A0AA82N8E3_SCHMA Loading...

Uncharacterized protein AlphaSync

AlphaFold DB , UniProt , Accession A0AA82N8E3, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 39 aa.

						>A0AA82N8E3_SCHMA|A0AA82N8E3
MFSQPYLVICNNANSGQQRVNALEKDEEALRDLNEQNNE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	67.8	Low	76.4	Confident	244 Å²	244	109.5 Å²	109.5	100%	1.202	57%	0.566	S	S	*	*				0	110.7	0	-167.6	165	-174.3	0	0	106.8
2	F	68.8	Low	76.7	Confident	140 Å²	140	109.5 Å²	109.5	61%	0.614	57%	0.568	S	S	*	*			trans	-68.4	136.2	178.7	-71.2	-78.6	0	0	0	109	Y6	F2-Y6 HydrophobicContact CB-CD1 3.93Å; F2-Y6 AromaticContact CD1-CD1 3.29Å; F2-Y6 HydrophobicContact CD1-CD1 3.29Å; F2-Y6 AromaticContact CD1-CE1 3.46Å; F2-Y6 HydrophobicContact CD1-CE1 3.46Å; F2-Y6 VanDerWaalsContact CD1-CE1 3.46Å; F2-Y6 AromaticContact CD1-CG 3.87Å; F2-Y6 HydrophobicContact CD1-CG 3.87Å; F2-Y6 AromaticContact CE1-CD1 3.95Å; F2-Y6 HydrophobicContact CE1-CD1 3.95Å; F2-Y6 AromaticContact CE1-CE1 3.6Å; F2-Y6 HydrophobicContact CE1-CE1 3.6Å; F2-Y6 AromaticContact CG-CD1 3.74Å; F2-Y6 HydrophobicContact CG-CD1 3.74Å; F2-Y6 HydrophobicContact CG-CE1 4.09Å; F2-Y6 HydrophobicContact CZ-CE1 4.34Å
3	S	75.9	Confident	77	Confident	70 Å²	70	105.8 Å²	105.8	49%	0.49	56%	0.563	S	S	.	*			trans	-65.7	145.3	175.4	59.9	0	0	0	0	109.2	P5 Y6 L7	S3-P5 VanDerWaalsContact C-N 3.25Å; S3-P5 VanDerWaalsContact O-N 3.16Å; S3-P5 WeakPolarHBondContact OG-CG 3.37Å; S3-Y6 WeakPolarHBondContact O-CB 3.36Å; S3-Y6 PolarHBondContact O-N 3.48Å; S3-L7 PolarHBondContact O-N 3Å
4	Q	75.8	Confident	77.6	Confident	145 Å²	145	105.1 Å²	105.1	68%	0.678	56%	0.56	S	S	*	*	H	α-helix	trans	-43.4	-43.3	174	-68.9	-71	0.8	0	0	114.1	Y6 L7 V8	Q4-Y6 VanDerWaalsContact C-N 3.3Å; Q4-Y6 PolarHBondContact O-N 3.1Å; Q4-L7 PolarHBondContact O-N 3.47Å; Q4-V8 WeakPolarHBondContact O-CG2 3.3Å; Q4-V8 PolarHBondContact O-N 3.08Å
5	P	79	Confident	78	Confident	79 Å²	79	102.1 Å²	102.1	51%	0.513	55%	0.55	S	S	.	.	H	α-helix	trans	-61.4	-34.2	177.5	21.8	-34.8	0	0	0	113.7	S3 V8 I9	S3-P5 VanDerWaalsContact C-N 3.25Å; S3-P5 VanDerWaalsContact O-N 3.16Å; S3-P5 WeakPolarHBondContact OG-CG 3.37Å; P5-V8 PolarHBondContact O-N 3.31Å; P5-I9 WeakPolarHBondContact O-CD1 3.47Å; P5-I9 VanDerWaalsContact O-CG1 3.26Å; P5-I9 WeakPolarHBondContact O-CG1 3.48Å; P5-I9 PolarHBondContact O-N 3.05Å
