0	113.7	R4 W5 E6	K2-R4 VanDerWaalsContact C-N 3.26Å; K2-R4 PolarHBondContact O-N 3.33Å; K2-W5 WeakPolarHBondContact O-CB 3.45Å; K2-W5 PolarHBondContact O-N 3.13Å; K2-E6 VanDerWaalsContact CE-OE1 3.25Å; K2-E6 WeakPolarHBondContact CE-OE1 3.25Å; K2-E6 PolarHBondContact O-N 2.93Å; K2-E6 VanDerWaalsContact O-N 3.12Å
3	D	86.9	Confident	84.7	Confident	115 Å²	115	125.7 Å²	125.7	62%	0.615	58%	0.577	S	S	*	*	H	α-helix	trans	-61.7	-31.1	-178.4	-45.6	-7.4	0	0	0	113.6	I1 V7	I1-D3 PolarHBondContact O-N 3.37Å; D3-V7 WeakPolarHBondContact O-CG2 3.25Å; D3-V7 PolarHBondContact O-N 3.12Å; D3-V7 VanDerWaalsContact O-N 3.17Å
4	R	84.7	Confident	85	Confident	209 Å²	209	124.6 Å²	124.6	79%	0.789	57%	0.572	S	S	*	*	H	α-helix	trans	-71.2	-34.2	177	-68.8	-174	-178.3	177.6	-0.8	111.9	I1 K2 F8	I1-R4 PolarHBondContact O-N 3.02Å; I1-R4 VanDerWaalsContact O-N 3.13Å; K2-R4 VanDerWaalsContact C-N 3.26Å; K2-R4 PolarHBondContact O-N 3.33Å; R4-F8 WeakPolarHBondContact O-CB 3.44Å; R4-F8 PolarHBondContact O-N 2.84Å; R4-F8 VanDerWaalsContact O-N 3.07Å
5	W	83.7	Confident	85.5	Confident	158 Å²	158	122.2 Å²	122.2	60%	0.598	56%	0.562	S	S	*	*	H	α-helix	trans	-70.2	-40.2	175.3	-81.1	107.6	0	0	0	111.2	I1 K2 F8 M9	I1-W5 PolarHBondContact O-N 3.19Å; K2-W5 WeakPolarHBondContact O-CB 3.45Å; K2-W5 PolarHBondContact O-N 3.13Å; W5-F8 HydrophobicContact CE3-CD1 4.02Å; W5-F8 HydrophobicContact CZ3-CD1 4.05Å; W5-F8 HydrophobicContact CZ3-CE1 4.23Å; W5-F8 PolarHBondContact O-N 3.17Å; W5-M9 WeakPolarHBondContact O-CB 3.43Å; W5-M9 VanDerWaalsContact O-CG 3.25Å; W5-M9 WeakPolarHBondContact O-CG 3.33Å; W5-M9 PolarHBondContact O-N 2.95Å
6	E	89.2	Confident	86	Confident	96 Å²	96	122.1 Å²	122.1	45%	0.449	56%	0.562	S	S	.	*	H	α-helix	trans	-59.8	-50.3	175.9	-70.2	171.6	179.4	0	0	111.2	K2 F8 M9 E10	K2-E6 VanDerWaalsContact CE-OE1 3.25Å; K2-E6 WeakPolarHBondContact CE-OE1 3.25Å; K2-E6 PolarHBondContact O-N 2.93Å; K2-E6 VanDerWaalsContact O-N 3.12Å; E6-F8 VanDerWaalsContact C-N 3.3Å; E6-F8 PolarHBondContact O-N 3.1Å; E6-M9 PolarHBondContact O-N 3.3Å; E6-E10 WeakPolarHBondContact O-CG 3.4Å; E6-E10 PolarHBondContact O-N 3.16Å
7	V	87.3	Confident	86.4	Confident	96 Å²	96	121.9 Å²	121.9	58%	0.582	56%	0.559	S	S	*	*	H	α-helix	trans	-61.1	-37.3	175.9	174.7	0	0	0	0	112.4	D3 K11	D3-V7 WeakPolarHBondContact O-CG2 3.25Å; D3-V7 PolarHBondContact O-N 3.12Å; D3-V7 VanDerWaalsContact O-N 3.17Å; V7-K11 WeakPolarHBondContact O-CB 3.44Å; V7-K11 PolarHBondContact O-N 3.31Å; V7-K11 VanDerWaalsContact O-N 3.16Å
8	F	87.4	Confident	86.7	Confident	99 Å²	99	121.1 Å²	121.1	43%	0.434	55%	0.551	S	S	.	*	H	α-helix	trans	-66	-45.3	176	173.6	-97.5	0	0	0	111.6	R4 W5 E6 K11 Q12	R4-F8 WeakPolarHBondContact O-CB 3.44Å; R4-F8 PolarHBondContact O-N 2.84Å; R4-F8 VanDerWaalsContact O-N 3.07Å; W5-F8 HydrophobicContact CE3-CD1 4.02Å; W5-F8 HydrophobicContact CZ3-CD1 4.05Å; W5-F8 HydrophobicContact CZ3-CE1 4.23Å; W5-F8 PolarHBondContact O-N 3.17Å; E6-F8 VanDerWaalsContact C-N 3.3Å; E6-F8 PolarHBondContact O-N 3.1Å; F8-K11 PolarHBondContact O-N 3.18Å; F8-Q12 HydrophobicContact CD1-CG 4.22Å; F8-Q12 HydrophobicContact CD2-CG 4.46Å; F8-Q12 HydrophobicContact CE1-CG 3.71Å; F8-Q12 HydrophobicContact CE2-CG 3.98Å; F8-Q12 HydrophobicContact CZ-CG 3.58Å; F8-Q12 WeakPolarHBondContact O-CG 3.27Å; F8-Q12 PolarHBondContact O-N 2.84Å
