A0AA82N841_SCHMA Loading...

Uncharacterized protein AlphaSync

AlphaFold DB , UniProt , Accession A0AA82N841, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 32 aa.

						>A0AA82N841_SCHMA|A0AA82N841
MNGKIQTNNAKIQSTYPKQKQNIYKIDQNELV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	67	Low	87.8	Confident	209 Å²	209	111.9 Å²	111.9	100%	1.03	59%	0.594	S	S	*	*				0	-34.1	0	-142	165.1	-168.5	0	113	G3	M1-G3 PolarHBondContact O-N 3.26Å
2	N	80.8	Confident	88.1	Confident	124 Å²	124	110.4 Å²	110.4	66%	0.663	59%	0.585	S	S	*	*	H	α-helix	trans	-63.8	-33.9	-175.7	-67.6	-5.6	0	0	116.2	K4 I5 Q6	N2-K4 PolarHBondContact O-N 3.41Å; N2-I5 PolarHBondContact O-N 3.02Å; N2-Q6 PolarHBondContact O-N 2.88Å
3	G	85.8	Confident	88.2	Confident	42 Å²	42	112.5 Å²	112.5	43%	0.433	59%	0.589	S	S	.	*	H	α-helix	trans	-61.9	-41.7	-177.5	0	0	0	0	113.5	M1 I5 Q6 T7	M1-G3 PolarHBondContact O-N 3.26Å; G3-I5 VanDerWaalsContact C-N 3.34Å; G3-I5 PolarHBondContact O-N 3.26Å; G3-Q6 PolarHBondContact O-N 2.94Å; G3-T7 PolarHBondContact O-N 3.48Å; G3-T7 PolarHBondContact O-OG1 3.46Å
4	K	90.3	Very high	88	Confident	170 Å²	170	108.9 Å²	108.9	74%	0.739	58%	0.578	S	S	*	*	H	α-helix	trans	-65	-38.2	178.3	-70.2	-174.5	178	-178.6	112	N2 T7 N8	N2-K4 PolarHBondContact O-N 3.41Å; K4-T7 PolarHBondContact O-N 3.35Å; K4-N8 WeakPolarHBondContact O-CB 3.49Å; K4-N8 VanDerWaalsContact O-CG 3.24Å; K4-N8 PolarHBondContact O-N 3.4Å
5	I	92.7	Very high	88.2	Confident	97 Å²	97	105.9 Å²	105.9	50%	0.497	57%	0.566	S	S	.	*	H	α-helix	trans	-66.6	-45.4	177.4	-63.7	172.4	0	0	110.2	N2 G3 T7 N8 N9	N2-I5 PolarHBondContact O-N 3.02Å; G3-I5 VanDerWaalsContact C-N 3.34Å; G3-I5 PolarHBondContact O-N 3.26Å; I5-T7 PolarHBondContact O-N 3.49Å; I5-N8 PolarHBondContact O-N 3.39Å; I5-N9 PolarHBondContact O-N 2.93Å
6	Q	89	Confident	88	Confident	140 Å²	140	108.3 Å²	108.3	65%	0.654	57%	0.566	S	S	*	*	H	α-helix	trans	-60.7	-43.8	175.8	-76.4	177.3	-26.9	0	111.9	N2 G3 N8 N9 A10	N2-Q6 PolarHBondContact O-N 2.88Å; G3-Q6 PolarHBondContact O-N 2.94Å; Q6-N8 PolarHBondContact O-N 3.46Å; Q6-N9 PolarHBondContact O-N 3.37Å; Q6-A10 WeakPolarHBondContact O-CB 3.21Å; Q6-A10 PolarHBondContact O-N 2.95Å
