A0AA82N849_SCHMA Loading...

26S proteasome complex subunit SEM1 AlphaSync

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins.

AlphaFold DB , UniProt , Accession A0AA82N849, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 78 aa.

						>A0AA82N849_SCHMA|A0AA82N849
MSSEQLQDPEQVEEALGILKDDKEFEEFEKENWLTSEEEISDLQVWDDKWDYEVEIDDQFTQYLRQELTKLGHLHETN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	38.7	Very low	58.1	Low	240 Å²	240	138.7 Å²	138.7	100%	1.182	73%	0.731	S	S	*	*				0	110	0	-62.9	-156.9	91.6	0	0	106.4	S3	M1-S3 PolarHBondContact O-N 3Å
2	S	48.1	Very low	59.7	Low	120 Å²	120	132.3 Å²	132.3	84%	0.839	70%	0.701	S	S	*	*			trans	-69.8	108.2	168.3	-55.9	0	0	0	0	107.2
3	S	52.7	Low	61	Low	96 Å²	96	133.2 Å²	133.2	67%	0.671	70%	0.699	S	S	*	*			trans	-101.3	88.7	155.7	-77.9	0	0	0	0	105.3	M1 Q5	M1-S3 PolarHBondContact O-N 3Å; S3-Q5 PolarHBondContact O-N 3.04Å
4	E	50.1	Low	62.1	Low	176 Å²	176	132.9 Å²	132.9	82%	0.822	69%	0.692	S	S	*	*			trans	-50.3	98.2	148	-70.2	172.4	126.1	0	0	105.7	L6	E4-L6 PolarHBondContact O-N 2.83Å
5	Q	53.4	Low	63	Low	156 Å²	156	127.1 Å²	127.1	73%	0.729	67%	0.671	S	S	*	*			trans	-67.2	94.8	160.6	-70.9	-68	-14.3	0	0	104.2	S3 Q7	S3-Q5 PolarHBondContact O-N 3.04Å; Q5-Q7 PolarHBondContact O-N 2.99Å
6	L	48.5	Very low	63.7	Low	155 Å²	155	124.1 Å²	124.1	81%	0.812	66%	0.655	S	S	*	*			trans	-48.8	93.9	158.5	-76.8	153.3	0	0	0	105.8	E4 D8	E4-L6 PolarHBondContact O-N 2.83Å; L6-D8 PolarHBondContact O-N 2.82Å
7	Q	55.7	Low	64.5	Low	116 Å²	116	119.2 Å²	119.2	54%	0.542	64%	0.641	S	S	.	*			trans	-59	112.6	168.3	-155.6	97.8	5.1	0	0	104.6	Q5 Q11 V12	Q5-Q7 PolarHBondContact O-N 2.99Å; Q7-Q11 HydrophobicContact CG-CB 4.16Å; Q7-V12 HydrophobicContact CB-CG2 3.68Å; Q7-V12 HydrophobicContact CG-CG2 3.73Å
8	D	70.2	Confident	65.1	Low	105 Å²	105	116.6 Å²	116.6	56%	0.561	63%	0.626	S	S	*	*			trans	-49.3	136.6	179.9	-98	-42.2	0	0	0	108.3	L6 E10 Q11 V12	L6-D8 PolarHBondContact O-N 2.82Å; D8-E10 PolarHBondContact O-N 2.67Å; D8-Q11 HydrophobicContact CB-CG 4.43Å; D8-Q11 WeakPolarHBondContact O-CA 3.47Å; D8-Q11 PolarHBondContact O-N 2.9Å; D8-V12 PolarHBondContact O-N 2.92Å
9	P	73	Confident	65.5	Low	104 Å²	104	117.4 Å²	117.4	68%	0.675	63%	0.63	S	S	*	*	H	α-helix	trans	-55.1	-28.8	-176.1	21.1	-32.5	0	0	0	112.3	V12 E13	P9-V12 PolarHBondContact O-N 2.88Å; P9-E13 WeakPolarHBondContact O-CB 3.16Å; P9-E13 PolarHBondContact O-N 2.95Å
10	E	74.4	Confident	66.1	Low	155 Å²	155	119.7 Å²	119.7	72%	0.724	63%	0.634	S	S	*	*	H	α-helix	trans	-66.8	-40.5	173.7	-168.2	170.9	-164.3	0	0	112.6	D8 E13 E14	D8-E10 PolarHBondContact O-N 2.67Å; E10-E13 PolarHBondContact O-N 3.43Å; E10-E14 WeakPolarHBondContact O-CB 3.21Å; E10-E14 PolarHBondContact O-N 2.85Å
11	Q	74.7	Confident	66.7	Low	103 Å²	103	118 Å²	118	48%	0.481	63%	0.625	S	S	.	*	H	α-helix	trans	-71	-32.4	174	-69.6	-156.2	18.5	0	0	112.6	Q7 D8 E13 A15	Q7-Q11 HydrophobicContact CG-CB 4.16Å; D8-Q11 HydrophobicContact CB-CG 4.43Å; D8-Q11 WeakPolarHBondContact O-CA 3.47Å; D8-Q11 PolarHBondContact O-N 2.9Å; Q11-E13 VanDerWaalsContact C-N 3.34Å; Q11-A15 WeakPolarHBondContact O-CB 3.46Å; Q11-A15 PolarHBondContact O-N 3.29Å
12	V	77.2	Confident	68.2	Low	61 Å²	61	114 Å²	114	37%	0.37	61%	0.608	S	S	.	*	H	α-helix	trans	-66	-40.7	172.4	178.8	0	0	0	0	110.2	Q7 D8 P9 L16	Q7-V12 HydrophobicContact CB-CG2 3.68Å; Q7-V12 HydrophobicContact CG-CG2 3.73Å; D8-V12 PolarHBondContact O-N 2.92Å; P9-V12 PolarHBondContact O-N 2.88Å; V12-L16 HydrophobicContact CG1-CD1 3.96Å; V12-L16 HydrophobicContact CG1-CG 4.36Å; V12-L16 VanDerWaalsContact O-CB 3.25Å; V12-L16 WeakPolarHBondContact O-CB 3.48Å; V12-L16 WeakPolarHBondContact O-CG 3.44Å; V12-L16 PolarHBondContact O-N 3.33Å