6	Y	79.1	Confident	78.7	Confident	114 Å²	114	97.5 Å²	97.5	45%	0.447	53%	0.534	S	S	.	.	H	α-helix	trans	-64.5	-44.5	177.8	-175.4	-95	0	0	0	111.5	F2 S3 Q4 V8 I9 C10	F2-Y6 HydrophobicContact CB-CD1 3.93Å; F2-Y6 AromaticContact CD1-CD1 3.29Å; F2-Y6 HydrophobicContact CD1-CD1 3.29Å; F2-Y6 AromaticContact CD1-CE1 3.46Å; F2-Y6 HydrophobicContact CD1-CE1 3.46Å; F2-Y6 VanDerWaalsContact CD1-CE1 3.46Å; F2-Y6 AromaticContact CD1-CG 3.87Å; F2-Y6 HydrophobicContact CD1-CG 3.87Å; F2-Y6 AromaticContact CE1-CD1 3.95Å; F2-Y6 HydrophobicContact CE1-CD1 3.95Å; F2-Y6 AromaticContact CE1-CE1 3.6Å; F2-Y6 HydrophobicContact CE1-CE1 3.6Å; F2-Y6 AromaticContact CG-CD1 3.74Å; F2-Y6 HydrophobicContact CG-CD1 3.74Å; F2-Y6 HydrophobicContact CG-CE1 4.09Å; F2-Y6 HydrophobicContact CZ-CE1 4.34Å; S3-Y6 WeakPolarHBondContact O-CB 3.36Å; S3-Y6 PolarHBondContact O-N 3.48Å; Q4-Y6 VanDerWaalsContact C-N 3.3Å; Q4-Y6 PolarHBondContact O-N 3.1Å; Y6-V8 VanDerWaalsContact C-N 3.33Å; Y6-V8 PolarHBondContact O-N 3.1Å; Y6-I9 PolarHBondContact O-N 3.45Å; Y6-C10 WeakPolarHBondContact CE1-SG 3.25Å; Y6-C10 PolarHBondContact O-N 2.92Å; Y6-C10 PolarHBondContact O-SG 3Å
7	L	77.3	Confident	79.4	Confident	79 Å²	79	97.9 Å²	97.9	41%	0.414	53%	0.531	S	S	.	.	H	α-helix	trans	-61.9	-39.9	177.4	-69.5	177.8	0	0	0	112.2	S3 Q4 C10 N11	S3-L7 PolarHBondContact O-N 3Å; Q4-L7 PolarHBondContact O-N 3.47Å; L7-C10 PolarHBondContact O-N 3.03Å; L7-N11 WeakPolarHBondContact O-CB 3.37Å; L7-N11 VanDerWaalsContact O-CG 3.25Å; L7-N11 PolarHBondContact O-N 3.2Å; L7-N11 PolarHBondContact O-ND2 3.31Å
8	V	78.5	Confident	79.9	Confident	78 Å²	78	100.2 Å²	100.2	47%	0.473	54%	0.538	S	S	.	.	H	α-helix	trans	-63	-44.2	176.2	174.8	0	0	0	0	111.2	Q4 P5 Y6 N11 N12	Q4-V8 WeakPolarHBondContact O-CG2 3.3Å; Q4-V8 PolarHBondContact O-N 3.08Å; P5-V8 PolarHBondContact O-N 3.31Å; Y6-V8 VanDerWaalsContact C-N 3.33Å; Y6-V8 PolarHBondContact O-N 3.1Å; V8-N11 PolarHBondContact O-N 2.94Å; V8-N12 WeakPolarHBondContact O-CB 3.49Å; V8-N12 PolarHBondContact O-N 3.1Å
9	I	79.3	Confident	80.6	Confident	112 Å²	112	104.1 Å²	104.1	57%	0.574	54%	0.544	S	S	*	.	H	α-helix	trans	-62	-46.4	177.9	-67	162	0	0	0	110.6	P5 Y6 N11 N12 A13	P5-I9 WeakPolarHBondContact O-CD1 3.47Å; P5-I9 VanDerWaalsContact O-CG1 3.26Å; P5-I9 WeakPolarHBondContact O-CG1 3.48Å; P5-I9 PolarHBondContact O-N 3.05Å; Y6-I9 PolarHBondContact O-N 3.45Å; I9-N11 PolarHBondContact O-N 3.36Å; I9-N12 PolarHBondContact O-N 2.97Å; I9-A13 WeakPolarHBondContact O-CB 3.48Å; I9-A13 PolarHBondContact O-N 3.33Å
