A0AA82N8M4_SCHMA Loading...

Plexin AlphaSync

AlphaFold DB , UniProt , Accession A0AA82N8M4, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 141 aa.

						>A0AA82N8M4_SCHMA|A0AA82N8M4
QILKEFDENNLQSWIYYRYKCLDKQNVSVPEPYNRIQIPKKFIKSRILVEFEPNTESCFMKVSNETCLDASKPDMECHWCLTANLCSNGRDTHSKAWMIKNCPKIDNKPMFNYLYVLIPSVIGLVIVCVGFIVWFWLSKRQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	Q	49.6	Very low	65.2	Low	247 Å²	247	138.7 Å²	138.7	100%	1.154	68%	0.676	S	S	*	*				0	111.5	0	-106.7	171.1	-10.4	0	0	107.4	L3	Q1-L3 PolarHBondContact O-N 3.35Å
2	I	48.5	Very low	67.1	Low	170 Å²	170	137.4 Å²	137.4	87%	0.872	67%	0.668	S	S	*	*	P	Polyproline II helix	trans	-74.7	117.8	175.9	-63.4	169.9	0	0	0	106.6	K4	I2-K4 PolarHBondContact O-N 2.92Å
3	L	56	Low	68.7	Low	138 Å²	138	130.7 Å²	130.7	72%	0.723	64%	0.643	S	S	*	*	P	Polyproline II helix	trans	-63.6	118.1	175.1	-140.8	82.1	0	0	0	107.1	Q1 E5 F6	Q1-L3 PolarHBondContact O-N 3.35Å; L3-E5 PolarHBondContact O-N 3.17Å; L3-F6 HydrophobicContact CD2-CE2 3.89Å; L3-F6 HydrophobicContact CG-CE2 4.05Å
4	K	62.2	Low	70.1	Confident	180 Å²	180	129.6 Å²	129.6	78%	0.783	63%	0.629	S	S	*	*	P	Polyproline II helix	trans	-56.5	128.3	169.6	-83.7	-179.5	173.7	179.9	0	107.7	I2 F6	I2-K4 PolarHBondContact O-N 2.92Å; K4-F6 WeakPolarHBondContact O-CD2 3.24Å; K4-F6 PolarHBondContact O-N 2.91Å; K4-F6 VanDerWaalsContact O-N 3.08Å
5	E	61	Low	71.1	Confident	197 Å²	197	126.5 Å²	126.5	92%	0.921	62%	0.615	S	S	*	*			trans	-57.8	113.1	172.8	-164.7	168.4	-167.2	0	0	107.8	L3	L3-E5 PolarHBondContact O-N 3.17Å
6	F	67.2	Low	72	Confident	132 Å²	132	127.1 Å²	127.1	58%	0.579	61%	0.61	S	S	*	*			trans	-78.1	130	179.2	-64.3	-84.6	0	0	0	108	L3 K4 E8 L11	L3-F6 HydrophobicContact CD2-CE2 3.89Å; L3-F6 HydrophobicContact CG-CE2 4.05Å; K4-F6 WeakPolarHBondContact O-CD2 3.24Å; K4-F6 PolarHBondContact O-N 2.91Å; K4-F6 VanDerWaalsContact O-N 3.08Å; F6-E8 PolarHBondContact O-N 3.36Å; F6-L11 HydrophobicContact CB-CD1 4.36Å
7	D	69.9	Low	72.5	Confident	81 Å²	81	128.6 Å²	128.6	43%	0.433	61%	0.61	S	S	.	*			trans	-68.8	100.1	171.6	178.6	6.4	0	0	0	109.5	N9 N10	D7-N9 PolarHBondContact O-N 2.84Å; D7-N9 VanDerWaalsContact O-N 3.09Å; D7-N9 WeakPolarHBondContact OD1-CB 3.28Å; D7-N9 PolarHBondContact OD1-N 3.07Å; D7-N9 VanDerWaalsContact OD1-N 3.13Å; D7-N9 PolarHBondContact OD1-ND2 3.31Å; D7-N10 PolarHBondContact O-N 3.11Å; D7-N10 PolarHBondContact OD2-ND2 3.3Å
8	E	68.6	Low	73	Confident	79 Å²	79	129.8 Å²	129.8	37%	0.369	61%	0.607	S	S	.	*	G	3₁₀ helix	trans	-56.4	-26.3	-177.4	-63.1	-170	153.2	0	0	112.5	F6 N10 L11 K44 S45	F6-E8 PolarHBondContact O-N 3.36Å; E8-N10 PolarHBondContact O-N 3.3Å; E8-L11 PolarHBondContact O-N 2.97Å; E8-K44 WeakPolarHBondContact OE1-CA 3.36Å; E8-S45 PolarHBondContact OE1-N 3.31Å
