A0AA82N8L6_SCHMA Loading...

Uncharacterized protein AlphaSync

AlphaFold DB , UniProt , Accession A0AA82N8L6, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 34 aa.

						>A0AA82N8L6_SCHMA|A0AA82N8L6
MQQTYWLSCISYAFRLLMHLICYVCWVLQVFAQH
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	58.6	Low	82.1	Confident	218 Å²	218	128.7 Å²	128.7	100%	1.074	65%	0.646	S	S	*	*				0	14.6	0	-64.8	-168.6	-179.2	0	0	113.9	Y5	M1-Y5 VanDerWaalsContact O-CE2 3.22Å; M1-Y5 WeakPolarHBondContact O-CE2 3.35Å
2	Q	68.3	Low	83.2	Confident	157 Å²	157	132.1 Å²	132.1	73%	0.734	65%	0.648	S	S	*	*			trans	-95.1	-20.7	-172.7	-150.6	173.7	16.3	0	0	114.7	T4	Q2-T4 PolarHBondContact O-N 3.26Å
3	Q	72.2	Confident	84	Confident	173 Å²	173	125.8 Å²	125.8	81%	0.808	63%	0.63	S	S	*	*	H	α-helix	trans	-72.6	-27.6	-175.5	-69.8	-168.5	0.7	0	0	114	Y5	Q3-Y5 VanDerWaalsContact C-N 3.3Å; Q3-Y5 PolarHBondContact O-N 3.13Å
4	T	79.2	Confident	84.9	Confident	98 Å²	98	126.9 Å²	126.9	60%	0.601	63%	0.629	S	S	*	*	H	α-helix	trans	-67.9	-27.3	-178.1	-45.9	0	0	0	0	113.3	Q2 W6 S8	Q2-T4 PolarHBondContact O-N 3.26Å; T4-W6 VanDerWaalsContact C-N 3.35Å; T4-W6 PolarHBondContact O-N 3.32Å; T4-S8 PolarHBondContact O-N 3.03Å; T4-S8 PolarHBondContact O-OG 2.92Å
5	Y	85.2	Confident	85.7	Confident	159 Å²	159	129.5 Å²	129.5	62%	0.624	63%	0.629	S	S	*	*	H	α-helix	trans	-65.3	-37	-178.3	-64.8	-74.1	0	0	0	112.9	M1 Q3 S8 C9	M1-Y5 VanDerWaalsContact O-CE2 3.22Å; M1-Y5 WeakPolarHBondContact O-CE2 3.35Å; Q3-Y5 VanDerWaalsContact C-N 3.3Å; Q3-Y5 PolarHBondContact O-N 3.13Å; Y5-S8 PolarHBondContact O-N 3.16Å; Y5-C9 PolarHBondContact O-N 3.4Å; Y5-C9 PolarHBondContact O-SG 3.35Å
6	W	86.5	Confident	86.3	Confident	193 Å²	193	128.3 Å²	128.3	73%	0.731	63%	0.626	S	S	*	*	H	α-helix	trans	-64.7	-43.5	-177.6	-73.1	69.8	0	0	0	112.1	T4 S8 C9 I10	T4-W6 VanDerWaalsContact C-N 3.35Å; T4-W6 PolarHBondContact O-N 3.32Å; W6-S8 VanDerWaalsContact C-N 3.31Å; W6-S8 PolarHBondContact O-N 2.95Å; W6-C9 WeakPolarHBondContact O-CB 3.16Å; W6-C9 PolarHBondContact O-N 3.39Å; W6-I10 WeakPolarHBondContact O-CG1 3.38Å; W6-I10 PolarHBondContact O-N 2.9Å
7	L	86.5	Confident	86.9	Confident	119 Å²	119	126.4 Å²	126.4	62%	0.623	62%	0.619	S	S	*	*	H	α-helix	trans	-63	-39.8	177.8	-70.3	173.1	0	0	0	111.8	S11	L7-S11 WeakPolarHBondContact O-CB 3.4Å; L7-S11 PolarHBondContact O-N 3.09Å; L7-S11 PolarHBondContact O-OG 3.48Å