10	C	79.7	Confident	81.1	Confident	38 Å²	38	102 Å²	102	26%	0.257	54%	0.536	S	S	.	.	H	α-helix	trans	-61.9	-43	178.1	-66.6	0	0	0	0	112.3	Y6 L7 A13 N14	Y6-C10 WeakPolarHBondContact CE1-SG 3.25Å; Y6-C10 PolarHBondContact O-N 2.92Å; Y6-C10 PolarHBondContact O-SG 3Å; L7-C10 PolarHBondContact O-N 3.03Å; C10-A13 PolarHBondContact O-N 3.06Å; C10-N14 WeakPolarHBondContact O-CB 3.44Å; C10-N14 VanDerWaalsContact O-CG 3.24Å; C10-N14 PolarHBondContact O-N 3Å; C10-N14 PolarHBondContact O-ND2 3.36Å
11	N	79.3	Confident	81.6	Confident	105 Å²	105	101 Å²	101	56%	0.561	53%	0.531	S	S	*	.	H	α-helix	trans	-64	-41.6	177.8	-73.4	-21.5	0	0	0	111.9	L7 V8 I9 N14 S15	L7-N11 WeakPolarHBondContact O-CB 3.37Å; L7-N11 VanDerWaalsContact O-CG 3.25Å; L7-N11 PolarHBondContact O-N 3.2Å; L7-N11 PolarHBondContact O-ND2 3.31Å; V8-N11 PolarHBondContact O-N 2.94Å; I9-N11 PolarHBondContact O-N 3.36Å; N11-N14 PolarHBondContact O-N 3.41Å; N11-S15 WeakPolarHBondContact O-CB 3.45Å; N11-S15 PolarHBondContact O-N 2.96Å
12	N	79.4	Confident	82.8	Confident	110 Å²	110	91.8 Å²	91.8	59%	0.588	49%	0.494	S	S	*	.	H	α-helix	trans	-65.6	-41.8	176.2	-73.5	-8.6	0	0	0	111.7	V8 I9 S15 G16	V8-N12 WeakPolarHBondContact O-CB 3.49Å; V8-N12 PolarHBondContact O-N 3.1Å; I9-N12 PolarHBondContact O-N 2.97Å; N12-S15 PolarHBondContact O-N 3.3Å; N12-G16 PolarHBondContact O-N 3.48Å
13	A	80.7	Confident	84	Confident	61 Å²	61	90 Å²	90	50%	0.504	49%	0.49	S	S	.	.	H	α-helix	trans	-62.5	-44.1	175.7	0	0	0	0	0	111.7	I9 C10 S15 G16 Q17	I9-A13 WeakPolarHBondContact O-CB 3.48Å; I9-A13 PolarHBondContact O-N 3.33Å; C10-A13 PolarHBondContact O-N 3.06Å; A13-S15 PolarHBondContact O-N 3.01Å; A13-G16 PolarHBondContact O-N 3.46Å; A13-Q17 PolarHBondContact O-N 2.83Å
14	N	85.3	Confident	84.9	Confident	97 Å²	97	92.2 Å²	92.2	52%	0.519	49%	0.493	S	S	.	.	H	α-helix	trans	-62.5	-41.8	176	-72.8	-18.7	0	0	0	112	C10 N11 Q17 Q18	C10-N14 WeakPolarHBondContact O-CB 3.44Å; C10-N14 VanDerWaalsContact O-CG 3.24Å; C10-N14 PolarHBondContact O-N 3Å; C10-N14 PolarHBondContact O-ND2 3.36Å; N11-N14 PolarHBondContact O-N 3.41Å; N14-Q17 PolarHBondContact O-N 3.41Å; N14-Q18 WeakPolarHBondContact O-CB 3.33Å; N14-Q18 VanDerWaalsContact O-CG 3.28Å; N14-Q18 WeakPolarHBondContact O-CG 3.42Å; N14-Q18 PolarHBondContact O-N 3.23Å