9	M	84.1	Confident	87.1	Confident	93 Å²	93	121.6 Å²	121.6	46%	0.458	55%	0.552	S	S	.	*	H	α-helix	trans	-63.1	-46	178.6	-71.5	-59.3	-61.4	0	0	111.3	W5 E6 K11 Q12 E13	W5-M9 WeakPolarHBondContact O-CB 3.43Å; W5-M9 VanDerWaalsContact O-CG 3.25Å; W5-M9 WeakPolarHBondContact O-CG 3.33Å; W5-M9 PolarHBondContact O-N 2.95Å; E6-M9 PolarHBondContact O-N 3.3Å; M9-K11 VanDerWaalsContact C-N 3.27Å; M9-K11 PolarHBondContact O-N 3.32Å; M9-Q12 PolarHBondContact O-N 3.25Å; M9-Q12 VanDerWaalsContact O-N 3.1Å; M9-E13 WeakPolarHBondContact O-CG 3.4Å; M9-E13 PolarHBondContact O-N 3.07Å
10	E	88.2	Confident	87.6	Confident	129 Å²	129	119.3 Å²	119.3	60%	0.603	54%	0.544	S	S	*	.	H	α-helix	trans	-57.3	-41.6	175.6	-73.5	176.7	174.6	0	0	112	E6 H14	E6-E10 WeakPolarHBondContact O-CG 3.4Å; E6-E10 PolarHBondContact O-N 3.16Å; E10-H14 WeakPolarHBondContact O-CB 3.35Å; E10-H14 PolarHBondContact O-N 3.03Å
11	K	86	Confident	88	Confident	126 Å²	126	117.7 Å²	117.7	55%	0.548	54%	0.536	S	S	.	.	H	α-helix	trans	-65.7	-42.3	176.4	-176.7	178.3	170.8	-175.7	0	111.8	V7 F8 M9 H14 E15	V7-K11 WeakPolarHBondContact O-CB 3.44Å; V7-K11 PolarHBondContact O-N 3.31Å; V7-K11 VanDerWaalsContact O-N 3.16Å; F8-K11 PolarHBondContact O-N 3.18Å; M9-K11 VanDerWaalsContact C-N 3.27Å; M9-K11 PolarHBondContact O-N 3.32Å; K11-H14 PolarHBondContact O-N 2.89Å; K11-E15 WeakPolarHBondContact CE-OE1 3.46Å; K11-E15 IonicContact NZ-OE1 3.34Å; K11-E15 WeakPolarHBondContact O-CG 3.45Å; K11-E15 PolarHBondContact O-N 2.82Å
12	Q	82.2	Confident	89	Confident	77 Å²	77	115.6 Å²	115.6	36%	0.36	52%	0.521	S	S	.	.	H	α-helix	trans	-65.8	-44.7	177.7	-72.5	-60.6	-75.7	0	0	111.7	F8 M9 H14 E15 E16	F8-Q12 HydrophobicContact CD1-CG 4.22Å; F8-Q12 HydrophobicContact CD2-CG 4.46Å; F8-Q12 HydrophobicContact CE1-CG 3.71Å; F8-Q12 HydrophobicContact CE2-CG 3.98Å; F8-Q12 HydrophobicContact CZ-CG 3.58Å; F8-Q12 WeakPolarHBondContact O-CG 3.27Å; F8-Q12 PolarHBondContact O-N 2.84Å; M9-Q12 PolarHBondContact O-N 3.25Å; M9-Q12 VanDerWaalsContact O-N 3.1Å; Q12-H14 VanDerWaalsContact C-N 3.26Å; Q12-H14 PolarHBondContact O-N 3.18Å; Q12-E15 PolarHBondContact NE2-OE2 2.95Å; Q12-E15 PolarHBondContact O-N 3.34Å; Q12-E16 WeakPolarHBondContact O-CB 3.41Å; Q12-E16 PolarHBondContact O-N 2.94Å
13	E	87.2	Confident	89.9	Confident	121 Å²	121	112.4 Å²	112.4	57%	0.565	51%	0.509	S	S	*	.	H	α-helix	trans	-58.7	-40.3	175.5	-73.7	178.8	-178.3	0	0	111.4	M9 F17	M9-E13 WeakPolarHBondContact O-CG 3.4Å; M9-E13 PolarHBondContact O-N 3.07Å; E13-F17 VanDerWaalsContact O-CB 3.27Å; E13-F17 WeakPolarHBondContact O-CB 3.32Å; E13-F17 PolarHBondContact O-N 3.42Å
14	H	89.4	Confident	90.4	Very high	110 Å²	110	112.6 Å²	112.6	51%	0.509	51%	0.509	S	S	.	.	H	α-helix	trans	-67.1	-43.5	175.7	-179.1	-91.9	0	0	0	112.4	E10 K11 Q12 F17 W18	E10-H14 WeakPolarHBondContact O-CB 3.35Å; E10-H14 PolarHBondContact O-N 3.03Å; K11-H14 PolarHBondContact O-N 2.89Å; Q12-H14 VanDerWaalsContact C-N 3.26Å; Q12-H14 PolarHBondContact O-N 3.18Å; H14-F17 PolarHBondContact O-N 2.95Å; H14-W18 AromaticContact CD2-NE1 3.68Å; H14-W18 AromaticContact CE1-CD1 3.28Å; H14-W18 AromaticContact CE1-NE1 2.98Å; H14-W18 PolarHBondContact CE1-NE1 2.95Å; H14-W18 AromaticContact ND1-CD1 3.53Å; H14-W18 AromaticContact ND1-NE1 3.67Å; H14-W18 AromaticContact NE2-CD1 3.65Å; H14-W18 AromaticContact NE2-NE1 2.95Å; H14-W18 PolarHBondContact NE2-NE1 2.98Å; H14-W18 PolarHBondContact O-N 3.33Å; H14-W18 VanDerWaalsContact O-N 3.15Å