9	N	70.6	Confident	73.5	Confident	118 Å²	118	125.8 Å²	125.8	63%	0.631	59%	0.586	S	S	*	*	G	3₁₀ helix	trans	-69.5	-24.1	179.8	-63.5	-51.9	0	0	0	113.4	D7 K40	D7-N9 PolarHBondContact O-N 2.84Å; D7-N9 VanDerWaalsContact O-N 3.09Å; D7-N9 WeakPolarHBondContact OD1-CB 3.28Å; D7-N9 PolarHBondContact OD1-N 3.07Å; D7-N9 VanDerWaalsContact OD1-N 3.13Å; D7-N9 PolarHBondContact OD1-ND2 3.31Å; N9-K40 PolarHBondContact O-NZ 3.31Å
10	N	80.4	Confident	73.9	Confident	122 Å²	122	127.9 Å²	127.9	65%	0.652	59%	0.593	S	S	*	*	G	3₁₀ helix	trans	-97.2	-3.8	-178.9	-77.9	-38.4	0	0	0	113.1	D7 E8	D7-N10 PolarHBondContact O-N 3.11Å; D7-N10 PolarHBondContact OD2-ND2 3.3Å; E8-N10 PolarHBondContact O-N 3.3Å
11	L	83.6	Confident	74.3	Confident	62 Å²	62	123.2 Å²	123.2	33%	0.325	58%	0.575	S	S	.	*			trans	-77.2	136.9	176	-61.3	178.6	0	0	0	110.9	F6 E8 I43	F6-L11 HydrophobicContact CB-CD1 4.36Å; E8-L11 PolarHBondContact O-N 2.97Å; L11-I43 HydrophobicContact CB-CG2 3.7Å; L11-I43 HydrophobicContact CD1-CG2 3.91Å; L11-I43 HydrophobicContact CG-CG2 4.48Å
12	Q	87.5	Confident	76.1	Confident	123 Å²	123	117.3 Å²	117.3	58%	0.575	55%	0.55	S	S	*	*			trans	-127.5	137.9	169.3	-62.5	-175.8	17.5	0	0	107.7	W14	Q12-W14 HydrophobicContact CB-CE3 4.27Å; Q12-W14 HydrophobicContact CB-CZ3 3.86Å
13	S	87.6	Confident	77.9	Confident	50 Å²	50	112 Å²	112	35%	0.35	52%	0.524	S	S	.	.			trans	-138.2	145.1	176	-169.1	0	0	0	0	108.8	I38	S13-I38 WeakPolarHBondContact O-CB 3.49Å; S13-I38 PolarHBondContact O-N 2.93Å; S13-I38 WeakPolarHBondContact OG-CD1 3.47Å
14	W	88.5	Confident	79.4	Confident	115 Å²	115	116 Å²	116	44%	0.436	54%	0.535	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-151.9	149.9	178	57.3	82.9	0	0	0	110.4	Q12 Y16 I36	Q12-W14 HydrophobicContact CB-CE3 4.27Å; Q12-W14 HydrophobicContact CB-CZ3 3.86Å; W14-Y16 AromaticContact CD1-CD1 3.75Å; W14-Y16 AromaticContact NE1-CD1 3.68Å; W14-I36 CarbonylContact C-O 3.48Å; W14-I36 WeakPolarHBondContact CA-O 3.38Å; W14-I36 WeakPolarHBondContact CB-O 3.3Å
15	I	85.9	Confident	80.7	Confident	84 Å²	84	115 Å²	115	43%	0.431	53%	0.534	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.2	131	164.9	-59.3	175.7	0	0	0	106.5	R35 I36 F51	I15-R35 WeakPolarHBondContact O-CA 3.35Å; I15-I36 HydrophobicContact CB-CB 4.37Å; I15-I36 PolarHBondContact N-O 2.88Å; I15-I36 PolarHBondContact O-N 3.25Å; I15-F51 HydrophobicContact CD1-CD2 3.31Å; I15-F51 HydrophobicContact CD1-CE2 3.47Å; I15-F51 VanDerWaalsContact CD1-CE2 3.47Å; I15-F51 HydrophobicContact CD1-CG 4.21Å; I15-F51 HydrophobicContact CD1-CZ 4.46Å; I15-F51 HydrophobicContact CG1-CE2 4.27Å