15	S	84.7	Confident	85.8	Confident	59 Å²	59	92.5 Å²	92.5	41%	0.413	49%	0.492	S	S	.	.	H	α-helix	trans	-65.2	-40.5	176.1	-176.5	0	0	0	0	111.9	N11 N12 A13 Q18 R19	N11-S15 WeakPolarHBondContact O-CB 3.45Å; N11-S15 PolarHBondContact O-N 2.96Å; N12-S15 PolarHBondContact O-N 3.3Å; A13-S15 PolarHBondContact O-N 3.01Å; S15-Q18 PolarHBondContact O-N 2.98Å; S15-R19 VanDerWaalsContact O-CG 3.31Å; S15-R19 WeakPolarHBondContact O-CG 3.48Å; S15-R19 PolarHBondContact O-N 2.98Å; S15-R19 VanDerWaalsContact O-N 3.13Å
16	G	88.7	Confident	86.5	Confident	29 Å²	29	93.3 Å²	93.3	30%	0.299	49%	0.492	S	S	.	.	H	α-helix	trans	-59.7	-49.1	173.3	0	0	0	0	0	112	N12 A13 Q18 R19 V20	N12-G16 PolarHBondContact O-N 3.48Å; A13-G16 PolarHBondContact O-N 3.46Å; G16-Q18 PolarHBondContact O-N 3.24Å; G16-R19 WeakPolarHBondContact O-CB 3.45Å; G16-R19 PolarHBondContact O-N 3.11Å; G16-V20 WeakPolarHBondContact O-CG2 3.31Å; G16-V20 PolarHBondContact O-N 2.98Å
17	Q	89.8	Confident	87.3	Confident	105 Å²	105	93 Å²	93	49%	0.491	49%	0.494	S	S	.	.	H	α-helix	trans	-64.1	-41	179.9	-168.7	62.5	52.7	0	0	112.3	A13 N14 R19 V20 N21	A13-Q17 PolarHBondContact O-N 2.83Å; N14-Q17 PolarHBondContact O-N 3.41Å; Q17-R19 VanDerWaalsContact C-N 3.27Å; Q17-R19 PolarHBondContact O-N 3.38Å; Q17-V20 PolarHBondContact O-N 3.28Å; Q17-N21 PolarHBondContact NE2-OD1 2.85Å; Q17-N21 PolarHBondContact O-N 3.04Å; Q17-N21 PolarHBondContact O-OD1 3.18Å; Q17-N21 VanDerWaalsContact O-OD1 3.12Å
18	Q	89.8	Confident	88.1	Confident	139 Å²	139	95 Å²	95	65%	0.65	50%	0.502	S	S	*	.	H	α-helix	trans	-59.4	-39.3	175.2	-76.2	174.6	-5.7	0	0	112.1	N14 S15 G16 A22	N14-Q18 WeakPolarHBondContact O-CB 3.33Å; N14-Q18 VanDerWaalsContact O-CG 3.28Å; N14-Q18 WeakPolarHBondContact O-CG 3.42Å; N14-Q18 PolarHBondContact O-N 3.23Å; S15-Q18 PolarHBondContact O-N 2.98Å; G16-Q18 PolarHBondContact O-N 3.24Å; Q18-A22 WeakPolarHBondContact O-CB 3.47Å; Q18-A22 PolarHBondContact O-N 3.32Å
19	R	91.6	Very high	88.9	Confident	173 Å²	173	94 Å²	94	65%	0.653	50%	0.501	S	S	*	.	H	α-helix	trans	-68.3	-41.8	176.3	-70.4	171.5	63.5	-159.6	-2.4	112	S15 G16 Q17 A22 L23	S15-R19 VanDerWaalsContact O-CG 3.31Å; S15-R19 WeakPolarHBondContact O-CG 3.48Å; S15-R19 PolarHBondContact O-N 2.98Å; S15-R19 VanDerWaalsContact O-N 3.13Å; G16-R19 WeakPolarHBondContact O-CB 3.45Å; G16-R19 PolarHBondContact O-N 3.11Å; Q17-R19 VanDerWaalsContact C-N 3.27Å; Q17-R19 PolarHBondContact O-N 3.38Å; R19-A22 PolarHBondContact O-N 2.9Å; R19-L23 WeakPolarHBondContact O-CG 3.28Å; R19-L23 PolarHBondContact O-N 3.36Å