15	E	91.7	Very high	90.9	Very high	89 Å²	89	105.5 Å²	105.5	42%	0.416	49%	0.487	S	S	.	.	H	α-helix	trans	-64.2	-43.2	176	-75.4	175.5	178.5	0	0	111.9	K11 Q12 W18 F19	K11-E15 WeakPolarHBondContact CE-OE1 3.46Å; K11-E15 IonicContact NZ-OE1 3.34Å; K11-E15 WeakPolarHBondContact O-CG 3.45Å; K11-E15 PolarHBondContact O-N 2.82Å; Q12-E15 PolarHBondContact NE2-OE2 2.95Å; Q12-E15 PolarHBondContact O-N 3.34Å; E15-W18 PolarHBondContact O-N 3.25Å; E15-F19 WeakPolarHBondContact O-CB 3.38Å; E15-F19 PolarHBondContact O-N 3.47Å
16	E	93.2	Very high	91.5	Very high	121 Å²	121	102.9 Å²	102.9	57%	0.565	48%	0.483	S	S	*	.	H	α-helix	trans	-63.8	-42.1	176.3	-174.9	176.4	179.4	0	0	111.4	Q12 W18 F19 N20	Q12-E16 WeakPolarHBondContact O-CB 3.41Å; Q12-E16 PolarHBondContact O-N 2.94Å; E16-W18 PolarHBondContact O-N 3.34Å; E16-F19 PolarHBondContact O-N 3.44Å; E16-N20 WeakPolarHBondContact O-CB 3.34Å; E16-N20 VanDerWaalsContact O-CG 3.22Å; E16-N20 PolarHBondContact O-N 2.92Å; E16-N20 PolarHBondContact O-ND2 3.43Å
17	F	93.1	Very high	91.7	Very high	119 Å²	119	103 Å²	103	52%	0.522	48%	0.484	S	S	.	.	H	α-helix	trans	-55.4	-50	173.4	170	-94.3	0	0	0	111.7	E13 H14 N20 F21	E13-F17 VanDerWaalsContact O-CB 3.27Å; E13-F17 WeakPolarHBondContact O-CB 3.32Å; E13-F17 PolarHBondContact O-N 3.42Å; H14-F17 PolarHBondContact O-N 2.95Å; F17-N20 PolarHBondContact O-N 3.49Å; F17-F21 WeakPolarHBondContact O-CB 2.93Å; F17-F21 PolarHBondContact O-N 3.02Å
18	W	91.6	Very high	91.9	Very high	107 Å²	107	106.1 Å²	106.1	41%	0.405	49%	0.485	S	S	.	.	H	α-helix	trans	-66.3	-41.1	-179.7	-76.8	112.5	0	0	0	112.2	H14 E15 E16 F21 F22	H14-W18 AromaticContact CD2-NE1 3.68Å; H14-W18 AromaticContact CE1-CD1 3.28Å; H14-W18 AromaticContact CE1-NE1 2.98Å; H14-W18 PolarHBondContact CE1-NE1 2.95Å; H14-W18 AromaticContact ND1-CD1 3.53Å; H14-W18 AromaticContact ND1-NE1 3.67Å; H14-W18 AromaticContact NE2-CD1 3.65Å; H14-W18 AromaticContact NE2-NE1 2.95Å; H14-W18 PolarHBondContact NE2-NE1 2.98Å; H14-W18 PolarHBondContact O-N 3.33Å; H14-W18 VanDerWaalsContact O-N 3.15Å; E15-W18 PolarHBondContact O-N 3.25Å; E16-W18 PolarHBondContact O-N 3.34Å; W18-F21 HydrophobicContact CE3-CD1 4Å; W18-F21 AromaticContact CZ3-CD1 3.98Å; W18-F21 HydrophobicContact CZ3-CD1 3.98Å; W18-F21 HydrophobicContact CZ3-CE1 4.17Å; W18-F21 PolarHBondContact O-N 2.96Å; W18-F22 HydrophobicContact CB-CD2 4.49Å; W18-F22 HydrophobicContact CB-CE2 4.36Å; W18-F22 AromaticContact CE3-CE2 3.99Å; W18-F22 HydrophobicContact CE3-CE2 3.99Å; W18-F22 HydrophobicContact CE3-CZ 4.3Å; W18-F22 WeakPolarHBondContact O-CD2 3.46Å; W18-F22 PolarHBondContact O-N 3.34Å
19	F	95.4	Very high	92.1	Very high	131 Å²	131	105.5 Å²	105.5	58%	0.575	49%	0.486	S	S	*	.	H	α-helix	trans	-56.8	-53.1	175.3	178.1	-93.2	0	0	0	111.2	E15 E16 F21 F22 E23	E15-F19 WeakPolarHBondContact O-CB 3.38Å; E15-F19 PolarHBondContact O-N 3.47Å; E16-F19 PolarHBondContact O-N 3.44Å; F19-F21 VanDerWaalsContact C-N 3.3Å; F19-F21 PolarHBondContact O-N 3.35Å; F19-F22 PolarHBondContact O-N 3.15Å; F19-E23 PolarHBondContact O-N 3.23Å