7	T	92.4	Very high	87.9	Confident	75 Å²	75	106.4 Å²	106.4	46%	0.46	56%	0.561	S	S	.	*	H	α-helix	trans	-62.2	-42.5	175.9	-55.2	0	0	0	112	G3 K4 I5 A10 K11	G3-T7 PolarHBondContact O-N 3.48Å; G3-T7 PolarHBondContact O-OG1 3.46Å; K4-T7 PolarHBondContact O-N 3.35Å; I5-T7 PolarHBondContact O-N 3.49Å; T7-A10 PolarHBondContact O-N 3.44Å; T7-K11 WeakPolarHBondContact O-CG 3.42Å; T7-K11 PolarHBondContact O-N 3.3Å
8	N	92.2	Very high	88	Confident	92 Å²	92	108.1 Å²	108.1	49%	0.492	56%	0.563	S	S	.	*	H	α-helix	trans	-66.8	-41.4	178.4	-73.4	-6	0	0	111.6	K4 I5 Q6 A10 K11 I12	K4-N8 WeakPolarHBondContact O-CB 3.49Å; K4-N8 VanDerWaalsContact O-CG 3.24Å; K4-N8 PolarHBondContact O-N 3.4Å; I5-N8 PolarHBondContact O-N 3.39Å; Q6-N8 PolarHBondContact O-N 3.46Å; N8-A10 PolarHBondContact O-N 2.94Å; N8-K11 PolarHBondContact O-N 3.06Å; N8-I12 VanDerWaalsContact O-CG1 3.32Å; N8-I12 WeakPolarHBondContact O-CG1 3.28Å; N8-I12 PolarHBondContact O-N 3.26Å
9	N	91.5	Very high	87.9	Confident	92 Å²	92	107.9 Å²	107.9	49%	0.492	56%	0.56	S	S	.	*	H	α-helix	trans	-61.1	-44.3	173.9	-95.3	-7.6	0	0	111.9	I5 Q6 K11 I12 Q13	I5-N9 PolarHBondContact O-N 2.93Å; Q6-N9 PolarHBondContact O-N 3.37Å; N9-K11 VanDerWaalsContact C-N 3.31Å; N9-K11 PolarHBondContact O-N 3.03Å; N9-I12 PolarHBondContact O-N 2.95Å; N9-Q13 WeakPolarHBondContact O-CB 3.42Å; N9-Q13 WeakPolarHBondContact O-CG 3.32Å; N9-Q13 PolarHBondContact O-N 3.02Å
10	A	91.8	Very high	87.8	Confident	63 Å²	63	109.5 Å²	109.5	52%	0.521	56%	0.562	S	S	.	*	H	α-helix	trans	-60.3	-41.2	176.6	0	0	0	0	112.1	Q6 T7 N8 Q13 S14	Q6-A10 WeakPolarHBondContact O-CB 3.21Å; Q6-A10 PolarHBondContact O-N 2.95Å; T7-A10 PolarHBondContact O-N 3.44Å; N8-A10 PolarHBondContact O-N 2.94Å; A10-Q13 PolarHBondContact O-N 2.71Å; A10-S14 WeakPolarHBondContact O-CB 2.96Å; A10-S14 PolarHBondContact O-N 3.39Å
11	K	92.8	Very high	87.7	Confident	127 Å²	127	109.7 Å²	109.7	55%	0.552	56%	0.561	S	S	*	*	H	α-helix	trans	-61.6	-50.1	174.7	-73.9	176.9	179.8	-179.3	111.4	T7 N8 N9 Q13 S14 T15	T7-K11 WeakPolarHBondContact O-CG 3.42Å; T7-K11 PolarHBondContact O-N 3.3Å; N8-K11 PolarHBondContact O-N 3.06Å; N9-K11 VanDerWaalsContact C-N 3.31Å; N9-K11 PolarHBondContact O-N 3.03Å; K11-Q13 VanDerWaalsContact C-N 3.34Å; K11-Q13 PolarHBondContact O-N 3.04Å; K11-S14 PolarHBondContact O-N 3.27Å; K11-S14 PolarHBondContact O-OG 3.41Å; K11-T15 PolarHBondContact O-N 3.49Å; K11-T15 PolarHBondContact O-OG1 2.9Å