13	E	76.2	Confident	69.7	Low	145 Å²	145	116.6 Å²	116.6	68%	0.678	60%	0.604	S	S	*	*	H	α-helix	trans	-67.2	-42.3	176.4	-173.2	172.6	-175	0	0	112	P9 E10 Q11 L16 G17	P9-E13 WeakPolarHBondContact O-CB 3.16Å; P9-E13 PolarHBondContact O-N 2.95Å; E10-E13 PolarHBondContact O-N 3.43Å; Q11-E13 VanDerWaalsContact C-N 3.34Å; E13-L16 PolarHBondContact O-N 3.42Å; E13-G17 PolarHBondContact O-N 3Å
14	E	76.1	Confident	71.1	Confident	128 Å²	128	116.1 Å²	116.1	60%	0.598	59%	0.592	S	S	*	*	H	α-helix	trans	-61	-48.4	172.7	-172.8	175.3	-161.9	0	0	110.9	E10 L16 G17 I18	E10-E14 WeakPolarHBondContact O-CB 3.21Å; E10-E14 PolarHBondContact O-N 2.85Å; E14-L16 VanDerWaalsContact C-N 3.33Å; E14-L16 PolarHBondContact O-N 2.98Å; E14-G17 WeakPolarHBondContact O-CA 3.44Å; E14-G17 PolarHBondContact O-N 3.39Å; E14-G17 VanDerWaalsContact O-N 3.09Å; E14-I18 HydrophobicContact CG-CD1 4.17Å; E14-I18 WeakPolarHBondContact O-CB 3.38Å; E14-I18 VanDerWaalsContact O-CG1 3.3Å; E14-I18 WeakPolarHBondContact O-CG1 3.44Å; E14-I18 PolarHBondContact O-N 2.81Å
15	A	75.8	Confident	72.7	Confident	46 Å²	46	116.1 Å²	116.1	38%	0.38	59%	0.589	S	S	.	*	H	α-helix	trans	-63.5	-35	176.1	0	0	0	0	0	113.1	Q11 I18 L19	Q11-A15 WeakPolarHBondContact O-CB 3.46Å; Q11-A15 PolarHBondContact O-N 3.29Å; A15-I18 WeakPolarHBondContact O-CB 3.36Å; A15-L19 VanDerWaalsContact O-CB 3.28Å; A15-L19 WeakPolarHBondContact O-CB 3.5Å; A15-L19 PolarHBondContact O-N 3.48Å
16	L	75.3	Confident	74.2	Confident	80 Å²	80	117.1 Å²	117.1	42%	0.419	59%	0.594	S	S	.	*	H	α-helix	trans	-71.4	-33.9	172.4	-79.7	170.3	0	0	0	112	V12 E13 E14 L19 K20	V12-L16 HydrophobicContact CG1-CD1 3.96Å; V12-L16 HydrophobicContact CG1-CG 4.36Å; V12-L16 VanDerWaalsContact O-CB 3.25Å; V12-L16 WeakPolarHBondContact O-CB 3.48Å; V12-L16 WeakPolarHBondContact O-CG 3.44Å; V12-L16 PolarHBondContact O-N 3.33Å; E13-L16 PolarHBondContact O-N 3.42Å; E14-L16 VanDerWaalsContact C-N 3.33Å; E14-L16 PolarHBondContact O-N 2.98Å; L16-L19 HydrophobicContact CD2-CD2 4.49Å; L16-K20 WeakPolarHBondContact O-CB 3.05Å; L16-K20 WeakPolarHBondContact O-CD 3.47Å; L16-K20 WeakPolarHBondContact O-CG 3.3Å; L16-K20 PolarHBondContact O-N 3.17Å
17	G	77	Confident	76.1	Confident	40 Å²	40	117.9 Å²	117.9	41%	0.412	59%	0.593	S	S	.	*	H	α-helix	trans	-63.8	-45.9	173.2	0	0	0	0	0	110.6	E13 E14 K20 D21	E13-G17 PolarHBondContact O-N 3Å; E14-G17 WeakPolarHBondContact O-CA 3.44Å; E14-G17 PolarHBondContact O-N 3.39Å; E14-G17 VanDerWaalsContact O-N 3.09Å; G17-K20 PolarHBondContact O-N 3.35Å; G17-D21 PolarHBondContact O-N 3.21Å; G17-D21 VanDerWaalsContact O-N 3.09Å
18	I	75	Confident	77.7	Confident	73 Å²	73	120.5 Å²	120.5	37%	0.374	60%	0.603	S	S	.	*	H	α-helix	trans	-56.4	-52.9	172.2	-77.1	168.4	0	0	0	111.2	E14 A15 K20 D21 E24	E14-I18 HydrophobicContact CG-CD1 4.17Å; E14-I18 WeakPolarHBondContact O-CB 3.38Å; E14-I18 VanDerWaalsContact O-CG1 3.3Å; E14-I18 WeakPolarHBondContact O-CG1 3.44Å; E14-I18 PolarHBondContact O-N 2.81Å; A15-I18 WeakPolarHBondContact O-CB 3.36Å; I18-K20 PolarHBondContact O-N 3.45Å; I18-K20 VanDerWaalsContact O-N 3.14Å; I18-D21 PolarHBondContact O-N 2.98Å; I18-E24 VanDerWaalsContact C-OE2 3.31Å; I18-E24 WeakPolarHBondContact CA-OE2 3.46Å; I18-E24 WeakPolarHBondContact CB-OE2 3.28Å; I18-E24 WeakPolarHBondContact CG1-OE1 3.39Å; I18-E24 WeakPolarHBondContact CG1-OE2 3.41Å; I18-E24 WeakPolarHBondContact CG2-OE1 3.17Å; I18-E24 WeakPolarHBondContact CG2-OE2 3.3Å
19	L	71.9	Confident	78.6	Confident	132 Å²	132	123.6 Å²	123.6	69%	0.691	61%	0.614	S	S	*	*	H	α-helix	trans	-61.9	-25.8	178.9	-175	63	0	0	0	113.5	A15 L16	A15-L19 VanDerWaalsContact O-CB 3.28Å; A15-L19 WeakPolarHBondContact O-CB 3.5Å; A15-L19 PolarHBondContact O-N 3.48Å; L16-L19 HydrophobicContact CD2-CD2 4.49Å