20	V	91.4	Very high	89.6	Confident	63 Å²	63	94.1 Å²	94.1	38%	0.382	50%	0.502	S	S	.	.	H	α-helix	trans	-59.9	-49.1	174.8	171.8	0	0	0	0	110.2	G16 Q17 A22 L23 E24	G16-V20 WeakPolarHBondContact O-CG2 3.31Å; G16-V20 PolarHBondContact O-N 2.98Å; Q17-V20 PolarHBondContact O-N 3.28Å; V20-A22 VanDerWaalsContact C-N 3.27Å; V20-A22 PolarHBondContact O-N 2.86Å; V20-L23 PolarHBondContact O-N 3.12Å; V20-L23 VanDerWaalsContact O-N 3.11Å; V20-E24 HydrophobicContact CG1-CG 4.24Å; V20-E24 WeakPolarHBondContact O-CG 3.41Å; V20-E24 PolarHBondContact O-N 2.91Å
21	N	91.6	Very high	90.3	Very high	81 Å²	81	99.7 Å²	99.7	43%	0.433	52%	0.518	S	S	.	.	H	α-helix	trans	-59.9	-37.5	178.6	-63.9	0.8	0	0	0	112.4	Q17 K25	Q17-N21 PolarHBondContact NE2-OD1 2.85Å; Q17-N21 PolarHBondContact O-N 3.04Å; Q17-N21 PolarHBondContact O-OD1 3.18Å; Q17-N21 VanDerWaalsContact O-OD1 3.12Å; N21-K25 WeakPolarHBondContact O-CB 3.48Å; N21-K25 PolarHBondContact O-N 3.47Å
22	A	92.2	Very high	91	Very high	51 Å²	51	98.4 Å²	98.4	42%	0.421	51%	0.511	S	S	.	.	H	α-helix	trans	-66.8	-43.3	176.1	0	0	0	0	0	111.6	Q18 R19 V20 K25 D26	Q18-A22 WeakPolarHBondContact O-CB 3.47Å; Q18-A22 PolarHBondContact O-N 3.32Å; R19-A22 PolarHBondContact O-N 2.9Å; V20-A22 VanDerWaalsContact C-N 3.27Å; V20-A22 PolarHBondContact O-N 2.86Å; A22-K25 PolarHBondContact O-N 3.49Å; A22-D26 PolarHBondContact O-N 3.28Å
23	L	94.5	Very high	91.6	Very high	102 Å²	102	97.4 Å²	97.4	53%	0.534	51%	0.506	S	S	.	.	H	α-helix	trans	-66.9	-40.9	177.6	-70.9	171	0	0	0	112.5	R19 V20 K25 D26 E27	R19-L23 WeakPolarHBondContact O-CG 3.28Å; R19-L23 PolarHBondContact O-N 3.36Å; V20-L23 PolarHBondContact O-N 3.12Å; V20-L23 VanDerWaalsContact O-N 3.11Å; L23-K25 VanDerWaalsContact C-N 3.28Å; L23-K25 PolarHBondContact O-N 2.95Å; L23-D26 PolarHBondContact O-N 3.4Å; L23-E27 WeakPolarHBondContact O-CB 3.43Å; L23-E27 WeakPolarHBondContact O-CG 3.45Å; L23-E27 PolarHBondContact O-N 2.9Å