12	I	91.2	Very high	88.8	Confident	94 Å²	94	104 Å²	104	48%	0.482	53%	0.534	S	S	.	.	H	α-helix	trans	-57.5	-47.4	178.9	-68.8	166	0	0	110.9	N8 N9 S14 T15 Y16	N8-I12 VanDerWaalsContact O-CG1 3.32Å; N8-I12 WeakPolarHBondContact O-CG1 3.28Å; N8-I12 PolarHBondContact O-N 3.26Å; N9-I12 PolarHBondContact O-N 2.95Å; I12-S14 PolarHBondContact O-N 3.02Å; I12-T15 PolarHBondContact O-N 3.46Å; I12-T15 VanDerWaalsContact O-N 3.12Å; I12-Y16 PolarHBondContact O-N 2.96Å
13	Q	88.6	Confident	89.1	Confident	137 Å²	137	102.7 Å²	102.7	64%	0.64	53%	0.526	S	S	*	.	H	α-helix	trans	-62	-30.6	178	-68.7	-67.6	-30.2	0	112.5	N9 A10 K11 P17	N9-Q13 WeakPolarHBondContact O-CB 3.42Å; N9-Q13 WeakPolarHBondContact O-CG 3.32Å; N9-Q13 PolarHBondContact O-N 3.02Å; A10-Q13 PolarHBondContact O-N 2.71Å; K11-Q13 VanDerWaalsContact C-N 3.34Å; K11-Q13 PolarHBondContact O-N 3.04Å; Q13-P17 WeakPolarHBondContact O-CD 3.42Å; Q13-P17 VanDerWaalsContact O-CG 3.28Å; Q13-P17 WeakPolarHBondContact O-CG 3.48Å
14	S	86.5	Confident	89.3	Confident	62 Å²	62	107.5 Å²	107.5	43%	0.434	53%	0.532	S	S	.	.	H	α-helix	trans	-78.2	-27.1	175.7	80.9	0	0	0	113.8	A10 K11 I12	A10-S14 WeakPolarHBondContact O-CB 2.96Å; A10-S14 PolarHBondContact O-N 3.39Å; K11-S14 PolarHBondContact O-N 3.27Å; K11-S14 PolarHBondContact O-OG 3.41Å; I12-S14 PolarHBondContact O-N 3.02Å
15	T	90.5	Very high	89.2	Confident	65 Å²	65	104.7 Å²	104.7	40%	0.399	52%	0.52	S	S	.	.	H	α-helix	trans	-87.2	-39.3	-175.5	-54.5	0	0	0	112.2	K11 I12 K18 Q19	K11-T15 PolarHBondContact O-N 3.49Å; K11-T15 PolarHBondContact O-OG1 2.9Å; I12-T15 PolarHBondContact O-N 3.46Å; I12-T15 VanDerWaalsContact O-N 3.12Å; T15-K18 PolarHBondContact O-N 3.03Å; T15-Q19 HydrophobicContact CG2-CG 4.27Å; T15-Q19 PolarHBondContact O-N 3.18Å
16	Y	85.3	Confident	88.9	Confident	143 Å²	143	104.8 Å²	104.8	56%	0.561	52%	0.521	S	S	*	.	H	α-helix	trans	-57.9	-44.1	-176.5	-145.6	-95.1	0	0	114	I12 K18 Q19 K20	I12-Y16 PolarHBondContact O-N 2.96Å; Y16-K18 PolarHBondContact O-N 3.12Å; Y16-Q19 PolarHBondContact O-N 3.38Å; Y16-K20 PolarHBondContact O-N 3.37Å; Y16-K20 VanDerWaalsContact O-N 3.09Å