20	K	78.8	Confident	79.2	Confident	163 Å²	163	126.9 Å²	126.9	71%	0.709	62%	0.618	S	S	*	*	H	α-helix	trans	-87.3	-15.7	176.8	-73.9	171	-173.8	178.1	0	113	L16 G17 I18 D22	L16-K20 WeakPolarHBondContact O-CB 3.05Å; L16-K20 WeakPolarHBondContact O-CD 3.47Å; L16-K20 WeakPolarHBondContact O-CG 3.3Å; L16-K20 PolarHBondContact O-N 3.17Å; G17-K20 PolarHBondContact O-N 3.35Å; I18-K20 PolarHBondContact O-N 3.45Å; I18-K20 VanDerWaalsContact O-N 3.14Å; K20-D22 PolarHBondContact O-N 3.47Å
21	D	77.1	Confident	79.7	Confident	83 Å²	83	126 Å²	126	44%	0.444	61%	0.614	S	S	.	*			trans	-91.4	88.6	176.4	-163.3	-6.1	0	0	0	109.9	G17 I18 K23 E24	G17-D21 PolarHBondContact O-N 3.21Å; G17-D21 VanDerWaalsContact O-N 3.09Å; I18-D21 PolarHBondContact O-N 2.98Å; D21-K23 PolarHBondContact O-N 3.34Å; D21-K23 PolarHBondContact OD1-N 2.98Å; D21-E24 WeakPolarHBondContact O-CB 3.25Å; D21-E24 PolarHBondContact O-N 3.09Å
22	D	70.6	Confident	80.2	Confident	157 Å²	157	128.6 Å²	128.6	84%	0.84	63%	0.631	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.4	-10.6	175.7	-67.3	-22.9	0	0	0	113.7	K20	K20-D22 PolarHBondContact O-N 3.47Å
23	K	79.3	Confident	80.6	Confident	175 Å²	175	133.9 Å²	133.9	76%	0.761	64%	0.644	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.8	5.1	175.8	-54.7	-166.6	-163.7	70.7	0	114.2	D21 F25	D21-K23 PolarHBondContact O-N 3.34Å; D21-K23 PolarHBondContact OD1-N 2.98Å; K23-F25 VanDerWaalsContact C-N 3.26Å; K23-F25 PolarHBondContact O-N 3.06Å
24	E	83.7	Confident	81	Confident	86 Å²	86	132.1 Å²	132.1	40%	0.402	64%	0.639	S	S	.	*			trans	-66.1	-29.3	-177.3	-179.3	163.6	159	0	0	113.5	I18 D21 E26	I18-E24 VanDerWaalsContact C-OE2 3.31Å; I18-E24 WeakPolarHBondContact CA-OE2 3.46Å; I18-E24 WeakPolarHBondContact CB-OE2 3.28Å; I18-E24 WeakPolarHBondContact CG1-OE1 3.39Å; I18-E24 WeakPolarHBondContact CG1-OE2 3.41Å; I18-E24 WeakPolarHBondContact CG2-OE1 3.17Å; I18-E24 WeakPolarHBondContact CG2-OE2 3.3Å; D21-E24 WeakPolarHBondContact O-CB 3.25Å; D21-E24 PolarHBondContact O-N 3.09Å; E24-E26 PolarHBondContact O-N 2.79Å
25	F	83.2	Confident	81.2	Confident	175 Å²	175	131.8 Å²	131.8	77%	0.768	65%	0.646	S	S	*	*	S	Bend	trans	-79	120.7	173.5	-68.4	-82.3	0	0	0	110.4	K23	K23-F25 VanDerWaalsContact C-N 3.26Å; K23-F25 PolarHBondContact O-N 3.06Å
26	E	84.9	Confident	81.5	Confident	178 Å²	178	134.5 Å²	134.5	83%	0.832	66%	0.662	S	S	*	*			trans	-62.8	132	166.3	-60.9	-175.7	-171.7	0	0	109.1	E24 F28	E24-E26 PolarHBondContact O-N 2.79Å; E26-F28 PolarHBondContact O-N 3.4Å; E26-F28 VanDerWaalsContact O-N 3.12Å
27	E	87.4	Confident	82	Confident	170 Å²	170	135.5 Å²	135.5	79%	0.794	67%	0.665	S	S	*	*			trans	-62.6	115.5	176.5	-174.4	174.3	-178.8	0	0	108.9
28	F	89	Confident	82.1	Confident	172 Å²	172	139.1 Å²	139.1	75%	0.754	67%	0.671	S	S	*	*	P	Polyproline II helix	trans	-61.3	141.8	177.6	-73.7	-90.9	0	0	0	110.6	E26 K30	E26-F28 PolarHBondContact O-N 3.4Å; E26-F28 VanDerWaalsContact O-N 3.12Å; F28-K30 PolarHBondContact O-N 3.34Å
29	E	90	Very high	82.4	Confident	170 Å²	170	141.4 Å²	141.4	79%	0.794	68%	0.68	S	S	*	*	P	Polyproline II helix	trans	-57.8	135.9	171.3	-67.4	-65.6	163.6	0	0	109.8	E31	E29-E31 PolarHBondContact O-N 2.85Å
30	K	85.7	Confident	82.7	Confident	173 Å²	173	141.9 Å²	141.9	75%	0.752	68%	0.682	S	S	*	*	P	Polyproline II helix	trans	-72.5	126.2	177.1	-69.3	178.8	-177.9	170.6	0	109.8	F28 N32	F28-K30 PolarHBondContact O-N 3.34Å; K30-N32 PolarHBondContact O-N 2.87Å
31	E	84.9	Confident	82.6	Confident	137 Å²	137	138.1 Å²	138.1	64%	0.64	68%	0.676	S	S	*	*	P	Polyproline II helix	trans	-62.1	134.1	172.7	-67.9	74.4	-162.9	0	0	110.7	E29 W33	E29-E31 PolarHBondContact O-N 2.85Å; E31-W33 HydrophobicContact CB-CG 4.36Å
32	N	85.2	Confident	82.6	Confident	157 Å²	157	137.5 Å²	137.5	84%	0.84	67%	0.673	S	S	*	*			trans	-98.9	27.8	-174.4	69.1	-29.9	0	0	0	113.6	K30	K30-N32 PolarHBondContact O-N 2.87Å
33	W	85.8	Confident	83	Confident	171 Å²	171	136 Å²	136	65%	0.648	66%	0.664	S	S	*	*			trans	-68.9	136.6	175.6	48.5	2.8	0	0	0	113.2	E31 E37	E31-W33 HydrophobicContact CB-CG 4.36Å; W33-E37 VanDerWaalsContact CA-OE2 3.25Å; W33-E37 WeakPolarHBondContact CA-OE2 3.34Å