16	Y	85.5	Confident	81.9	Confident	136 Å²	136	111.9 Å²	111.9	53%	0.533	52%	0.523	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.7	141.4	173.5	75.8	-83.4	0	0	0	110	W14 R18	W14-Y16 AromaticContact CD1-CD1 3.75Å; W14-Y16 AromaticContact NE1-CD1 3.68Å; Y16-R18 HydrophobicContact CE2-CB 4.5Å
17	Y	80.7	Confident	83	Confident	153 Å²	153	109.2 Å²	109.2	60%	0.6	52%	0.518	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-112.2	135.2	171.6	-179	-108.4	0	0	0	109.4	Y19 Y33	Y17-Y19 HydrophobicContact CE1-CG 4.49Å; Y17-Y33 PolarHBondContact O-N 3.49Å; Y17-Y33 VanDerWaalsContact O-N 3.12Å
18	R	80.9	Confident	83.9	Confident	150 Å²	150	108.4 Å²	108.4	57%	0.566	52%	0.519	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-122.4	123.1	177.4	179.6	-170.9	-78.1	-167.1	8.6	107.3	Y16 P30	Y16-R18 HydrophobicContact CE2-CB 4.5Å; R18-P30 HydrophobicContact CG-CB 3.64Å
19	Y	81.6	Confident	84.7	Confident	54 Å²	54	107.4 Å²	107.4	21%	0.212	52%	0.517	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.8	160.3	173.5	63.9	-67.2	0	0	0	109.1	Y17 C21 P30 E31 Y33 K95	Y17-Y19 HydrophobicContact CE1-CG 4.49Å; Y19-C21 VanDerWaalsContact CD2-SG 3.59Å; Y19-C21 WeakPolarHBondContact CE2-SG 3.36Å; Y19-P30 WeakPolarHBondContact O-CA 3.32Å; Y19-E31 HydrophobicContact CD1-CB 4.33Å; Y19-E31 VanDerWaalsContact CD1-O 3.3Å; Y19-E31 WeakPolarHBondContact CD1-O 3.48Å; Y19-E31 HydrophobicContact CE1-CB 3.73Å; Y19-E31 HydrophobicContact CE2-CB 4.41Å; Y19-E31 PolarHBondContact N-O 3.48Å; Y19-E31 PolarHBondContact O-N 3.47Å; Y19-E31 PolarHBondContact OH-OE2 2.87Å; Y19-Y33 HydrophobicContact CD1-CD2 4.44Å; Y19-Y33 AromaticContact CE1-CD2 3.95Å; Y19-Y33 HydrophobicContact CE1-CD2 3.95Å; Y19-Y33 HydrophobicContact CE1-CG 4.38Å; Y19-K95 PolarHBondContact OH-NZ 2.84Å
20	K	83.2	Confident	85.2	Confident	166 Å²	166	104.8 Å²	104.8	72%	0.722	51%	0.507	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-101.9	122.2	177.5	-66.4	-178.5	-180	-177.8	0	108.2	V29	K20-V29 WeakPolarHBondContact CA-O 3.31Å
21	C	82.5	Confident	84.9	Confident	31 Å²	31	102.2 Å²	102.2	21%	0.209	49%	0.491	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.5	155.3	167.3	-67.3	0	0	0	0	109.2	Y19 S28 V29 E31	Y19-C21 VanDerWaalsContact CD2-SG 3.59Å; Y19-C21 WeakPolarHBondContact CE2-SG 3.36Å; C21-S28 CarbonylContact O-C 3.24Å; C21-S28 VanDerWaalsContact O-CA 3.31Å; C21-S28 WeakPolarHBondContact O-CA 3.35Å; C21-V29 PolarHBondContact N-O 3.35Å; C21-V29 PolarHBondContact O-N 3.03Å; C21-E31 HydrophobicContact CB-CG 4.41Å