20	N	96.5	Very high	92.3	Very high	74 Å²	74	106.6 Å²	106.6	40%	0.396	49%	0.49	S	S	.	.	H	α-helix	trans	-61.3	-38.2	179.5	-69.9	-23.6	0	0	0	112.2	E16 F17 L24	E16-N20 WeakPolarHBondContact O-CB 3.34Å; E16-N20 VanDerWaalsContact O-CG 3.22Å; E16-N20 PolarHBondContact O-N 2.92Å; E16-N20 PolarHBondContact O-ND2 3.43Å; F17-N20 PolarHBondContact O-N 3.49Å; N20-L24 WeakPolarHBondContact O-CB 3.05Å; N20-L24 PolarHBondContact O-N 3.08Å
21	F	95.4	Very high	92.2	Very high	86 Å²	86	103.3 Å²	103.3	38%	0.377	48%	0.481	S	S	.	.	H	α-helix	trans	-64.2	-45.2	176.7	176.9	-103.7	0	0	0	112.4	F17 W18 F19 L24 I25	F17-F21 WeakPolarHBondContact O-CB 2.93Å; F17-F21 PolarHBondContact O-N 3.02Å; W18-F21 HydrophobicContact CE3-CD1 4Å; W18-F21 AromaticContact CZ3-CD1 3.98Å; W18-F21 HydrophobicContact CZ3-CD1 3.98Å; W18-F21 HydrophobicContact CZ3-CE1 4.17Å; W18-F21 PolarHBondContact O-N 2.96Å; F19-F21 VanDerWaalsContact C-N 3.3Å; F19-F21 PolarHBondContact O-N 3.35Å; F21-L24 PolarHBondContact O-N 3.02Å; F21-I25 HydrophobicContact CD1-CD1 3.87Å; F21-I25 HydrophobicContact CE1-CD1 3.3Å; F21-I25 HydrophobicContact CE1-CG1 4.45Å; F21-I25 HydrophobicContact CE2-CD1 4.12Å; F21-I25 HydrophobicContact CZ-CD1 3.45Å; F21-I25 VanDerWaalsContact CZ-CD1 3.45Å; F21-I25 HydrophobicContact CZ-CG1 4.39Å; F21-I25 WeakPolarHBondContact O-CG1 3.41Å; F21-I25 PolarHBondContact O-N 2.95Å; F21-I25 VanDerWaalsContact O-N 3.08Å
22	F	97.5	Very high	91.9	Very high	119 Å²	119	100 Å²	100	52%	0.522	47%	0.474	S	S	.	.	H	α-helix	trans	-68.7	-38.1	177.9	-74.5	-60.9	0	0	0	112.3	W18 F19 L24 I25 L26	W18-F22 HydrophobicContact CB-CD2 4.49Å; W18-F22 HydrophobicContact CB-CE2 4.36Å; W18-F22 AromaticContact CE3-CE2 3.99Å; W18-F22 HydrophobicContact CE3-CE2 3.99Å; W18-F22 HydrophobicContact CE3-CZ 4.3Å; W18-F22 WeakPolarHBondContact O-CD2 3.46Å; W18-F22 PolarHBondContact O-N 3.34Å; F19-F22 PolarHBondContact O-N 3.15Å; F22-L24 VanDerWaalsContact C-N 3.33Å; F22-L24 PolarHBondContact O-N 3.44Å; F22-I25 PolarHBondContact O-N 3.46Å; F22-L26 WeakPolarHBondContact O-CG 3.37Å; F22-L26 PolarHBondContact O-N 3.35Å
23	E	97.4	Very high	91.8	Very high	85 Å²	85	105.1 Å²	105.1	40%	0.397	49%	0.491	S	S	.	.	H	α-helix	trans	-60.1	-44.1	174.3	-172.1	175.7	-149.7	0	0	111.3	F19 I25 L26 H27	F19-E23 PolarHBondContact O-N 3.23Å; E23-I25 PolarHBondContact O-N 2.99Å; E23-L26 PolarHBondContact O-N 3.24Å; E23-H27 PolarHBondContact O-CD2 2.91Å; E23-H27 PolarHBondContact O-N 2.97Å
24	L	96.5	Very high	91.3	Very high	119 Å²	119	105.5 Å²	105.5	62%	0.623	49%	0.491	S	S	*	.	H	α-helix	trans	-60.4	-43.6	174.8	-179.5	64.1	0	0	0	112.4	N20 F21 F22 H27 W28	N20-L24 WeakPolarHBondContact O-CB 3.05Å; N20-L24 PolarHBondContact O-N 3.08Å; F21-L24 PolarHBondContact O-N 3.02Å; F22-L24 VanDerWaalsContact C-N 3.33Å; F22-L24 PolarHBondContact O-N 3.44Å; L24-H27 PolarHBondContact O-N 3.26Å; L24-W28 WeakPolarHBondContact O-CB 3.44Å; L24-W28 PolarHBondContact O-N 3.25Å