34	L	84.7	Confident	83	Confident	109 Å²	109	134.7 Å²	134.7	57%	0.571	66%	0.661	S	S	*	*			trans	-80.9	151.2	171.8	-72.3	142.9	0	0	0	109.9	S36 E37	L34-S36 PolarHBondContact O-N 2.87Å; L34-E37 HydrophobicContact CB-CG 4.11Å; L34-E37 PolarHBondContact N-OE2 2.91Å; L34-E37 WeakPolarHBondContact O-CA 3.47Å; L34-E37 WeakPolarHBondContact O-CB 3.43Å; L34-E37 PolarHBondContact O-N 3.39Å
35	T	79.7	Confident	83	Confident	121 Å²	121	135.5 Å²	135.5	74%	0.742	67%	0.671	S	S	*	*	G	3₁₀ helix	trans	-57.8	-23.3	173.3	-48	0	0	0	0	113	E37 E38	T35-E37 VanDerWaalsContact C-N 3.27Å; T35-E38 WeakPolarHBondContact O-CB 3.41Å
36	S	83.1	Confident	83.1	Confident	103 Å²	103	135.8 Å²	135.8	72%	0.72	67%	0.667	S	S	*	*	G	3₁₀ helix	trans	-75.7	-14.4	174.1	56.6	0	0	0	0	114.3	L34	L34-S36 PolarHBondContact O-N 2.87Å
37	E	84	Confident	82.9	Confident	101 Å²	101	130.7 Å²	130.7	47%	0.472	65%	0.646	S	S	.	*	G	3₁₀ helix	trans	-95.1	-1.8	177.1	-61.9	172.5	152.5	0	0	111.7	W33 L34 T35 E39	W33-E37 VanDerWaalsContact CA-OE2 3.25Å; W33-E37 WeakPolarHBondContact CA-OE2 3.34Å; L34-E37 HydrophobicContact CB-CG 4.11Å; L34-E37 PolarHBondContact N-OE2 2.91Å; L34-E37 WeakPolarHBondContact O-CA 3.47Å; L34-E37 WeakPolarHBondContact O-CB 3.43Å; L34-E37 PolarHBondContact O-N 3.39Å; T35-E37 VanDerWaalsContact C-N 3.27Å; E37-E39 PolarHBondContact O-N 3.34Å
38	E	80.3	Confident	82.5	Confident	116 Å²	116	126.7 Å²	126.7	54%	0.542	63%	0.63	S	S	.	*			trans	-66.8	111.1	172.6	-171.6	176.3	-175.3	0	0	108.9	T35	T35-E38 WeakPolarHBondContact O-CB 3.41Å
39	E	81.3	Confident	82.1	Confident	120 Å²	120	124.3 Å²	124.3	56%	0.561	62%	0.619	S	S	*	*			trans	-85.2	142	-179.5	-69.3	-66.6	151.5	0	0	109.9	E37 S41 D42	E37-E39 PolarHBondContact O-N 3.34Å; E39-S41 PolarHBondContact O-N 2.93Å; E39-D42 PolarHBondContact N-OD2 3.49Å; E39-D42 VanDerWaalsContact O-CB 3.29Å; E39-D42 WeakPolarHBondContact O-CB 3.32Å; E39-D42 PolarHBondContact O-N 3.26Å
40	I	77.4	Confident	81.7	Confident	142 Å²	142	125 Å²	125	73%	0.728	61%	0.614	S	S	*	*	G	3₁₀ helix	trans	-58.5	-26.8	178.6	-65.5	167.6	0	0	0	111.5	D42 L43	I40-D42 PolarHBondContact O-N 2.87Å; I40-L43 HydrophobicContact CG2-CD1 4.32Å; I40-L43 WeakPolarHBondContact O-CB 3.12Å; I40-L43 PolarHBondContact O-N 3.24Å
41	S	77.7	Confident	81.2	Confident	85 Å²	85	123.5 Å²	123.5	59%	0.594	62%	0.615	S	S	*	*	G	3₁₀ helix	trans	-61.3	-25.6	174.2	52.7	0	0	0	0	113.6	E39 L43 Q44	E39-S41 PolarHBondContact O-N 2.93Å; S41-L43 PolarHBondContact O-N 2.98Å; S41-Q44 PolarHBondContact O-N 3.03Å
42	D	77.4	Confident	80.9	Confident	70 Å²	70	123.9 Å²	123.9	37%	0.374	61%	0.612	S	S	.	*	G	3₁₀ helix	trans	-72.9	-14.8	-178.9	-59.7	-17.5	0	0	0	112.1	E39 I40 Q44 V45	E39-D42 PolarHBondContact N-OD2 3.49Å; E39-D42 VanDerWaalsContact O-CB 3.29Å; E39-D42 WeakPolarHBondContact O-CB 3.32Å; E39-D42 PolarHBondContact O-N 3.26Å; I40-D42 PolarHBondContact O-N 2.87Å; D42-Q44 VanDerWaalsContact C-N 3.29Å; D42-Q44 PolarHBondContact O-N 3.36Å; D42-V45 HydrophobicContact CB-CG2 4.49Å; D42-V45 WeakPolarHBondContact O-CG2 2.97Å
43	L	78	Confident	80.2	Confident	125 Å²	125	125.4 Å²	125.4	65%	0.654	61%	0.613	S	S	*	*	G	3₁₀ helix	trans	-70.3	-24.6	177.1	-63.6	176.2	0	0	0	112.9	I40 S41	I40-L43 HydrophobicContact CG2-CD1 4.32Å; I40-L43 WeakPolarHBondContact O-CB 3.12Å; I40-L43 PolarHBondContact O-N 3.24Å; S41-L43 PolarHBondContact O-N 2.98Å
44	Q	79.7	Confident	79.4	Confident	148 Å²	148	122.6 Å²	122.6	69%	0.692	62%	0.615	S	S	*	*	G	3₁₀ helix	trans	-119.1	44.6	-176.8	-62.7	-171.9	-92.2	0	0	111.9	S41 D42 W46	S41-Q44 PolarHBondContact O-N 3.03Å; D42-Q44 VanDerWaalsContact C-N 3.29Å; D42-Q44 PolarHBondContact O-N 3.36Å; Q44-W46 VanDerWaalsContact C-N 3.29Å
45	V	83.1	Confident	78.6	Confident	103 Å²	103	125.4 Å²	125.4	62%	0.624	63%	0.625	S	S	*	*			trans	-72.5	-26.6	177.6	175.2	0	0	0	0	111.9	D42	D42-V45 HydrophobicContact CB-CG2 4.49Å; D42-V45 WeakPolarHBondContact O-CG2 2.97Å