22	L	86.6	Confident	84.2	Confident	122 Å²	122	104.2 Å²	104.2	64%	0.639	51%	0.508	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-87.6	129.7	163.9	-63.7	174.7	0	0	0	108.3	V27	L22-V27 WeakPolarHBondContact CA-O 3.4Å
23	D	86.1	Confident	83.3	Confident	60 Å²	60	102.9 Å²	102.9	32%	0.321	50%	0.498	S	S	.	.			trans	-77.8	-175.7	170.3	77.3	-3.3	0	0	0	111.5	Q25 N26 V27 V29	D23-Q25 PolarHBondContact O-N 3.23Å; D23-Q25 VanDerWaalsContact O-N 3.12Å; D23-Q25 VanDerWaalsContact OD1-CA 3.32Å; D23-Q25 WeakPolarHBondContact OD1-CA 3.28Å; D23-Q25 WeakPolarHBondContact OD1-CB 3.47Å; D23-Q25 PolarHBondContact OD1-N 3.47Å; D23-N26 PolarHBondContact O-N 3.32Å; D23-N26 VanDerWaalsContact O-N 3.1Å; D23-N26 PolarHBondContact OD1-N 3.35Å; D23-N26 VanDerWaalsContact OD1-N 3.16Å; D23-V27 PolarHBondContact N-O 3.42Å; D23-V27 WeakPolarHBondContact OD1-CB 3.3Å; D23-V27 PolarHBondContact OD1-N 2.86Å; D23-V29 HydrophobicContact CB-CG2 3.94Å
24	K	86.8	Confident	82.6	Confident	220 Å²	220	105.6 Å²	105.6	96%	0.957	51%	0.509	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.4	-15.2	178.7	-64.4	-175.9	179.8	-179.2	0	114
25	Q	90.9	Very high	82.3	Confident	160 Å²	160	109.2 Å²	109.2	75%	0.748	52%	0.522	S	S	*	.	T	Hydrogen-bonded Turn	trans	-103.2	12.5	179.3	-60.4	178.4	14.7	0	0	111.8	D23 V27	D23-Q25 PolarHBondContact O-N 3.23Å; D23-Q25 VanDerWaalsContact O-N 3.12Å; D23-Q25 VanDerWaalsContact OD1-CA 3.32Å; D23-Q25 WeakPolarHBondContact OD1-CA 3.28Å; D23-Q25 WeakPolarHBondContact OD1-CB 3.47Å; D23-Q25 PolarHBondContact OD1-N 3.47Å; Q25-V27 HydrophobicContact CB-CG2 4.14Å; Q25-V27 PolarHBondContact O-N 2.87Å
26	N	85.4	Confident	82.3	Confident	132 Å²	132	109.4 Å²	109.4	71%	0.706	52%	0.523	S	S	*	.	S	Bend	trans	59.4	26.4	-173.6	-72.8	-18.8	0	0	0	114.1	D23	D23-N26 PolarHBondContact O-N 3.32Å; D23-N26 VanDerWaalsContact O-N 3.1Å; D23-N26 PolarHBondContact OD1-N 3.35Å; D23-N26 VanDerWaalsContact OD1-N 3.16Å
27	V	89.7	Confident	82.5	Confident	75 Å²	75	109 Å²	109	46%	0.455	53%	0.526	S	S	.	.			trans	-91.5	133.6	174.7	-178.3	0	0	0	0	109.1	L22 D23 Q25 V29	L22-V27 WeakPolarHBondContact CA-O 3.4Å; D23-V27 PolarHBondContact N-O 3.42Å; D23-V27 WeakPolarHBondContact OD1-CB 3.3Å; D23-V27 PolarHBondContact OD1-N 2.86Å; Q25-V27 HydrophobicContact CB-CG2 4.14Å; Q25-V27 PolarHBondContact O-N 2.87Å; V27-V29 PolarHBondContact O-N 3.45Å
28	S	88.5	Confident	82.9	Confident	65 Å²	65	102.4 Å²	102.4	46%	0.455	50%	0.501	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.4	108	177.5	74.2	0	0	0	0	110.5	C21	C21-S28 CarbonylContact O-C 3.24Å; C21-S28 VanDerWaalsContact O-CA 3.31Å; C21-S28 WeakPolarHBondContact O-CA 3.35Å