25	I	96.2	Very high	90.6	Very high	61 Å²	61	106.5 Å²	106.5	31%	0.313	49%	0.494	S	S	.	.	H	α-helix	trans	-62.7	-44.4	176.5	-72.5	173.6	0	0	0	110.9	F21 F22 E23 W28 L29	F21-I25 HydrophobicContact CD1-CD1 3.87Å; F21-I25 HydrophobicContact CE1-CD1 3.3Å; F21-I25 HydrophobicContact CE1-CG1 4.45Å; F21-I25 HydrophobicContact CE2-CD1 4.12Å; F21-I25 HydrophobicContact CZ-CD1 3.45Å; F21-I25 VanDerWaalsContact CZ-CD1 3.45Å; F21-I25 HydrophobicContact CZ-CG1 4.39Å; F21-I25 WeakPolarHBondContact O-CG1 3.41Å; F21-I25 PolarHBondContact O-N 2.95Å; F21-I25 VanDerWaalsContact O-N 3.08Å; F22-I25 PolarHBondContact O-N 3.46Å; E23-I25 PolarHBondContact O-N 2.99Å; I25-W28 WeakPolarHBondContact O-CB 3.24Å; I25-W28 PolarHBondContact O-N 2.89Å; I25-L29 HydrophobicContact CG2-CD1 3.97Å; I25-L29 HydrophobicContact CG2-CG 4.34Å; I25-L29 WeakPolarHBondContact O-CG 3.37Å; I25-L29 PolarHBondContact O-N 2.98Å
26	L	95.8	Very high	89.7	Confident	102 Å²	102	104 Å²	104	53%	0.534	49%	0.492	S	S	.	.	H	α-helix	trans	-60.6	-47.7	179	-75	170.6	0	0	0	111	F22 E23 W28 L29 E30	F22-L26 WeakPolarHBondContact O-CG 3.37Å; F22-L26 PolarHBondContact O-N 3.35Å; E23-L26 PolarHBondContact O-N 3.24Å; L26-W28 VanDerWaalsContact C-N 3.29Å; L26-W28 PolarHBondContact O-N 3.49Å; L26-L29 WeakPolarHBondContact O-CB 3.5Å; L26-L29 PolarHBondContact O-N 3.48Å; L26-L29 VanDerWaalsContact O-N 3.12Å; L26-E30 WeakPolarHBondContact O-CG 3.29Å; L26-E30 PolarHBondContact O-N 2.89Å
27	H	93.2	Very high	88.7	Confident	98 Å²	98	100.6 Å²	100.6	45%	0.454	48%	0.482	S	S	.	.	H	α-helix	trans	-62.7	-35.1	176.3	-75.9	-38	0	0	0	113.5	E23 L24 E30 S31	E23-H27 PolarHBondContact O-CD2 2.91Å; E23-H27 PolarHBondContact O-N 2.97Å; L24-H27 PolarHBondContact O-N 3.26Å; H27-E30 IonicContact CE1-OE2 3.77Å; H27-E30 IonicContact ND1-OE2 3.84Å; H27-E30 PolarHBondContact ND1-OE2 3.44Å; H27-S31 VanDerWaalsContact O-CB 3.29Å; H27-S31 WeakPolarHBondContact O-CB 3.46Å; H27-S31 PolarHBondContact O-N 2.93Å; H27-S31 PolarHBondContact O-OG 3.32Å
28	W	92.1	Very high	87.6	Confident	163 Å²	163	99.3 Å²	99.3	62%	0.617	48%	0.48	S	S	*	.	H	α-helix	trans	-65.1	-44.5	172.7	177.9	79.2	0	0	0	111.7	L24 I25 L26 S31 C32	L24-W28 WeakPolarHBondContact O-CB 3.44Å; L24-W28 PolarHBondContact O-N 3.25Å; I25-W28 WeakPolarHBondContact O-CB 3.24Å; I25-W28 PolarHBondContact O-N 2.89Å; L26-W28 VanDerWaalsContact C-N 3.29Å; L26-W28 PolarHBondContact O-N 3.49Å; W28-S31 WeakPolarHBondContact O-CB 3.3Å; W28-S31 PolarHBondContact O-N 3.46Å; W28-C32 VanDerWaalsContact CE2-SG 3.6Å; W28-C32 WeakPolarHBondContact O-CB 3.48Å; W28-C32 PolarHBondContact O-N 2.84Å; W28-C32 PolarHBondContact O-SG 2.82Å; W28-C32 VanDerWaalsContact O-SG 3.33Å
29	L	90.5	Very high	86.5	Confident	86 Å²	86	102.7 Å²	102.7	45%	0.45	49%	0.493	S	S	.	.	H	α-helix	trans	-62.9	-44.1	176.3	-72.3	172.3	0	0	0	111.9	I25 L26 S31 C32 Y33	I25-L29 HydrophobicContact CG2-CD1 3.97Å; I25-L29 HydrophobicContact CG2-CG 4.34Å; I25-L29 WeakPolarHBondContact O-CG 3.37Å; I25-L29 PolarHBondContact O-N 2.98Å; L26-L29 WeakPolarHBondContact O-CB 3.5Å; L26-L29 PolarHBondContact O-N 3.48Å; L26-L29 VanDerWaalsContact O-N 3.12Å; L29-S31 VanDerWaalsContact C-N 3.31Å; L29-S31 PolarHBondContact O-N 3.26Å; L29-C32 PolarHBondContact O-N 3.12Å; L29-Y33 WeakPolarHBondContact O-CB 3.49Å; L29-Y33 PolarHBondContact O-N 3.25Å