17	P	86.3	Confident	88.6	Confident	76 Å²	76	102.3 Å²	102.3	49%	0.494	51%	0.512	S	S	.	.	H	α-helix	trans	-65.7	-37.1	177.3	-19.6	32.2	0	0	112.6	Q13 K20 Q21	Q13-P17 WeakPolarHBondContact O-CD 3.42Å; Q13-P17 VanDerWaalsContact O-CG 3.28Å; Q13-P17 WeakPolarHBondContact O-CG 3.48Å; P17-K20 PolarHBondContact O-N 3.09Å; P17-Q21 WeakPolarHBondContact O-CB 3.48Å; P17-Q21 PolarHBondContact O-N 3.04Å
18	K	88.5	Confident	87.9	Confident	137 Å²	137	103.2 Å²	103.2	60%	0.596	51%	0.511	S	S	*	.	H	α-helix	trans	-66	-40.3	177.6	-68.7	-178.6	178.8	179.2	111.4	T15 Y16 Q21 N22	T15-K18 PolarHBondContact O-N 3.03Å; Y16-K18 PolarHBondContact O-N 3.12Å; K18-Q21 PolarHBondContact O-N 3.36Å; K18-N22 WeakPolarHBondContact O-CB 3.38Å; K18-N22 VanDerWaalsContact O-CG 3.28Å; K18-N22 PolarHBondContact O-N 3.06Å; K18-N22 PolarHBondContact O-OD1 3.12Å
19	Q	86.7	Confident	87	Confident	106 Å²	106	104.8 Å²	104.8	50%	0.495	52%	0.519	S	S	.	.	H	α-helix	trans	-63	-46.2	174.8	-73.7	176.2	-13.7	0	111.5	T15 Y16 Q21 N22 I23	T15-Q19 HydrophobicContact CG2-CG 4.27Å; T15-Q19 PolarHBondContact O-N 3.18Å; Y16-Q19 PolarHBondContact O-N 3.38Å; Q19-Q21 VanDerWaalsContact C-N 3.32Å; Q19-Q21 PolarHBondContact O-N 3.46Å; Q19-N22 PolarHBondContact O-N 2.97Å; Q19-I23 WeakPolarHBondContact O-CG1 3.35Å; Q19-I23 PolarHBondContact O-N 3.21Å
20	K	85.2	Confident	86	Confident	138 Å²	138	108.1 Å²	108.1	60%	0.6	53%	0.532	S	S	*	.	H	α-helix	trans	-58.4	-43.1	174.7	-78.1	-165.7	175.1	-171.8	112.5	Y16 P17 N22 I23 Y24	Y16-K20 PolarHBondContact O-N 3.37Å; Y16-K20 VanDerWaalsContact O-N 3.09Å; P17-K20 PolarHBondContact O-N 3.09Å; K20-N22 VanDerWaalsContact C-N 3.34Å; K20-I23 PolarHBondContact O-N 2.94Å; K20-Y24 PolarHBondContact O-N 3.39Å
21	Q	87.6	Confident	84.6	Confident	115 Å²	115	112.3 Å²	112.3	54%	0.537	55%	0.545	S	S	.	.	H	α-helix	trans	-65.8	-37.6	178.4	-170.3	174.1	45.8	0	112.3	P17 K18 Q19 K25	P17-Q21 WeakPolarHBondContact O-CB 3.48Å; P17-Q21 PolarHBondContact O-N 3.04Å; K18-Q21 PolarHBondContact O-N 3.36Å; Q19-Q21 VanDerWaalsContact C-N 3.32Å; Q19-Q21 PolarHBondContact O-N 3.46Å; Q21-K25 WeakPolarHBondContact O-CG 3.48Å; Q21-K25 PolarHBondContact O-N 3.5Å; Q21-K25 VanDerWaalsContact O-N 3.12Å