29	V	86.7	Confident	83.3	Confident	57 Å²	57	98 Å²	98	35%	0.345	49%	0.492	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.1	129.4	177.8	-177.6	0	0	0	0	109.4	K20 C21 D23 V27 E31	K20-V29 WeakPolarHBondContact CA-O 3.31Å; C21-V29 PolarHBondContact N-O 3.35Å; C21-V29 PolarHBondContact O-N 3.03Å; D23-V29 HydrophobicContact CB-CG2 3.94Å; V27-V29 PolarHBondContact O-N 3.45Å; V29-E31 PolarHBondContact O-N 3.33Å
30	P	81.4	Confident	83.5	Confident	63 Å²	63	100.5 Å²	100.5	41%	0.409	50%	0.504	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.7	117.1	173.5	26.3	-30.2	0	0	0	111.3	R18 Y19	R18-P30 HydrophobicContact CG-CB 3.64Å; Y19-P30 WeakPolarHBondContact O-CA 3.32Å
31	E	72.6	Confident	83.8	Confident	68 Å²	68	99.7 Å²	99.7	32%	0.318	50%	0.501	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.9	131.3	171.5	-72.5	-169.4	-177.6	0	0	110.6	Y19 C21 V29 Y33 K95	Y19-E31 HydrophobicContact CD1-CB 4.33Å; Y19-E31 VanDerWaalsContact CD1-O 3.3Å; Y19-E31 WeakPolarHBondContact CD1-O 3.48Å; Y19-E31 HydrophobicContact CE1-CB 3.73Å; Y19-E31 HydrophobicContact CE2-CB 4.41Å; Y19-E31 PolarHBondContact N-O 3.48Å; Y19-E31 PolarHBondContact O-N 3.47Å; Y19-E31 PolarHBondContact OH-OE2 2.87Å; C21-E31 HydrophobicContact CB-CG 4.41Å; V29-E31 PolarHBondContact O-N 3.33Å; E31-Y33 PolarHBondContact O-N 3.34Å; E31-K95 IonicContact OE2-NZ 2.73Å; E31-K95 PolarHBondContact OE2-NZ 3.3Å
32	P	70.5	Confident	84.1	Confident	105 Å²	105	102.8 Å²	102.8	68%	0.682	51%	0.511	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-70	124.8	168.2	28.9	-30.5	0	0	0	108.8
33	Y	67.4	Low	84.1	Confident	95 Å²	95	98.2 Å²	98.2	37%	0.373	49%	0.486	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.6	-59.6	177.7	-177	-105.7	0	0	0	110.8	Y17 Y19 E31 T92	Y17-Y33 PolarHBondContact O-N 3.49Å; Y17-Y33 VanDerWaalsContact O-N 3.12Å; Y19-Y33 HydrophobicContact CD1-CD2 4.44Å; Y19-Y33 AromaticContact CE1-CD2 3.95Å; Y19-Y33 HydrophobicContact CE1-CD2 3.95Å; Y19-Y33 HydrophobicContact CE1-CG 4.38Å; E31-Y33 PolarHBondContact O-N 3.34Å; Y33-T92 WeakPolarHBondContact OH-CA 3.43Å; Y33-T92 WeakPolarHBondContact OH-CG2 3.07Å
34	N	74.2	Confident	84.1	Confident	107 Å²	107	101 Å²	101	57%	0.572	50%	0.496	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-169.3	160	170.6	-90.1	-37.1	0	0	0	108.4
35	R	81.4	Confident	84	Confident	191 Å²	191	94.9 Å²	94.9	72%	0.721	48%	0.48	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-107.4	128.6	173.8	-62.7	-174.5	-68.2	-152.7	-2.1	109.1	I15	I15-R35 WeakPolarHBondContact O-CA 3.35Å