8	S	88.3	Confident	87.4	Confident	55 Å²	55	126.2 Å²	126.2	39%	0.385	62%	0.618	S	S	.	*	H	α-helix	trans	-62.7	-47.7	173.2	-62.6	0	0	0	0	111.1	T4 Y5 W6 I10 S11 Y12	T4-S8 PolarHBondContact O-N 3.03Å; T4-S8 PolarHBondContact O-OG 2.92Å; Y5-S8 PolarHBondContact O-N 3.16Å; W6-S8 VanDerWaalsContact C-N 3.31Å; W6-S8 PolarHBondContact O-N 2.95Å; S8-I10 VanDerWaalsContact C-N 3.35Å; S8-I10 PolarHBondContact O-N 3.48Å; S8-S11 PolarHBondContact O-N 3.27Å; S8-Y12 WeakPolarHBondContact O-CD2 3.5Å; S8-Y12 PolarHBondContact O-N 3.24Å
9	C	93.9	Very high	87.9	Confident	84 Å²	84	125.7 Å²	125.7	57%	0.568	61%	0.614	S	S	*	*	H	α-helix	trans	-57.6	-45	178.5	-70.2	0	0	0	0	112.6	Y5 W6 S11 Y12 A13	Y5-C9 PolarHBondContact O-N 3.4Å; Y5-C9 PolarHBondContact O-SG 3.35Å; W6-C9 WeakPolarHBondContact O-CB 3.16Å; W6-C9 PolarHBondContact O-N 3.39Å; C9-S11 PolarHBondContact O-N 3.49Å; C9-Y12 PolarHBondContact O-N 2.89Å; C9-A13 PolarHBondContact O-N 3.35Å
10	I	92.8	Very high	88.4	Confident	83 Å²	83	124 Å²	124	43%	0.426	61%	0.607	S	S	.	*	H	α-helix	trans	-62.1	-45.6	177.6	-67.9	166.8	0	0	0	110.2	W6 S8 Y12 A13 F14	W6-I10 WeakPolarHBondContact O-CG1 3.38Å; W6-I10 PolarHBondContact O-N 2.9Å; S8-I10 VanDerWaalsContact C-N 3.35Å; S8-I10 PolarHBondContact O-N 3.48Å; I10-Y12 VanDerWaalsContact C-N 3.32Å; I10-Y12 PolarHBondContact O-N 3.41Å; I10-A13 WeakPolarHBondContact O-CB 3.34Å; I10-A13 PolarHBondContact O-N 2.94Å; I10-A13 VanDerWaalsContact O-N 3.16Å; I10-F14 HydrophobicContact CG2-CD2 3.58Å; I10-F14 HydrophobicContact CG2-CE2 3.4Å; I10-F14 VanDerWaalsContact CG2-CE2 3.4Å; I10-F14 VanDerWaalsContact O-CD2 3.23Å; I10-F14 WeakPolarHBondContact O-CD2 3.24Å; I10-F14 PolarHBondContact O-N 2.92Å
11	S	92.2	Very high	88.8	Confident	77 Å²	77	122.9 Å²	122.9	54%	0.538	60%	0.603	S	S	.	*	H	α-helix	trans	-61.7	-39.3	178.5	-58.6	0	0	0	0	112.5	L7 S8 C9 R15	L7-S11 WeakPolarHBondContact O-CB 3.4Å; L7-S11 PolarHBondContact O-N 3.09Å; L7-S11 PolarHBondContact O-OG 3.48Å; S8-S11 PolarHBondContact O-N 3.27Å; C9-S11 PolarHBondContact O-N 3.49Å; S11-R15 WeakPolarHBondContact O-CB 3.46Å; S11-R15 PolarHBondContact O-N 3.49Å