24	E	95.5	Very high	92.1	Very high	117 Å²	117	99 Å²	99	55%	0.547	51%	0.505	S	S	.	.	H	α-helix	trans	-59.8	-41.3	175.6	-74.4	176.2	160.5	0	0	111.2	V20 E27 E28	V20-E24 HydrophobicContact CG1-CG 4.24Å; V20-E24 WeakPolarHBondContact O-CG 3.41Å; V20-E24 PolarHBondContact O-N 2.91Å; E24-E27 PolarHBondContact O-N 3.19Å; E24-E28 WeakPolarHBondContact O-CB 3.48Å; E24-E28 PolarHBondContact O-N 3.13Å
25	K	94	Very high	92.4	Very high	150 Å²	150	100.6 Å²	100.6	65%	0.652	51%	0.51	S	S	*	.	H	α-helix	trans	-66.4	-41.2	175.7	-172.2	-179.6	177.9	-178.4	0	112.5	N21 A22 L23 E27 E28 A29	N21-K25 WeakPolarHBondContact O-CB 3.48Å; N21-K25 PolarHBondContact O-N 3.47Å; A22-K25 PolarHBondContact O-N 3.49Å; L23-K25 VanDerWaalsContact C-N 3.28Å; L23-K25 PolarHBondContact O-N 2.95Å; K25-E27 VanDerWaalsContact C-N 3.35Å; K25-E28 PolarHBondContact O-N 3.35Å; K25-A29 WeakPolarHBondContact O-CB 3.46Å; K25-A29 PolarHBondContact O-N 3.33Å
26	D	94.8	Very high	92.6	Very high	97 Å²	97	104 Å²	104	52%	0.519	52%	0.519	S	S	.	.	H	α-helix	trans	-65.8	-39.3	176.3	-72.5	-11.6	0	0	0	110.9	A22 L23 A29 L30	A22-D26 PolarHBondContact O-N 3.28Å; L23-D26 PolarHBondContact O-N 3.4Å; D26-A29 PolarHBondContact O-N 2.97Å; D26-L30 WeakPolarHBondContact O-CB 3.43Å; D26-L30 VanDerWaalsContact O-CG 3.25Å; D26-L30 WeakPolarHBondContact O-CG 3.26Å; D26-L30 PolarHBondContact O-N 3.48Å
27	E	94.2	Very high	92.3	Very high	106 Å²	106	108.1 Å²	108.1	50%	0.495	53%	0.534	S	S	.	.	H	α-helix	trans	-63.1	-44.5	174.3	-79.3	-169.7	-162.7	0	0	112.4	L23 E24 K25 L30 R31	L23-E27 WeakPolarHBondContact O-CB 3.43Å; L23-E27 WeakPolarHBondContact O-CG 3.45Å; L23-E27 PolarHBondContact O-N 2.9Å; E24-E27 PolarHBondContact O-N 3.19Å; K25-E27 VanDerWaalsContact C-N 3.35Å; E27-L30 PolarHBondContact O-N 2.9Å; E27-R31 VanDerWaalsContact O-CG 3.3Å; E27-R31 WeakPolarHBondContact O-CG 3.46Å; E27-R31 PolarHBondContact O-N 3.48Å; E27-R31 IonicContact OE2-NH2 3.2Å; E27-R31 PolarHBondContact OE2-NH2 3.38Å
28	E	95	Very high	92	Very high	122 Å²	122	108.9 Å²	108.9	57%	0.57	54%	0.542	S	S	*	.	H	α-helix	trans	-60.7	-48	176.4	-172.2	174.8	-157.1	0	0	110.8	E24 K25 L30 R31 D32	E24-E28 WeakPolarHBondContact O-CB 3.48Å; E24-E28 PolarHBondContact O-N 3.13Å; K25-E28 PolarHBondContact O-N 3.35Å; E28-L30 VanDerWaalsContact C-N 3.29Å; E28-L30 PolarHBondContact O-N 3.35Å; E28-R31 WeakPolarHBondContact O-CB 3.43Å; E28-R31 PolarHBondContact O-N 2.94Å; E28-R31 VanDerWaalsContact O-N 3.1Å; E28-D32 PolarHBondContact O-N 2.96Å