30	E	88.6	Confident	85.4	Confident	116 Å²	116	104 Å²	104	54%	0.542	49%	0.494	S	S	.	.	H	α-helix	trans	-59.3	-43.3	174.1	-73.4	175.8	158.2	0	0	111.3	L26 H27 C32 Y33 F34	L26-E30 WeakPolarHBondContact O-CG 3.29Å; L26-E30 PolarHBondContact O-N 2.89Å; H27-E30 IonicContact CE1-OE2 3.77Å; H27-E30 IonicContact ND1-OE2 3.84Å; H27-E30 PolarHBondContact ND1-OE2 3.44Å; E30-C32 PolarHBondContact O-N 3.33Å; E30-Y33 PolarHBondContact O-N 2.82Å; E30-F34 VanDerWaalsContact O-CB 3.3Å; E30-F34 WeakPolarHBondContact O-CB 3.3Å; E30-F34 PolarHBondContact O-N 2.92Å
31	S	86	Confident	84.5	Confident	60 Å²	60	102.3 Å²	102.3	42%	0.42	49%	0.49	S	S	.	.	H	α-helix	trans	-64.2	-40.6	176.7	-66.2	0	0	0	0	112.1	H27 W28 L29 K35	H27-S31 VanDerWaalsContact O-CB 3.29Å; H27-S31 WeakPolarHBondContact O-CB 3.46Å; H27-S31 PolarHBondContact O-N 2.93Å; H27-S31 PolarHBondContact O-OG 3.32Å; W28-S31 WeakPolarHBondContact O-CB 3.3Å; W28-S31 PolarHBondContact O-N 3.46Å; L29-S31 VanDerWaalsContact C-N 3.31Å; L29-S31 PolarHBondContact O-N 3.26Å; S31-K35 VanDerWaalsContact O-CB 3.3Å; S31-K35 WeakPolarHBondContact O-CB 3.35Å; S31-K35 VanDerWaalsContact O-CG 3.24Å; S31-K35 WeakPolarHBondContact O-CG 3.49Å; S31-K35 PolarHBondContact O-N 2.82Å
32	C	81.2	Confident	83.5	Confident	57 Å²	57	101.7 Å²	101.7	39%	0.385	50%	0.5	S	S	.	.	H	α-helix	trans	-66.1	-43.2	174.8	-73.9	0	0	0	0	111.6	W28 L29 E30 K35 G36	W28-C32 VanDerWaalsContact CE2-SG 3.6Å; W28-C32 WeakPolarHBondContact O-CB 3.48Å; W28-C32 PolarHBondContact O-N 2.84Å; W28-C32 PolarHBondContact O-SG 2.82Å; W28-C32 VanDerWaalsContact O-SG 3.33Å; L29-C32 PolarHBondContact O-N 3.12Å; E30-C32 PolarHBondContact O-N 3.33Å; C32-K35 PolarHBondContact O-N 3.44Å; C32-G36 PolarHBondContact O-N 2.81Å
33	Y	80.2	Confident	82.5	Confident	183 Å²	183	101.8 Å²	101.8	72%	0.718	51%	0.506	S	S	*	.	H	α-helix	trans	-63.2	-47.1	176.7	178.1	-98.4	0	0	0	111.4	L29 E30 G36 S37	L29-Y33 WeakPolarHBondContact O-CB 3.49Å; L29-Y33 PolarHBondContact O-N 3.25Å; E30-Y33 PolarHBondContact O-N 2.82Å; Y33-G36 CarbonylContact O-C 3.6Å; Y33-G36 PolarHBondContact O-N 2.84Å; Y33-S37 PolarHBondContact O-N 3.31Å; Y33-S37 PolarHBondContact O-OG 3.5Å
34	F	76.7	Confident	81.6	Confident	130 Å²	130	102.2 Å²	102.2	57%	0.57	51%	0.506	S	S	*	.	H	α-helix	trans	-65.6	-40.9	178.6	-173.4	-102	0	0	0	112.1	E30 G36 S37 L38	E30-F34 VanDerWaalsContact O-CB 3.3Å; E30-F34 WeakPolarHBondContact O-CB 3.3Å; E30-F34 PolarHBondContact O-N 2.92Å; F34-G36 VanDerWaalsContact C-N 3.35Å; F34-S37 WeakPolarHBondContact CA-OG 3.29Å; F34-S37 PolarHBondContact O-N 2.93Å; F34-S37 PolarHBondContact O-OG 3.43Å; F34-L38 HydrophobicContact CD1-CD1 3.71Å; F34-L38 HydrophobicContact CD1-CG 4.29Å; F34-L38 HydrophobicContact CE1-CD1 3.41Å; F34-L38 VanDerWaalsContact CE1-CD1 3.41Å; F34-L38 HydrophobicContact CE1-CG 4.03Å; F34-L38 HydrophobicContact CZ-CD1 4.13Å; F34-L38 HydrophobicContact CZ-CD2 4.49Å; F34-L38 HydrophobicContact CZ-CG 4.32Å; F34-L38 WeakPolarHBondContact O-CB 3.4Å; F34-L38 VanDerWaalsContact O-CG 3.29Å; F34-L38 WeakPolarHBondContact O-CG 3.46Å; F34-L38 PolarHBondContact O-N 2.88Å
35	K	73.6	Confident	80.3	Confident	130 Å²	130	100.7 Å²	100.7	57%	0.565	50%	0.504	S	S	*	.	H	α-helix	trans	-65	-41.3	172.6	-74.4	175.7	-178.8	177.5	0	111.1	S31 C32 L38 W39	S31-K35 VanDerWaalsContact O-CB 3.3Å; S31-K35 WeakPolarHBondContact O-CB 3.35Å; S31-K35 VanDerWaalsContact O-CG 3.24Å; S31-K35 WeakPolarHBondContact O-CG 3.49Å; S31-K35 PolarHBondContact O-N 2.82Å; C32-K35 PolarHBondContact O-N 3.44Å; K35-L38 WeakPolarHBondContact O-CB 3.37Å; K35-L38 PolarHBondContact O-N 2.81Å; K35-W39 PolarHBondContact O-N 3.22Å