12	Y	95.2	Very high	90.7	Very high	169 Å²	169	115.8 Å²	115.8	66%	0.663	57%	0.574	S	S	*	*	H	α-helix	trans	-65.1	-42.3	173.3	-83.5	-70.3	0	0	0	112.2	S8 C9 I10 R15 L16	S8-Y12 WeakPolarHBondContact O-CD2 3.5Å; S8-Y12 PolarHBondContact O-N 3.24Å; C9-Y12 PolarHBondContact O-N 2.89Å; I10-Y12 VanDerWaalsContact C-N 3.32Å; I10-Y12 PolarHBondContact O-N 3.41Å; Y12-R15 PolarHBondContact O-N 3.4Å; Y12-L16 PolarHBondContact O-N 3.22Å
13	A	93.8	Very high	92.1	Very high	50 Å²	50	115.3 Å²	115.3	41%	0.413	57%	0.566	S	S	.	*	H	α-helix	trans	-61.3	-46.2	176.8	0	0	0	0	0	111.7	C9 I10 R15 L16 L17	C9-A13 PolarHBondContact O-N 3.35Å; I10-A13 WeakPolarHBondContact O-CB 3.34Å; I10-A13 PolarHBondContact O-N 2.94Å; I10-A13 VanDerWaalsContact O-N 3.16Å; A13-R15 PolarHBondContact O-N 3.3Å; A13-L16 PolarHBondContact O-N 2.92Å; A13-L17 WeakPolarHBondContact O-CG 3.47Å; A13-L17 PolarHBondContact O-N 3.42Å
14	F	96	Very high	93.3	Very high	141 Å²	141	110.8 Å²	110.8	62%	0.618	55%	0.55	S	S	*	*	H	α-helix	trans	-62	-41.9	175.7	-81.9	-71.2	0	0	0	112.6	I10 L16 L17 M18	I10-F14 HydrophobicContact CG2-CD2 3.58Å; I10-F14 HydrophobicContact CG2-CE2 3.4Å; I10-F14 VanDerWaalsContact CG2-CE2 3.4Å; I10-F14 VanDerWaalsContact O-CD2 3.23Å; I10-F14 WeakPolarHBondContact O-CD2 3.24Å; I10-F14 PolarHBondContact O-N 2.92Å; F14-L16 VanDerWaalsContact C-N 3.32Å; F14-L16 PolarHBondContact O-N 3.01Å; F14-L17 PolarHBondContact O-N 3.44Å; F14-M18 PolarHBondContact O-N 3.35Å
15	R	96.4	Very high	94.2	Very high	166 Å²	166	109.2 Å²	109.2	63%	0.626	54%	0.542	S	S	*	.	H	α-helix	trans	-61.2	-40.7	176.3	179.9	177.2	-69.6	-91.2	-1.5	112	S11 Y12 A13 H19	S11-R15 WeakPolarHBondContact O-CB 3.46Å; S11-R15 PolarHBondContact O-N 3.49Å; Y12-R15 PolarHBondContact O-N 3.4Å; A13-R15 PolarHBondContact O-N 3.3Å; R15-H19 PolarHBondContact O-N 3.33Å; R15-H19 PolarHBondContact O-ND1 2.87Å
16	L	96.1	Very high	94.8	Very high	111 Å²	111	108.8 Å²	108.8	58%	0.581	54%	0.54	S	S	*	.	H	α-helix	trans	-67.1	-45.4	177.5	-174.5	65.1	0	0	0	111.1	Y12 A13 F14 M18 H19 L20	Y12-L16 PolarHBondContact O-N 3.22Å; A13-L16 PolarHBondContact O-N 2.92Å; F14-L16 VanDerWaalsContact C-N 3.32Å; F14-L16 PolarHBondContact O-N 3.01Å; L16-M18 PolarHBondContact O-N 3.22Å; L16-H19 PolarHBondContact O-N 3Å; L16-L20 HydrophobicContact CG-CD1 4.42Å; L16-L20 WeakPolarHBondContact O-CG 3.5Å; L16-L20 PolarHBondContact O-N 2.97Å