46	W	85.2	Confident	77.8	Confident	181 Å²	181	126.1 Å²	126.1	69%	0.686	62%	0.623	S	S	*	*	S	Bend	trans	-94.4	139.2	-177.5	-64.3	57.7	0	0	0	109.3	Q44 D48 W50	Q44-W46 VanDerWaalsContact C-N 3.29Å; W46-D48 PolarHBondContact O-N 3.46Å; W46-W50 HydrophobicContact CE3-CD2 4.22Å; W46-W50 AromaticContact CE3-CE3 3.55Å; W46-W50 HydrophobicContact CE3-CE3 3.55Å; W46-W50 HydrophobicContact CE3-CH2 4.46Å; W46-W50 AromaticContact CE3-CZ3 3.71Å; W46-W50 HydrophobicContact CE3-CZ3 3.71Å; W46-W50 HydrophobicContact CH2-CZ3 4.32Å; W46-W50 AromaticContact CZ3-CE3 3.59Å; W46-W50 HydrophobicContact CZ3-CE3 3.59Å; W46-W50 HydrophobicContact CZ3-CH2 4.24Å; W46-W50 AromaticContact CZ3-CZ3 3.35Å; W46-W50 HydrophobicContact CZ3-CZ3 3.35Å
47	D	81.1	Confident	76.9	Confident	71 Å²	71	126.2 Å²	126.2	38%	0.38	62%	0.616	S	S	.	*			trans	-69.6	122.8	178.2	-174	-17.8	0	0	0	109.2	K49 W50	D47-K49 PolarHBondContact O-N 3.36Å; D47-K49 VanDerWaalsContact OD1-CB 3.28Å; D47-K49 WeakPolarHBondContact OD1-CB 2.87Å; D47-K49 WeakPolarHBondContact OD1-CE 3.42Å; D47-K49 VanDerWaalsContact OD1-CG 3.3Å; D47-K49 WeakPolarHBondContact OD1-CG 2.97Å; D47-K49 PolarHBondContact OD1-N 2.85Å; D47-K49 IonicContact OD1-NZ 2.72Å; D47-K49 PolarHBondContact OD1-NZ 3.27Å; D47-K49 WeakPolarHBondContact OD2-CE 3.09Å; D47-K49 IonicContact OD2-NZ 2.63Å; D47-K49 PolarHBondContact OD2-NZ 3.39Å; D47-W50 VanDerWaalsContact O-CB 3.29Å; D47-W50 WeakPolarHBondContact O-CB 3.28Å; D47-W50 PolarHBondContact O-N 3.03Å
48	D	80	Confident	76.4	Confident	85 Å²	85	125.9 Å²	125.9	46%	0.455	62%	0.617	S	S	.	*	G	3₁₀ helix	trans	-53.1	-20.5	176.5	-61.1	-22.3	0	0	0	112.6	W46 W50 D51 Y52	W46-D48 PolarHBondContact O-N 3.46Å; D48-W50 PolarHBondContact O-N 2.99Å; D48-D51 PolarHBondContact O-N 3.3Å; D48-D51 VanDerWaalsContact O-N 3.12Å; D48-Y52 PolarHBondContact O-N 3.25Å; D48-Y52 VanDerWaalsContact O-N 3.09Å
49	K	79.1	Confident	76.6	Confident	122 Å²	122	126.5 Å²	126.5	53%	0.53	62%	0.62	S	S	.	*	G	3₁₀ helix	trans	-66.7	-15.9	172.2	-63.9	-175	-66.4	-63.8	0	114.5	D47 D51 Y52	D47-K49 PolarHBondContact O-N 3.36Å; D47-K49 VanDerWaalsContact OD1-CB 3.28Å; D47-K49 WeakPolarHBondContact OD1-CB 2.87Å; D47-K49 WeakPolarHBondContact OD1-CE 3.42Å; D47-K49 VanDerWaalsContact OD1-CG 3.3Å; D47-K49 WeakPolarHBondContact OD1-CG 2.97Å; D47-K49 PolarHBondContact OD1-N 2.85Å; D47-K49 IonicContact OD1-NZ 2.72Å; D47-K49 PolarHBondContact OD1-NZ 3.27Å; D47-K49 WeakPolarHBondContact OD2-CE 3.09Å; D47-K49 IonicContact OD2-NZ 2.63Å; D47-K49 PolarHBondContact OD2-NZ 3.39Å; K49-D51 VanDerWaalsContact C-N 3.33Å; K49-Y52 VanDerWaalsContact CA-CD2 3.44Å; K49-Y52 HydrophobicContact CB-CD2 3.89Å; K49-Y52 HydrophobicContact CB-CE2 4.29Å; K49-Y52 HydrophobicContact CG-CD2 3.56Å; K49-Y52 HydrophobicContact CG-CE2 3.55Å
50	W	81.7	Confident	76.7	Confident	184 Å²	184	127.4 Å²	127.4	70%	0.697	62%	0.622	S	S	*	*	G	3₁₀ helix	trans	-70.8	-34.8	169.9	-74.9	43.8	0	0	0	111	W46 D47 D48	W46-W50 HydrophobicContact CE3-CD2 4.22Å; W46-W50 AromaticContact CE3-CE3 3.55Å; W46-W50 HydrophobicContact CE3-CE3 3.55Å; W46-W50 HydrophobicContact CE3-CH2 4.46Å; W46-W50 AromaticContact CE3-CZ3 3.71Å; W46-W50 HydrophobicContact CE3-CZ3 3.71Å; W46-W50 HydrophobicContact CH2-CZ3 4.32Å; W46-W50 AromaticContact CZ3-CE3 3.59Å; W46-W50 HydrophobicContact CZ3-CE3 3.59Å; W46-W50 HydrophobicContact CZ3-CH2 4.24Å; W46-W50 AromaticContact CZ3-CZ3 3.35Å; W46-W50 HydrophobicContact CZ3-CZ3 3.35Å; D47-W50 VanDerWaalsContact O-CB 3.29Å; D47-W50 WeakPolarHBondContact O-CB 3.28Å; D47-W50 PolarHBondContact O-N 3.03Å; D48-W50 PolarHBondContact O-N 2.99Å