29	A	94.6	Very high	90.8	Very high	56 Å²	56	113.3 Å²	113.3	46%	0.463	56%	0.563	S	S	.	*	H	α-helix	trans	-61	-36.3	177.5	0	0	0	0	0	113	K25 D26 L33	K25-A29 WeakPolarHBondContact O-CB 3.46Å; K25-A29 PolarHBondContact O-N 3.33Å; D26-A29 PolarHBondContact O-N 2.97Å; A29-L33 WeakPolarHBondContact O-CB 3.37Å; A29-L33 PolarHBondContact O-N 3.31Å
30	L	94.6	Very high	90.8	Very high	115 Å²	115	110.4 Å²	110.4	60%	0.602	56%	0.558	S	S	*	*	H	α-helix	trans	-70.6	-35.4	175.8	-74.3	171.2	0	0	0	112.4	D26 E27 E28 N34	D26-L30 WeakPolarHBondContact O-CB 3.43Å; D26-L30 VanDerWaalsContact O-CG 3.25Å; D26-L30 WeakPolarHBondContact O-CG 3.26Å; D26-L30 PolarHBondContact O-N 3.48Å; E27-L30 PolarHBondContact O-N 2.9Å; E28-L30 VanDerWaalsContact C-N 3.29Å; E28-L30 PolarHBondContact O-N 3.35Å; L30-N34 WeakPolarHBondContact O-CB 3.45Å; L30-N34 PolarHBondContact O-N 2.99Å
31	R	94.2	Very high	90.7	Very high	156 Å²	156	112.8 Å²	112.8	59%	0.589	57%	0.567	S	S	*	*	H	α-helix	trans	-65.8	-48.4	174.3	-71.2	173.5	-165.9	-168.3	9.3	110.6	E27 E28 L33 N34 E35	E27-R31 VanDerWaalsContact O-CG 3.3Å; E27-R31 WeakPolarHBondContact O-CG 3.46Å; E27-R31 PolarHBondContact O-N 3.48Å; E27-R31 IonicContact OE2-NH2 3.2Å; E27-R31 PolarHBondContact OE2-NH2 3.38Å; E28-R31 WeakPolarHBondContact O-CB 3.43Å; E28-R31 PolarHBondContact O-N 2.94Å; E28-R31 VanDerWaalsContact O-N 3.1Å; R31-L33 VanDerWaalsContact C-N 3.31Å; R31-L33 PolarHBondContact O-N 3.42Å; R31-N34 PolarHBondContact O-N 3.42Å; R31-N34 VanDerWaalsContact O-N 3.08Å; R31-E35 PolarHBondContact O-N 2.91Å
32	D	94	Very high	90.7	Very high	78 Å²	78	114.6 Å²	114.6	42%	0.417	58%	0.575	S	S	.	*	H	α-helix	trans	-57.6	-44.1	177.1	-71.1	-6.3	0	0	0	111.7	E28 N34 E35 Q36	E28-D32 PolarHBondContact O-N 2.96Å; D32-N34 VanDerWaalsContact C-N 3.32Å; D32-N34 PolarHBondContact O-N 3.25Å; D32-E35 PolarHBondContact O-N 3.39Å; D32-Q36 WeakPolarHBondContact O-CG 3.43Å; D32-Q36 PolarHBondContact O-N 3.32Å
33	L	93.1	Very high	90.6	Very high	89 Å²	89	118.4 Å²	118.4	47%	0.466	58%	0.584	S	S	.	*	H	α-helix	trans	-64.1	-38.3	177.4	-176	65.8	0	0	0	112	A29 R31 N37	A29-L33 WeakPolarHBondContact O-CB 3.37Å; A29-L33 PolarHBondContact O-N 3.31Å; R31-L33 VanDerWaalsContact C-N 3.31Å; R31-L33 PolarHBondContact O-N 3.42Å; L33-N37 VanDerWaalsContact O-CG 3.3Å; L33-N37 PolarHBondContact O-N 2.92Å; L33-N37 VanDerWaalsContact O-N 3.1Å; L33-N37 PolarHBondContact O-ND2 3.4Å