17	L	96.8	Very high	95.3	Very high	96 Å²	96	101.4 Å²	101.4	50%	0.503	52%	0.516	S	S	.	.	H	α-helix	trans	-59.8	-43.7	177.5	-72.7	172.5	0	0	0	112.2	A13 F14 H19 L20 I21	A13-L17 WeakPolarHBondContact O-CG 3.47Å; A13-L17 PolarHBondContact O-N 3.42Å; F14-L17 PolarHBondContact O-N 3.44Å; L17-H19 VanDerWaalsContact C-N 3.31Å; L17-H19 PolarHBondContact O-N 3.05Å; L17-L20 PolarHBondContact O-N 3.38Å; L17-I21 WeakPolarHBondContact O-CG1 3.35Å; L17-I21 PolarHBondContact O-N 3.44Å
18	M	96	Very high	95.9	Very high	123 Å²	123	100.9 Å²	100.9	61%	0.606	51%	0.513	S	S	*	.	H	α-helix	trans	-59.5	-42	176.5	-172.2	66.2	-178.9	0	0	111.8	F14 L16 I21 C22	F14-M18 PolarHBondContact O-N 3.35Å; L16-M18 PolarHBondContact O-N 3.22Å; M18-I21 PolarHBondContact O-N 3.35Å; M18-C22 PolarHBondContact O-N 3.27Å; M18-C22 PolarHBondContact O-SG 3.19Å; M18-C22 VanDerWaalsContact O-SG 3.36Å
19	H	97.2	Very high	96.3	Very high	116 Å²	116	104.4 Å²	104.4	54%	0.537	52%	0.524	S	S	.	.	H	α-helix	trans	-65.2	-40.7	176.2	-80.7	88	0	0	0	112.7	R15 L16 L17 I21 C22 Y23	R15-H19 PolarHBondContact O-N 3.33Å; R15-H19 PolarHBondContact O-ND1 2.87Å; L16-H19 PolarHBondContact O-N 3Å; L17-H19 VanDerWaalsContact C-N 3.31Å; L17-H19 PolarHBondContact O-N 3.05Å; H19-I21 VanDerWaalsContact C-N 3.34Å; H19-I21 PolarHBondContact O-N 3.36Å; H19-C22 PolarHBondContact O-N 2.86Å; H19-Y23 WeakPolarHBondContact O-CB 3.37Å; H19-Y23 PolarHBondContact O-N 3.27Å
20	L	96.5	Very high	96.5	Very high	92 Å²	92	103.3 Å²	103.3	48%	0.482	51%	0.514	S	S	.	.	H	α-helix	trans	-62.5	-42.1	177.6	-69.6	173.4	0	0	0	111.5	L16 L17 Y23 V24	L16-L20 HydrophobicContact CG-CD1 4.42Å; L16-L20 WeakPolarHBondContact O-CG 3.5Å; L16-L20 PolarHBondContact O-N 2.97Å; L17-L20 PolarHBondContact O-N 3.38Å; L20-Y23 PolarHBondContact O-N 3.43Å; L20-V24 WeakPolarHBondContact O-CG2 3.37Å; L20-V24 PolarHBondContact O-N 3.39Å
21	I	97.4	Very high	96.6	Very high	100 Å²	100	106 Å²	106	51%	0.513	52%	0.523	S	S	.	.	H	α-helix	trans	-63.3	-48.7	176.7	-65.8	165.7	0	0	0	110.3	L17 M18 H19 Y23 V24 C25	L17-I21 WeakPolarHBondContact O-CG1 3.35Å; L17-I21 PolarHBondContact O-N 3.44Å; M18-I21 PolarHBondContact O-N 3.35Å; H19-I21 VanDerWaalsContact C-N 3.34Å; H19-I21 PolarHBondContact O-N 3.36Å; I21-Y23 VanDerWaalsContact C-N 3.27Å; I21-Y23 PolarHBondContact O-N 2.96Å; I21-V24 PolarHBondContact O-N 3.47Å; I21-C25 PolarHBondContact O-N 2.95Å; I21-C25 PolarHBondContact O-SG 3.32Å; I21-C25 VanDerWaalsContact O-SG 3.42Å