51	D	75.8	Confident	77.1	Confident	142 Å²	142	121.8 Å²	121.8	76%	0.759	59%	0.594	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.8	-18.3	175	-80.3	-3.7	0	0	0	112.6	D48 K49 E53	D48-D51 PolarHBondContact O-N 3.3Å; D48-D51 VanDerWaalsContact O-N 3.12Å; K49-D51 VanDerWaalsContact C-N 3.33Å; D51-E53 PolarHBondContact O-N 3.32Å
52	Y	79.3	Confident	77.5	Confident	146 Å²	146	121.6 Å²	121.6	57%	0.573	58%	0.584	S	S	*	*	S	Bend	trans	-62.5	115.1	170.5	-65.7	-22	0	0	0	108.6	D48 K49 V54	D48-Y52 PolarHBondContact O-N 3.25Å; D48-Y52 VanDerWaalsContact O-N 3.09Å; K49-Y52 VanDerWaalsContact CA-CD2 3.44Å; K49-Y52 HydrophobicContact CB-CD2 3.89Å; K49-Y52 HydrophobicContact CB-CE2 4.29Å; K49-Y52 HydrophobicContact CG-CD2 3.56Å; K49-Y52 HydrophobicContact CG-CE2 3.55Å; Y52-V54 PolarHBondContact O-N 3.32Å
53	E	68.8	Low	78.1	Confident	188 Å²	188	125.3 Å²	125.3	88%	0.879	59%	0.594	S	S	*	*			trans	-61	78.6	157.9	-62.6	-165	178.3	0	0	107.5	D51 E55	D51-E53 PolarHBondContact O-N 3.32Å; E53-E55 PolarHBondContact O-N 3.09Å
54	V	70.6	Confident	78.5	Confident	112 Å²	112	123.2 Å²	123.2	68%	0.679	58%	0.583	S	S	*	*			trans	-57.5	111.8	161	176.9	0	0	0	0	104.2	Y52 I56	Y52-V54 PolarHBondContact O-N 3.32Å; V54-I56 PolarHBondContact O-N 3.22Å; V54-I56 VanDerWaalsContact O-N 3.15Å
55	E	66.3	Low	78.9	Confident	168 Å²	168	122.6 Å²	122.6	79%	0.785	57%	0.574	S	S	*	*			trans	-48.3	127.4	-173.5	-70.6	-157.9	-167.3	0	0	109.3	E53 D57	E53-E55 PolarHBondContact O-N 3.09Å; E55-D57 PolarHBondContact O-N 2.99Å
56	I	64.8	Low	79.2	Confident	136 Å²	136	122.4 Å²	122.4	70%	0.697	57%	0.567	S	S	*	*	S	Bend	trans	-67.5	22	-172.8	-62	165.4	0	0	0	111.6	V54 D58 T61	V54-I56 PolarHBondContact O-N 3.22Å; V54-I56 VanDerWaalsContact O-N 3.15Å; I56-D58 VanDerWaalsContact C-N 3.31Å; I56-T61 HydrophobicContact CG2-CG2 3.96Å; I56-T61 WeakPolarHBondContact O-CB 3.47Å; I56-T61 VanDerWaalsContact O-CG2 3.23Å; I56-T61 WeakPolarHBondContact O-CG2 3.23Å; I56-T61 PolarHBondContact O-OG1 3.39Å
57	D	63.5	Low	79.4	Confident	106 Å²	106	118.1 Å²	118.1	57%	0.567	55%	0.554	S	S	*	*			trans	-97.4	31.3	168.6	-160.9	28.9	0	0	0	112.6	E55 Q62	E55-D57 PolarHBondContact O-N 2.99Å; D57-Q62 PolarHBondContact O-NE2 2.94Å; D57-Q62 WeakPolarHBondContact OD1-CG 3.34Å; D57-Q62 PolarHBondContact OD1-NE2 3.42Å
58	D	72.9	Confident	79.8	Confident	93 Å²	93	117.5 Å²	117.5	50%	0.497	55%	0.551	S	S	.	*	S	Bend	trans	-61	149.8	164.7	-174.4	24.9	0	0	0	110.4	I56 F60 T61 Q62	I56-D58 VanDerWaalsContact C-N 3.31Å; D58-F60 PolarHBondContact O-N 2.88Å; D58-T61 WeakPolarHBondContact O-CB 3.09Å; D58-T61 PolarHBondContact O-N 2.89Å; D58-Q62 PolarHBondContact O-N 3.37Å
59	Q	84.7	Confident	80.3	Confident	129 Å²	129	115.8 Å²	115.8	60%	0.603	54%	0.543	S	S	*	.	H	α-helix	trans	-51.9	-33	-179.7	-60.3	-175.1	-93.5	0	0	111.7	Q62 Y63	Q59-Q62 PolarHBondContact O-N 3.14Å; Q59-Y63 HydrophobicContact CB-CE2 4.39Å; Q59-Y63 WeakPolarHBondContact O-CD2 3.29Å; Q59-Y63 PolarHBondContact O-N 2.98Å
60	F	84.2	Confident	80.7	Confident	140 Å²	140	117 Å²	117	61%	0.614	55%	0.549	S	S	*	.	H	α-helix	trans	-59.1	-47.3	174	179.4	-103.6	0	0	0	112.6	D58 Q62 Y63 L64	D58-F60 PolarHBondContact O-N 2.88Å; F60-Q62 VanDerWaalsContact C-N 3.28Å; F60-Q62 PolarHBondContact O-N 2.86Å; F60-Y63 PolarHBondContact O-N 3.18Å; F60-L64 HydrophobicContact CE1-CD2 4.44Å; F60-L64 WeakPolarHBondContact O-CB 3.01Å; F60-L64 PolarHBondContact O-N 3.15Å
61	T	84.8	Confident	81	Confident	23 Å²	23	113.8 Å²	113.8	14%	0.141	54%	0.544	C	S	.	.	H	α-helix	trans	-63.3	-37.6	177.7	-50.4	0	0	0	0	111.1	I56 D58 L64 R65	I56-T61 HydrophobicContact CG2-CG2 3.96Å; I56-T61 WeakPolarHBondContact O-CB 3.47Å; I56-T61 VanDerWaalsContact O-CG2 3.23Å; I56-T61 WeakPolarHBondContact O-CG2 3.23Å; I56-T61 PolarHBondContact O-OG1 3.39Å; D58-T61 WeakPolarHBondContact O-CB 3.09Å; D58-T61 PolarHBondContact O-N 2.89Å; T61-L64 PolarHBondContact O-N 2.72Å; T61-R65 HydrophobicContact CG2-CG 4.39Å; T61-R65 WeakPolarHBondContact O-CB 3.39Å; T61-R65 VanDerWaalsContact O-CG 3.28Å; T61-R65 WeakPolarHBondContact O-CG 3.28Å; T61-R65 PolarHBondContact O-N 2.98Å