36	G	72.8	Confident	79.3	Confident	38 Å²	38	102.5 Å²	102.5	39%	0.392	52%	0.522	S	S	.	.	H	α-helix	trans	-61.6	-41.5	176.1	0	0	0	0	0	112.7	C32 Y33 F34 W39 R40	C32-G36 PolarHBondContact O-N 2.81Å; Y33-G36 CarbonylContact O-C 3.6Å; Y33-G36 PolarHBondContact O-N 2.84Å; F34-G36 VanDerWaalsContact C-N 3.35Å; G36-W39 PolarHBondContact O-N 3.27Å; G36-R40 WeakPolarHBondContact O-CB 3.43Å; G36-R40 PolarHBondContact O-N 2.9Å
37	S	72.5	Confident	77.8	Confident	48 Å²	48	103 Å²	103	34%	0.336	52%	0.521	S	S	.	.	H	α-helix	trans	-68.3	-38.5	175.7	69.3	0	0	0	0	111.7	Y33 F34 R40 A41	Y33-S37 PolarHBondContact O-N 3.31Å; Y33-S37 PolarHBondContact O-OG 3.5Å; F34-S37 WeakPolarHBondContact CA-OG 3.29Å; F34-S37 PolarHBondContact O-N 2.93Å; F34-S37 PolarHBondContact O-OG 3.43Å; S37-R40 PolarHBondContact O-N 2.89Å; S37-A41 WeakPolarHBondContact O-CB 3.48Å; S37-A41 PolarHBondContact O-N 3.29Å
38	L	70	Confident	76.1	Confident	93 Å²	93	102.8 Å²	102.8	49%	0.487	53%	0.527	S	S	.	.	H	α-helix	trans	-61.7	-45.7	171.3	-76.3	173.2	0	0	0	112.1	F34 K35 R40 A41 A42	F34-L38 HydrophobicContact CD1-CD1 3.71Å; F34-L38 HydrophobicContact CD1-CG 4.29Å; F34-L38 HydrophobicContact CE1-CD1 3.41Å; F34-L38 VanDerWaalsContact CE1-CD1 3.41Å; F34-L38 HydrophobicContact CE1-CG 4.03Å; F34-L38 HydrophobicContact CZ-CD1 4.13Å; F34-L38 HydrophobicContact CZ-CD2 4.49Å; F34-L38 HydrophobicContact CZ-CG 4.32Å; F34-L38 WeakPolarHBondContact O-CB 3.4Å; F34-L38 VanDerWaalsContact O-CG 3.29Å; F34-L38 WeakPolarHBondContact O-CG 3.46Å; F34-L38 PolarHBondContact O-N 2.88Å; K35-L38 WeakPolarHBondContact O-CB 3.37Å; K35-L38 PolarHBondContact O-N 2.81Å; L38-R40 VanDerWaalsContact C-N 3.28Å; L38-R40 PolarHBondContact O-N 3.42Å; L38-A41 PolarHBondContact O-N 3.4Å; L38-A42 WeakPolarHBondContact O-CB 3.37Å; L38-A42 PolarHBondContact O-N 2.85Å
39	W	68.7	Low	73.9	Confident	178 Å²	178	105.1 Å²	105.1	67%	0.674	55%	0.552	S	S	*	*	H	α-helix	trans	-60.1	-40.8	174.8	-77.7	115.5	0	0	0	111.2	K35 G36 A42 L43	K35-W39 PolarHBondContact O-N 3.22Å; G36-W39 PolarHBondContact O-N 3.27Å; W39-A42 PolarHBondContact O-N 2.94Å; W39-L43 WeakPolarHBondContact O-CB 3.29Å; W39-L43 VanDerWaalsContact O-CG 3.29Å; W39-L43 WeakPolarHBondContact O-CG 3.42Å; W39-L43 PolarHBondContact O-N 3.4Å
40	R	72	Confident	73.1	Confident	159 Å²	159	106.1 Å²	106.1	60%	0.6	56%	0.557	S	S	*	*	H	α-helix	trans	-64.7	-45.3	176.2	-170.1	175.4	-179.9	139	5.6	111.8	G36 S37 L38 A42 L43 F44 E47	G36-R40 WeakPolarHBondContact O-CB 3.43Å; G36-R40 PolarHBondContact O-N 2.9Å; S37-R40 PolarHBondContact O-N 2.89Å; L38-R40 VanDerWaalsContact C-N 3.28Å; L38-R40 PolarHBondContact O-N 3.42Å; R40-A42 VanDerWaalsContact C-N 3.31Å; R40-A42 PolarHBondContact O-N 3.39Å; R40-L43 PolarHBondContact O-N 3.44Å; R40-F44 HydrophobicContact CG-CD2 4Å; R40-F44 WeakPolarHBondContact O-CB 3.36Å; R40-F44 WeakPolarHBondContact O-CD2 3.43Å; R40-F44 PolarHBondContact O-N 3.34Å; R40-E47 IonicContact NH2-OE2 3.02Å; R40-E47 PolarHBondContact NH2-OE2 2.87Å