22	C	98.1	Very high	96.6	Very high	69 Å²	69	106.3 Å²	106.3	47%	0.466	53%	0.531	S	S	.	.	H	α-helix	trans	-58.5	-40.6	176.5	-70.5	0	0	0	0	112.1	M18 H19 C25 W26	M18-C22 PolarHBondContact O-N 3.27Å; M18-C22 PolarHBondContact O-SG 3.19Å; M18-C22 VanDerWaalsContact O-SG 3.36Å; H19-C22 PolarHBondContact O-N 2.86Å; C22-C25 PolarHBondContact O-N 3.33Å; C22-W26 WeakPolarHBondContact O-CB 3.4Å; C22-W26 PolarHBondContact O-N 3.04Å
23	Y	97.5	Very high	96.3	Very high	147 Å²	147	106.6 Å²	106.6	58%	0.576	54%	0.538	S	S	*	.	H	α-helix	trans	-63.3	-45.5	176.6	-179	-102.9	0	0	0	111.9	H19 L20 I21 W26 V27	H19-Y23 WeakPolarHBondContact O-CB 3.37Å; H19-Y23 PolarHBondContact O-N 3.27Å; L20-Y23 PolarHBondContact O-N 3.43Å; I21-Y23 VanDerWaalsContact C-N 3.27Å; I21-Y23 PolarHBondContact O-N 2.96Å; Y23-W26 HydrophobicContact CD2-CE3 4.44Å; Y23-W26 HydrophobicContact CE2-CE3 4.3Å; Y23-W26 HydrophobicContact CE2-CZ3 4.33Å; Y23-W26 PolarHBondContact O-N 2.96Å; Y23-V27 HydrophobicContact CD1-CG2 4.33Å; Y23-V27 HydrophobicContact CE1-CG2 3.96Å; Y23-V27 HydrophobicContact CE2-CG2 4.36Å; Y23-V27 WeakPolarHBondContact O-CG2 3.33Å; Y23-V27 PolarHBondContact O-N 2.97Å
24	V	97.9	Very high	95.5	Very high	79 Å²	79	114.7 Å²	114.7	48%	0.479	57%	0.567	S	S	.	*	H	α-helix	trans	-63.6	-44.7	176.6	171.8	0	0	0	0	111.4	L20 I21 W26 V27 L28	L20-V24 WeakPolarHBondContact O-CG2 3.37Å; L20-V24 PolarHBondContact O-N 3.39Å; I21-V24 PolarHBondContact O-N 3.47Å; V24-W26 VanDerWaalsContact C-N 3.3Å; V24-W26 PolarHBondContact O-N 2.97Å; V24-V27 PolarHBondContact O-N 3.5Å; V24-L28 HydrophobicContact CG1-CD1 3.97Å; V24-L28 HydrophobicContact CG1-CG 4.31Å; V24-L28 WeakPolarHBondContact O-CG 3.48Å; V24-L28 PolarHBondContact O-N 3.16Å
25	C	98.3	Very high	95.5	Very high	64 Å²	64	113.4 Å²	113.4	43%	0.432	56%	0.564	S	S	.	*	H	α-helix	trans	-58.4	-43.8	175.2	-71.6	0	0	0	0	111.5	I21 C22 L28 Q29	I21-C25 PolarHBondContact O-N 2.95Å; I21-C25 PolarHBondContact O-SG 3.32Å; I21-C25 VanDerWaalsContact O-SG 3.42Å; C22-C25 PolarHBondContact O-N 3.33Å; C25-L28 PolarHBondContact O-N 3.4Å; C25-Q29 WeakPolarHBondContact O-CB 3.34Å; C25-Q29 VanDerWaalsContact O-CG 3.24Å; C25-Q29 WeakPolarHBondContact O-CG 3.5Å; C25-Q29 PolarHBondContact O-N 3.42Å