22	N	88.2	Confident	82.7	Confident	89 Å²	89	114.8 Å²	114.8	48%	0.476	57%	0.57	S	S	.	*	H	α-helix	trans	-68.4	-42.3	177.1	-73.7	-3.7	0	0	112	K18 Q19 K20 Y24 K25 I26	K18-N22 WeakPolarHBondContact O-CB 3.38Å; K18-N22 VanDerWaalsContact O-CG 3.28Å; K18-N22 PolarHBondContact O-N 3.06Å; K18-N22 PolarHBondContact O-OD1 3.12Å; Q19-N22 PolarHBondContact O-N 2.97Å; K20-N22 VanDerWaalsContact C-N 3.34Å; N22-Y24 VanDerWaalsContact C-N 3.35Å; N22-Y24 PolarHBondContact O-N 3.24Å; N22-K25 PolarHBondContact O-N 2.92Å; N22-I26 WeakPolarHBondContact O-CG1 3.37Å; N22-I26 PolarHBondContact O-N 3.48Å
23	I	88.9	Confident	82.3	Confident	97 Å²	97	115.9 Å²	115.9	50%	0.497	58%	0.575	S	S	.	*	H	α-helix	trans	-59.7	-47.8	175.4	-66.9	165.4	0	0	110	Q19 K20 K25 I26 D27	Q19-I23 WeakPolarHBondContact O-CG1 3.35Å; Q19-I23 PolarHBondContact O-N 3.21Å; K20-I23 PolarHBondContact O-N 2.94Å; I23-K25 VanDerWaalsContact C-N 3.27Å; I23-K25 PolarHBondContact O-N 3.05Å; I23-I26 PolarHBondContact O-N 3.12Å; I23-D27 PolarHBondContact O-N 3.26Å
24	Y	89.5	Confident	82	Confident	143 Å²	143	114.7 Å²	114.7	56%	0.561	57%	0.571	S	S	*	*	H	α-helix	trans	-59	-37.5	178.3	-171.1	-94.4	0	0	112.9	K20 N22 Q28	K20-Y24 PolarHBondContact O-N 3.39Å; N22-Y24 VanDerWaalsContact C-N 3.35Å; N22-Y24 PolarHBondContact O-N 3.24Å; Y24-Q28 HydrophobicContact CD1-CG 4.19Å; Y24-Q28 HydrophobicContact CE1-CG 3.8Å; Y24-Q28 WeakPolarHBondContact O-CB 3.46Å; Y24-Q28 WeakPolarHBondContact O-CG 3.38Å; Y24-Q28 PolarHBondContact O-N 3Å; Y24-Q28 PolarHBondContact OH-NE2 3.07Å; Y24-Q28 VanDerWaalsContact OH-NE2 3.12Å
25	K	88.4	Confident	81.7	Confident	111 Å²	111	117.7 Å²	117.7	48%	0.483	58%	0.579	S	S	.	*	H	α-helix	trans	-68.6	-36.3	175.6	-74.4	175.4	178.4	-178.7	112.9	Q21 N22 I23 N29	Q21-K25 WeakPolarHBondContact O-CG 3.48Å; Q21-K25 PolarHBondContact O-N 3.5Å; Q21-K25 VanDerWaalsContact O-N 3.12Å; N22-K25 PolarHBondContact O-N 2.92Å; I23-K25 VanDerWaalsContact C-N 3.27Å; I23-K25 PolarHBondContact O-N 3.05Å; K25-N29 WeakPolarHBondContact O-CB 3.27Å; K25-N29 PolarHBondContact O-N 3.01Å
26	I	86	Confident	81.2	Confident	99 Å²	99	120.8 Å²	120.8	51%	0.508	59%	0.589	S	S	.	*	H	α-helix	trans	-66.6	-50.1	176.2	-67.8	164.7	0	0	109.3	N22 I23 Q28 N29 E30	N22-I26 WeakPolarHBondContact O-CG1 3.37Å; N22-I26 PolarHBondContact O-N 3.48Å; I23-I26 PolarHBondContact O-N 3.12Å; I26-Q28 VanDerWaalsContact C-N 3.27Å; I26-Q28 PolarHBondContact O-N 3.29Å; I26-N29 PolarHBondContact O-N 3.02Å; I26-N29 VanDerWaalsContact O-N 3.07Å; I26-E30 PolarHBondContact O-N 3.21Å