62	Q	87	Confident	81.4	Confident	81 Å²	81	109.3 Å²	109.3	38%	0.379	53%	0.532	S	S	.	.	H	α-helix	trans	-63	-46.4	176.2	-63.2	179.2	41.8	0	0	111.4	D57 D58 Q59 F60 R65 Q66	D57-Q62 PolarHBondContact O-NE2 2.94Å; D57-Q62 WeakPolarHBondContact OD1-CG 3.34Å; D57-Q62 PolarHBondContact OD1-NE2 3.42Å; D58-Q62 PolarHBondContact O-N 3.37Å; Q59-Q62 PolarHBondContact O-N 3.14Å; F60-Q62 VanDerWaalsContact C-N 3.28Å; F60-Q62 PolarHBondContact O-N 2.86Å; Q62-R65 PolarHBondContact O-N 3.12Å; Q62-Q66 VanDerWaalsContact O-CG 3.3Å; Q62-Q66 WeakPolarHBondContact O-CG 3.19Å; Q62-Q66 PolarHBondContact O-N 2.71Å
63	Y	88.9	Confident	81.6	Confident	148 Å²	148	108.9 Å²	108.9	58%	0.58	54%	0.535	S	S	*	.	H	α-helix	trans	-61.9	-43.3	174.6	-73.9	-58.5	0	0	0	112.1	Q59 F60 R65 Q66 E67	Q59-Y63 HydrophobicContact CB-CE2 4.39Å; Q59-Y63 WeakPolarHBondContact O-CD2 3.29Å; Q59-Y63 PolarHBondContact O-N 2.98Å; F60-Y63 PolarHBondContact O-N 3.18Å; Y63-R65 PolarHBondContact O-N 2.79Å; Y63-Q66 WeakPolarHBondContact O-CB 3.3Å; Y63-Q66 PolarHBondContact O-N 3.01Å; Y63-E67 PolarHBondContact O-N 2.72Å
64	L	87.9	Confident	81.9	Confident	82 Å²	82	103 Å²	103	43%	0.429	51%	0.509	S	S	.	.	H	α-helix	trans	-60.7	-44.7	177.1	-179.6	60.7	0	0	0	111.6	F60 T61 Q66 E67 L68	F60-L64 HydrophobicContact CE1-CD2 4.44Å; F60-L64 WeakPolarHBondContact O-CB 3.01Å; F60-L64 PolarHBondContact O-N 3.15Å; T61-L64 PolarHBondContact O-N 2.72Å; L64-Q66 PolarHBondContact O-N 2.63Å; L64-E67 PolarHBondContact O-N 2.98Å; L64-L68 HydrophobicContact CD1-CD1 4.24Å; L64-L68 HydrophobicContact CD1-CG 4.28Å; L64-L68 HydrophobicContact CG-CD1 4.12Å; L64-L68 WeakPolarHBondContact O-CB 3.25Å; L64-L68 WeakPolarHBondContact O-CG 3.29Å; L64-L68 PolarHBondContact O-N 3.09Å
65	R	86.4	Confident	81.8	Confident	134 Å²	134	105.5 Å²	105.5	51%	0.506	51%	0.513	S	S	.	.	H	α-helix	trans	-59.9	-45.1	175.1	-75.2	175.7	-176.3	-81.5	0.7	111.3	T61 Q62 Y63 E67 L68 T69	T61-R65 HydrophobicContact CG2-CG 4.39Å; T61-R65 WeakPolarHBondContact O-CB 3.39Å; T61-R65 VanDerWaalsContact O-CG 3.28Å; T61-R65 WeakPolarHBondContact O-CG 3.28Å; T61-R65 PolarHBondContact O-N 2.98Å; Q62-R65 PolarHBondContact O-N 3.12Å; Y63-R65 PolarHBondContact O-N 2.79Å; R65-E67 PolarHBondContact O-N 3.44Å; R65-L68 PolarHBondContact O-N 3.12Å; R65-T69 WeakPolarHBondContact O-CB 3.41Å; R65-T69 PolarHBondContact O-N 3.46Å; R65-T69 PolarHBondContact O-OG1 3.33Å
66	Q	89.5	Confident	81.7	Confident	99 Å²	99	105.7 Å²	105.7	46%	0.463	51%	0.514	S	S	.	.	H	α-helix	trans	-59.8	-45.2	177.5	-72.1	171.6	8.5	0	0	112.1	Q62 Y63 L64 T69 K70	Q62-Q66 VanDerWaalsContact O-CG 3.3Å; Q62-Q66 WeakPolarHBondContact O-CG 3.19Å; Q62-Q66 PolarHBondContact O-N 2.71Å; Y63-Q66 WeakPolarHBondContact O-CB 3.3Å; Y63-Q66 PolarHBondContact O-N 3.01Å; L64-Q66 PolarHBondContact O-N 2.63Å; Q66-T69 PolarHBondContact O-N 3.4Å; Q66-K70 WeakPolarHBondContact O-CG 3.48Å; Q66-K70 PolarHBondContact O-N 3.42Å
67	E	89.9	Confident	81.3	Confident	92 Å²	92	105.7 Å²	105.7	43%	0.43	52%	0.52	S	S	.	.	H	α-helix	trans	-65.2	-42.7	177.3	-71.1	-54.5	126.4	0	0	112.1	Y63 L64 R65 T69 K70 L71	Y63-E67 PolarHBondContact O-N 2.72Å; L64-E67 PolarHBondContact O-N 2.98Å; R65-E67 PolarHBondContact O-N 3.44Å; E67-T69 VanDerWaalsContact C-N 3.34Å; E67-T69 PolarHBondContact O-N 3.35Å; E67-K70 WeakPolarHBondContact O-CB 3.37Å; E67-K70 PolarHBondContact O-N 2.91Å; E67-K70 IonicContact OE1-NZ 2.67Å; E67-K70 PolarHBondContact OE1-NZ 3.41Å; E67-L71 WeakPolarHBondContact O-CG 3.46Å; E67-L71 PolarHBondContact O-N 3.43Å