26	W	97.9	Very high	95.5	Very high	150 Å²	150	110.6 Å²	110.6	57%	0.568	56%	0.561	S	S	*	*	H	α-helix	trans	-61.1	-46.3	176.1	177.6	79.1	0	0	0	111.9	C22 Y23 V24 L28 Q29 V30	C22-W26 WeakPolarHBondContact O-CB 3.4Å; C22-W26 PolarHBondContact O-N 3.04Å; Y23-W26 HydrophobicContact CD2-CE3 4.44Å; Y23-W26 HydrophobicContact CE2-CE3 4.3Å; Y23-W26 HydrophobicContact CE2-CZ3 4.33Å; Y23-W26 PolarHBondContact O-N 2.96Å; V24-W26 VanDerWaalsContact C-N 3.3Å; V24-W26 PolarHBondContact O-N 2.97Å; W26-L28 PolarHBondContact O-N 2.92Å; W26-Q29 WeakPolarHBondContact O-CB 3.23Å; W26-Q29 PolarHBondContact O-N 3.22Å; W26-V30 HydrophobicContact CD2-CG2 4.37Å; W26-V30 HydrophobicContact CH2-CG2 4.46Å; W26-V30 HydrophobicContact CZ2-CG2 4.1Å; W26-V30 WeakPolarHBondContact O-CG2 3.13Å; W26-V30 PolarHBondContact O-N 3.18Å
27	V	97.6	Very high	95.4	Very high	38 Å²	38	110.6 Å²	110.6	23%	0.23	56%	0.56	C	S	.	*	H	α-helix	trans	-60.3	-46.7	176.4	171.3	0	0	0	0	111.4	Y23 V24 Q29 V30 F31	Y23-V27 HydrophobicContact CD1-CG2 4.33Å; Y23-V27 HydrophobicContact CE1-CG2 3.96Å; Y23-V27 HydrophobicContact CE2-CG2 4.36Å; Y23-V27 WeakPolarHBondContact O-CG2 3.33Å; Y23-V27 PolarHBondContact O-N 2.97Å; V24-V27 PolarHBondContact O-N 3.5Å; V27-Q29 VanDerWaalsContact C-N 3.3Å; V27-Q29 PolarHBondContact O-N 2.96Å; V27-V30 WeakPolarHBondContact O-CB 3.43Å; V27-V30 PolarHBondContact O-N 3.44Å; V27-V30 VanDerWaalsContact O-N 3.16Å; V27-F31 HydrophobicContact CG1-CD2 3.74Å; V27-F31 HydrophobicContact CG1-CE2 3.47Å; V27-F31 VanDerWaalsContact CG1-CE2 3.47Å; V27-F31 WeakPolarHBondContact O-CD2 3.44Å; V27-F31 PolarHBondContact O-N 3.32Å; V27-F31 VanDerWaalsContact O-N 3.09Å
28	L	97.7	Very high	95.3	Very high	109 Å²	109	111.5 Å²	111.5	57%	0.571	56%	0.563	S	S	*	*	H	α-helix	trans	-62.1	-37.8	178.2	-71.4	174	0	0	0	112.2	V24 C25 W26 F31 A32	V24-L28 HydrophobicContact CG1-CD1 3.97Å; V24-L28 HydrophobicContact CG1-CG 4.31Å; V24-L28 WeakPolarHBondContact O-CG 3.48Å; V24-L28 PolarHBondContact O-N 3.16Å; C25-L28 PolarHBondContact O-N 3.4Å; W26-L28 PolarHBondContact O-N 2.92Å; L28-F31 PolarHBondContact O-N 3.41Å; L28-A32 WeakPolarHBondContact O-CB 3.36Å; L28-A32 PolarHBondContact O-N 3.26Å