27	D	83.4	Confident	81	Confident	87 Å²	87	119.4 Å²	119.4	47%	0.465	59%	0.591	S	S	.	*	H	α-helix	trans	-58.3	-40	178.2	-71.2	-10.6	0	0	111.6	I23 L31	I23-D27 PolarHBondContact O-N 3.26Å; D27-L31 WeakPolarHBondContact O-CD1 3.41Å; D27-L31 VanDerWaalsContact O-CG 3.27Å; D27-L31 WeakPolarHBondContact O-CG 3.34Å; D27-L31 PolarHBondContact O-N 3.43Å
28	Q	76.5	Confident	80.6	Confident	94 Å²	94	122.3 Å²	122.3	44%	0.439	60%	0.598	S	S	.	*	H	α-helix	trans	-67.3	-41.6	175.4	-76.2	-155.5	-38.5	0	112.7	Y24 I26 E30 L31 V32	Y24-Q28 HydrophobicContact CD1-CG 4.19Å; Y24-Q28 HydrophobicContact CE1-CG 3.8Å; Y24-Q28 WeakPolarHBondContact O-CB 3.46Å; Y24-Q28 WeakPolarHBondContact O-CG 3.38Å; Y24-Q28 PolarHBondContact O-N 3Å; Y24-Q28 PolarHBondContact OH-NE2 3.07Å; Y24-Q28 VanDerWaalsContact OH-NE2 3.12Å; I26-Q28 VanDerWaalsContact C-N 3.27Å; I26-Q28 PolarHBondContact O-N 3.29Å; Q28-E30 VanDerWaalsContact C-N 3.3Å; Q28-E30 PolarHBondContact O-N 3.36Å; Q28-L31 PolarHBondContact O-N 3Å; Q28-V32 WeakPolarHBondContact O-CG2 3.37Å
29	N	74.4	Confident	80.1	Confident	126 Å²	126	121.2 Å²	121.2	67%	0.674	60%	0.598	S	S	*	*	H	α-helix	trans	-69.9	-24.3	179.7	-82.3	13.6	0	0	113.4	K25 I26 L31	K25-N29 WeakPolarHBondContact O-CB 3.27Å; K25-N29 PolarHBondContact O-N 3.01Å; I26-N29 PolarHBondContact O-N 3.02Å; I26-N29 VanDerWaalsContact O-N 3.07Å; N29-L31 VanDerWaalsContact C-N 3.35Å
30	E	70.3	Confident	79.5	Confident	162 Å²	162	122.4 Å²	122.4	76%	0.757	61%	0.606	S	S	*	*	H	α-helix	trans	-82.4	-13.3	173.5	-67.8	-161.8	167.2	0	113.2	I26 Q28	I26-E30 PolarHBondContact O-N 3.21Å; Q28-E30 VanDerWaalsContact C-N 3.3Å; Q28-E30 PolarHBondContact O-N 3.36Å
31	L	61.7	Low	79.1	Confident	150 Å²	150	121.1 Å²	121.1	79%	0.785	61%	0.606	S	S	*	*			trans	-91.7	-7.2	177.5	-75	168.1	0	0	114.2	D27 Q28 N29	D27-L31 WeakPolarHBondContact O-CD1 3.41Å; D27-L31 VanDerWaalsContact O-CG 3.27Å; D27-L31 WeakPolarHBondContact O-CG 3.34Å; D27-L31 PolarHBondContact O-N 3.43Å; Q28-L31 PolarHBondContact O-N 3Å; N29-L31 VanDerWaalsContact C-N 3.35Å
32	V	54.1	Low	78.3	Confident	180 Å²	180	121.6 Å²	121.6	100%	1.091	61%	0.612	S	S	*	*			trans	-110.9	0	177.6	-159.4	0	0	0	110.5	Q28	Q28-V32 WeakPolarHBondContact O-CG2 3.37Å

Retrieved 32 of 32 residues in 42.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).