41	A	77.1	Confident	72.3	Confident	38 Å²	38	105.5 Å²	105.5	31%	0.314	56%	0.558	S	S	.	*	H	α-helix	trans	-63.4	-36.9	176.7	0	0	0	0	0	112.3	S37 L38 F44 P45 T48	S37-A41 WeakPolarHBondContact O-CB 3.48Å; S37-A41 PolarHBondContact O-N 3.29Å; L38-A41 PolarHBondContact O-N 3.4Å; A41-F44 CarbonylContact O-C 3.58Å; A41-P45 WeakPolarHBondContact O-CA 3.48Å; A41-T48 HydrophobicContact CB-CG2 4.17Å
42	A	74.8	Confident	71.5	Confident	72 Å²	72	108.1 Å²	108.1	60%	0.595	57%	0.565	S	S	*	*	H	α-helix	trans	-71.4	-37.8	177.7	0	0	0	0	0	113.1	L38 W39 R40	L38-A42 WeakPolarHBondContact O-CB 3.37Å; L38-A42 PolarHBondContact O-N 2.85Å; W39-A42 PolarHBondContact O-N 2.94Å; R40-A42 VanDerWaalsContact C-N 3.31Å; R40-A42 PolarHBondContact O-N 3.39Å
43	L	77.2	Confident	70.9	Confident	121 Å²	121	111.1 Å²	111.1	63%	0.634	58%	0.576	S	S	*	*	H	α-helix	trans	-80.6	-29.7	179.4	-70.5	171.8	0	0	0	112.9	W39 R40 P45	W39-L43 WeakPolarHBondContact O-CB 3.29Å; W39-L43 VanDerWaalsContact O-CG 3.29Å; W39-L43 WeakPolarHBondContact O-CG 3.42Å; W39-L43 PolarHBondContact O-N 3.4Å; R40-L43 PolarHBondContact O-N 3.44Å; L43-P45 VanDerWaalsContact C-CD 3.4Å; L43-P45 WeakPolarHBondContact O-CD 3.47Å
44	F	78	Confident	70.4	Confident	94 Å²	94	106.6 Å²	106.6	41%	0.412	57%	0.567	S	S	.	*			trans	-127.1	60.4	-177.4	-53.4	-81.5	0	0	0	111.6	R40 A41 S46 E47	R40-F44 HydrophobicContact CG-CD2 4Å; R40-F44 WeakPolarHBondContact O-CB 3.36Å; R40-F44 WeakPolarHBondContact O-CD2 3.43Å; R40-F44 PolarHBondContact O-N 3.34Å; A41-F44 CarbonylContact O-C 3.58Å; F44-S46 PolarHBondContact O-N 3Å; F44-S46 VanDerWaalsContact O-N 3.1Å; F44-E47 HydrophobicContact CB-CB 4.01Å; F44-E47 HydrophobicContact CB-CG 3.99Å; F44-E47 PolarHBondContact O-N 2.81Å
45	P	69.8	Low	69.9	Low	87 Å²	87	105 Å²	105	57%	0.565	57%	0.567	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.5	-20.4	-176.4	25.1	-33.7	0	0	0	113.3	A41 L43 T48	A41-P45 WeakPolarHBondContact O-CA 3.48Å; L43-P45 VanDerWaalsContact C-CD 3.4Å; L43-P45 WeakPolarHBondContact O-CD 3.47Å; P45-T48 PolarHBondContact O-OG1 3.1Å
46	S	75.2	Confident	69.7	Low	100 Å²	100	103.2 Å²	103.2	70%	0.699	57%	0.567	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.2	-18.6	175.4	56.1	0	0	0	0	114.2	F44 T48	F44-S46 PolarHBondContact O-N 3Å; F44-S46 VanDerWaalsContact O-N 3.1Å; S46-T48 VanDerWaalsContact C-N 3.32Å
47	E	62.9	Low	69.4	Low	111 Å²	111	108.2 Å²	108.2	52%	0.519	58%	0.58	S	S	.	*	T	Hydrogen-bonded Turn	trans	-83.5	-8.2	176.5	-70.7	-172	-174.2	0	0	112.7	R40 F44 N49	R40-E47 IonicContact NH2-OE2 3.02Å; R40-E47 PolarHBondContact NH2-OE2 2.87Å; F44-E47 HydrophobicContact CB-CB 4.01Å; F44-E47 HydrophobicContact CB-CG 3.99Å; F44-E47 PolarHBondContact O-N 2.81Å; E47-N49 VanDerWaalsContact C-N 3.33Å
48	T	57.3	Low	69.2	Low	94 Å²	94	113.3 Å²	113.3	58%	0.577	60%	0.601	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.4	1.1	178.9	28	0	0	0	0	115	A41 P45 S46	A41-T48 HydrophobicContact CB-CG2 4.17Å; P45-T48 PolarHBondContact O-OG1 3.1Å; S46-T48 VanDerWaalsContact C-N 3.32Å
49	N	47.3	Very low	69.1	Low	212 Å²	212	115.1 Å²	115.1	100%	1.134	61%	0.611	S	S	*	*			trans	-94	0	171.3	-79.5	-16.3	0	0	0	111.4	E47	E47-N49 VanDerWaalsContact C-N 3.33Å

Retrieved 49 of 49 residues in 44.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).