29	Q	97.2	Very high	95.3	Very high	128 Å²	128	110.8 Å²	110.8	60%	0.598	56%	0.561	S	S	*	*	H	α-helix	trans	-64.2	-39.8	174.6	-74.6	174.9	-49.7	0	0	112.1	C25 W26 V27 F31 A32 Q33	C25-Q29 WeakPolarHBondContact O-CB 3.34Å; C25-Q29 VanDerWaalsContact O-CG 3.24Å; C25-Q29 WeakPolarHBondContact O-CG 3.5Å; C25-Q29 PolarHBondContact O-N 3.42Å; W26-Q29 WeakPolarHBondContact O-CB 3.23Å; W26-Q29 PolarHBondContact O-N 3.22Å; V27-Q29 VanDerWaalsContact C-N 3.3Å; V27-Q29 PolarHBondContact O-N 2.96Å; Q29-F31 VanDerWaalsContact C-N 3.32Å; Q29-F31 PolarHBondContact O-N 2.84Å; Q29-A32 PolarHBondContact O-N 3.49Å; Q29-Q33 WeakPolarHBondContact O-CG 3.22Å; Q29-Q33 PolarHBondContact O-N 3.34Å
30	V	97.1	Very high	95.2	Very high	62 Å²	62	110.4 Å²	110.4	38%	0.376	56%	0.562	S	S	.	*	H	α-helix	trans	-61.7	-40.6	174.9	172	0	0	0	0	111.1	W26 V27	W26-V30 HydrophobicContact CD2-CG2 4.37Å; W26-V30 HydrophobicContact CH2-CG2 4.46Å; W26-V30 HydrophobicContact CZ2-CG2 4.1Å; W26-V30 WeakPolarHBondContact O-CG2 3.13Å; W26-V30 PolarHBondContact O-N 3.18Å; V27-V30 WeakPolarHBondContact O-CB 3.43Å; V27-V30 PolarHBondContact O-N 3.44Å; V27-V30 VanDerWaalsContact O-N 3.16Å
31	F	96	Very high	95.1	Very high	139 Å²	139	111.7 Å²	111.7	61%	0.61	57%	0.568	S	S	*	*	H	α-helix	trans	-72	-35.9	176.4	-76.3	-71.8	0	0	0	113.6	V27 L28 Q29 Q33 H34	V27-F31 HydrophobicContact CG1-CD2 3.74Å; V27-F31 HydrophobicContact CG1-CE2 3.47Å; V27-F31 VanDerWaalsContact CG1-CE2 3.47Å; V27-F31 WeakPolarHBondContact O-CD2 3.44Å; V27-F31 PolarHBondContact O-N 3.32Å; V27-F31 VanDerWaalsContact O-N 3.09Å; L28-F31 PolarHBondContact O-N 3.41Å; Q29-F31 VanDerWaalsContact C-N 3.32Å; Q29-F31 PolarHBondContact O-N 2.84Å; F31-Q33 PolarHBondContact O-N 3.05Å; F31-H34 PolarHBondContact O-N 3.43Å; F31-H34 VanDerWaalsContact O-N 3.13Å
32	A	91	Very high	94.9	Very high	84 Å²	84	112.6 Å²	112.6	69%	0.694	57%	0.572	S	S	*	*	H	α-helix	trans	-70.3	-13.4	-179.7	0	0	0	0	0	113.8	L28 Q29	L28-A32 WeakPolarHBondContact O-CB 3.36Å; L28-A32 PolarHBondContact O-N 3.26Å; Q29-A32 PolarHBondContact O-N 3.49Å
33	Q	90.7	Very high	94.6	Very high	175 Å²	175	116.3 Å²	116.3	82%	0.818	58%	0.581	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.2	-10.9	173.1	-71.8	-173.8	-42	0	0	113.4	Q29 F31	Q29-Q33 WeakPolarHBondContact O-CG 3.22Å; Q29-Q33 PolarHBondContact O-N 3.34Å; F31-Q33 PolarHBondContact O-N 3.05Å
34	H	76.6	Confident	94.4	Very high	220 Å²	220	113.5 Å²	113.5	100%	1.019	58%	0.581	S	S	*	*			trans	-93	0	172.8	-88.3	-74	0	0	0	111.3	F31	F31-H34 PolarHBondContact O-N 3.43Å; F31-H34 VanDerWaalsContact O-N 3.13Å

Retrieved 34 of 34 residues in 56.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).