34	N	91.1	Very high	90.4	Very high	93 Å²	93	119.4 Å²	119.4	50%	0.497	59%	0.587	S	S	.	*	H	α-helix	trans	-71.2	-35	178.6	-171.5	56.2	0	0	0	112.1	L30 R31 D32 N37 N38	L30-N34 WeakPolarHBondContact O-CB 3.45Å; L30-N34 PolarHBondContact O-N 2.99Å; R31-N34 PolarHBondContact O-N 3.42Å; R31-N34 VanDerWaalsContact O-N 3.08Å; D32-N34 VanDerWaalsContact C-N 3.32Å; D32-N34 PolarHBondContact O-N 3.25Å; N34-N37 PolarHBondContact O-N 3.07Å; N34-N38 VanDerWaalsContact O-CG 3.27Å; N34-N38 PolarHBondContact O-N 3.42Å; N34-N38 PolarHBondContact O-ND2 3.27Å
35	E	91.5	Very high	90	Very high	132 Å²	132	119.5 Å²	119.5	62%	0.617	59%	0.59	S	S	*	*	H	α-helix	trans	-64.1	-46.7	172.6	-72.5	-178.2	-172.4	0	0	111	R31 D32 N37 N38 E39	R31-E35 PolarHBondContact O-N 2.91Å; D32-E35 PolarHBondContact O-N 3.39Å; E35-N37 VanDerWaalsContact C-N 3.29Å; E35-N37 PolarHBondContact O-N 3.18Å; E35-N38 PolarHBondContact O-N 3.32Å; E35-N38 VanDerWaalsContact O-N 3.1Å; E35-E39 PolarHBondContact O-N 3.45Å
36	Q	87.5	Confident	89.7	Confident	131 Å²	131	117.4 Å²	117.4	61%	0.612	59%	0.585	S	S	*	*	H	α-helix	trans	-61.8	-32.2	176.7	-71.2	173.6	20.8	0	0	113.9	D32 N38	D32-Q36 WeakPolarHBondContact O-CG 3.43Å; D32-Q36 PolarHBondContact O-N 3.32Å; Q36-N38 VanDerWaalsContact C-N 3.31Å
37	N	83.9	Confident	89.3	Confident	114 Å²	114	118.9 Å²	118.9	61%	0.61	59%	0.59	S	S	*	*	H	α-helix	trans	-78.7	-15.1	178	-74.7	-39	0	0	0	113.4	L33 N34 E35	L33-N37 VanDerWaalsContact O-CG 3.3Å; L33-N37 PolarHBondContact O-N 2.92Å; L33-N37 VanDerWaalsContact O-N 3.1Å; L33-N37 PolarHBondContact O-ND2 3.4Å; N34-N37 PolarHBondContact O-N 3.07Å; E35-N37 VanDerWaalsContact C-N 3.29Å; E35-N37 PolarHBondContact O-N 3.18Å
38	N	82.3	Confident	88.9	Confident	122 Å²	122	120 Å²	120	65%	0.652	60%	0.598	S	S	*	*			trans	-97.9	-3.3	-179.3	-72.6	-31.3	0	0	0	113.5	N34 E35 Q36	N34-N38 VanDerWaalsContact O-CG 3.27Å; N34-N38 PolarHBondContact O-N 3.42Å; N34-N38 PolarHBondContact O-ND2 3.27Å; E35-N38 PolarHBondContact O-N 3.32Å; E35-N38 VanDerWaalsContact O-N 3.1Å; Q36-N38 VanDerWaalsContact C-N 3.31Å
39	E	65.6	Low	88.4	Confident	232 Å²	232	119.8 Å²	119.8	100%	1.084	60%	0.601	S	S	*	*			trans	-87.2	0	168.3	-66.8	-171.2	157.8	0	0	111.8	E35	E35-E39 PolarHBondContact O-N 3.45Å

Retrieved 39 of 39 residues in 55.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).