68	L	89.8	Confident	80.3	Confident	57 Å²	57	111.5 Å²	111.5	30%	0.298	55%	0.552	S	S	.	*	H	α-helix	trans	-65.7	-35	176.1	-70.6	175.7	0	0	0	112.8	L64 R65 L71 G72 H73 L74	L64-L68 HydrophobicContact CD1-CD1 4.24Å; L64-L68 HydrophobicContact CD1-CG 4.28Å; L64-L68 HydrophobicContact CG-CD1 4.12Å; L64-L68 WeakPolarHBondContact O-CB 3.25Å; L64-L68 WeakPolarHBondContact O-CG 3.29Å; L64-L68 PolarHBondContact O-N 3.09Å; R65-L68 PolarHBondContact O-N 3.12Å; L68-L71 PolarHBondContact O-N 3.18Å; L68-G72 PolarHBondContact O-N 2.88Å; L68-G72 VanDerWaalsContact O-N 3.17Å; L68-H73 HydrophobicContact CB-CB 4.42Å; L68-H73 HydrophobicContact CD2-CB 4.25Å; L68-H73 PolarHBondContact O-N 2.84Å; L68-L74 HydrophobicContact CB-CD1 3.7Å; L68-L74 HydrophobicContact CD1-CD1 3.83Å; L68-L74 HydrophobicContact CG-CD1 4.44Å
69	T	89.4	Confident	80.7	Confident	49 Å²	49	112.5 Å²	112.5	30%	0.301	55%	0.554	S	S	.	*	H	α-helix	trans	-65	-43.1	171.6	-61.5	0	0	0	0	111	R65 Q66 E67 L71 G72 E76	R65-T69 WeakPolarHBondContact O-CB 3.41Å; R65-T69 PolarHBondContact O-N 3.46Å; R65-T69 PolarHBondContact O-OG1 3.33Å; Q66-T69 PolarHBondContact O-N 3.4Å; E67-T69 VanDerWaalsContact C-N 3.34Å; E67-T69 PolarHBondContact O-N 3.35Å; T69-L71 VanDerWaalsContact C-N 3.27Å; T69-L71 PolarHBondContact O-N 3.25Å; T69-G72 PolarHBondContact O-N 3.05Å; T69-E76 HydrophobicContact CG2-CG 4.15Å
70	K	88	Confident	80.5	Confident	149 Å²	149	111.6 Å²	111.6	65%	0.648	55%	0.552	S	S	*	*	H	α-helix	trans	-59.3	-38	174.6	-72.4	172.7	-171.9	170.1	0	112.5	Q66 E67 G72	Q66-K70 WeakPolarHBondContact O-CG 3.48Å; Q66-K70 PolarHBondContact O-N 3.42Å; E67-K70 WeakPolarHBondContact O-CB 3.37Å; E67-K70 PolarHBondContact O-N 2.91Å; E67-K70 IonicContact OE1-NZ 2.67Å; E67-K70 PolarHBondContact OE1-NZ 3.41Å; K70-G72 PolarHBondContact O-N 3.29Å
71	L	89.3	Confident	80.3	Confident	115 Å²	115	110 Å²	110	60%	0.602	55%	0.548	S	S	*	.	T	Hydrogen-bonded Turn	trans	-77.4	-4.8	176.5	-65.7	172.7	0	0	0	113.2	E67 L68 T69 H73	E67-L71 WeakPolarHBondContact O-CG 3.46Å; E67-L71 PolarHBondContact O-N 3.43Å; L68-L71 PolarHBondContact O-N 3.18Å; T69-L71 VanDerWaalsContact C-N 3.27Å; T69-L71 PolarHBondContact O-N 3.25Å; L71-H73 VanDerWaalsContact C-N 3.3Å; L71-H73 PolarHBondContact O-N 3.32Å
72	G	83	Confident	80	Confident	48 Å²	48	115.1 Å²	115.1	50%	0.495	57%	0.572	S	S	.	*	T	Hydrogen-bonded Turn	trans	75.1	14.9	179.9	0	0	0	0	0	114.3	L68 T69 K70	L68-G72 PolarHBondContact O-N 2.88Å; L68-G72 VanDerWaalsContact O-N 3.17Å; T69-G72 PolarHBondContact O-N 3.05Å; K70-G72 PolarHBondContact O-N 3.29Å
73	H	82.9	Confident	79.5	Confident	137 Å²	137	117.3 Å²	117.3	63%	0.634	58%	0.584	S	S	*	*	S	Bend	trans	-82.6	-21	178.2	-65.8	-43	0	0	0	113.1	L68 L71	L68-H73 HydrophobicContact CB-CB 4.42Å; L68-H73 HydrophobicContact CD2-CB 4.25Å; L68-H73 PolarHBondContact O-N 2.84Å; L71-H73 VanDerWaalsContact C-N 3.3Å; L71-H73 PolarHBondContact O-N 3.32Å
74	L	76.1	Confident	78.9	Confident	65 Å²	65	115.2 Å²	115.2	34%	0.34	59%	0.585	S	S	.	*	S	Bend	trans	-120.2	119.6	175.7	-94.2	151.4	0	0	0	109.3	L68	L68-L74 HydrophobicContact CB-CD1 3.7Å; L68-L74 HydrophobicContact CD1-CD1 3.83Å; L68-L74 HydrophobicContact CG-CD1 4.44Å
75	H	68.7	Low	78.3	Confident	165 Å²	165	117.6 Å²	117.6	76%	0.764	60%	0.596	S	S	*	*			trans	-82.8	126.3	171.1	-74.4	-129.1	0	0	0	108.3	T77	H75-T77 PolarHBondContact O-N 3.04Å
76	E	63.7	Low	77.7	Confident	171 Å²	171	116.3 Å²	116.3	80%	0.799	60%	0.603	S	S	*	*			trans	-57.9	107.6	171.7	-66.6	175.7	-178.9	0	0	109	T69 N78	T69-E76 HydrophobicContact CG2-CG 4.15Å; E76-N78 PolarHBondContact O-N 2.83Å
77	T	57.5	Low	76.7	Confident	136 Å²	136	117.8 Å²	117.8	83%	0.834	61%	0.614	S	S	*	*			trans	-78.3	102.2	168.3	54.2	0	0	0	0	107.4	H75	H75-T77 PolarHBondContact O-N 3.04Å
78	N	41.6	Very low	75.5	Confident	229 Å²	229	120.1 Å²	120.1	100%	1.225	63%	0.631	S	S	*	*			trans	-50.5	0	171	-177.2	28	0	0	0	112.3	E76	E76-N78 PolarHBondContact O-N 2.83Å

Retrieved 78 of 78 residues in 83.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).