36	I	86.2	Confident	83.8	Confident	87 Å²	87	99.1 Å²	99.1	45%	0.446	49%	0.49	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.8	104.7	169	-56.3	175.1	0	0	0	106.5	W14 I15 F51	W14-I36 CarbonylContact C-O 3.48Å; W14-I36 WeakPolarHBondContact CA-O 3.38Å; W14-I36 WeakPolarHBondContact CB-O 3.3Å; I15-I36 HydrophobicContact CB-CB 4.37Å; I15-I36 PolarHBondContact N-O 2.88Å; I15-I36 PolarHBondContact O-N 3.25Å; I36-F51 HydrophobicContact CG2-CD1 3.93Å; I36-F51 HydrophobicContact CG2-CE1 3.38Å; I36-F51 HydrophobicContact CG2-CZ 3.79Å
37	Q	88.8	Confident	83.9	Confident	127 Å²	127	97.7 Å²	97.7	59%	0.593	48%	0.481	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-78.1	128.2	178	-174.1	173.5	-4.2	0	0	109.8	P39	Q37-P39 VanDerWaalsContact O-CD 3.32Å; Q37-P39 WeakPolarHBondContact O-CD 3.46Å
38	I	89.7	Confident	83.9	Confident	15 Å²	15	100.6 Å²	100.6	8%	0.077	49%	0.493	C	S	.	.	P	Polyproline II helix	trans	-76.3	121.9	173.5	-66.3	154	0	0	0	107.7	S13 K40 F42 I43 V49 F51	S13-I38 WeakPolarHBondContact O-CB 3.49Å; S13-I38 PolarHBondContact O-N 2.93Å; S13-I38 WeakPolarHBondContact OG-CD1 3.47Å; I38-K40 PolarHBondContact O-N 2.9Å; I38-F42 HydrophobicContact CG2-CB 4.16Å; I38-I43 HydrophobicContact CB-CG1 4.49Å; I38-I43 HydrophobicContact CG2-CD1 4.42Å; I38-I43 HydrophobicContact CG2-CG1 3.8Å; I38-V49 HydrophobicContact CG2-CG1 4.39Å; I38-V49 HydrophobicContact CG2-CG2 4.36Å; I38-F51 HydrophobicContact CD1-CE2 4.4Å; I38-F51 HydrophobicContact CG1-CE2 3.83Å; I38-F51 HydrophobicContact CG1-CZ 3.67Å
39	P	88.6	Confident	83.9	Confident	58 Å²	58	99.8 Å²	99.8	38%	0.377	49%	0.486	S	S	.	.	P	Polyproline II helix	trans	-55.6	132	175.7	-26.5	33.6	0	0	0	111.2	Q37 K41 F42	Q37-P39 VanDerWaalsContact O-CD 3.32Å; Q37-P39 WeakPolarHBondContact O-CD 3.46Å; P39-K41 HydrophobicContact CB-CG 4.04Å; P39-K41 PolarHBondContact O-N 3.46Å; P39-F42 HydrophobicContact CB-CD2 3.71Å; P39-F42 HydrophobicContact CB-CE2 4.05Å; P39-F42 HydrophobicContact CG-CD2 3.79Å; P39-F42 HydrophobicContact CG-CE2 3.89Å; P39-F42 PolarHBondContact O-N 2.9Å
40	K	87.4	Confident	84.1	Confident	107 Å²	107	104.4 Å²	104.4	47%	0.465	50%	0.503	S	S	.	.	G	3₁₀ helix	trans	-49.3	-36.5	-176.8	-69.2	-169.9	174	-164.1	0	113.6	N9 I38 F42 I43	N9-K40 PolarHBondContact O-NZ 3.31Å; I38-K40 PolarHBondContact O-N 2.9Å; K40-F42 PolarHBondContact O-N 3.48Å; K40-I43 PolarHBondContact O-N 3.16Å
41	K	88.1	Confident	84.4	Confident	149 Å²	149	105.6 Å²	105.6	65%	0.648	50%	0.502	S	S	*	.	G	3₁₀ helix	trans	-56.9	-22.4	178	66.3	177.8	-178	175.7	0	114.9	P39 K44	P39-K41 HydrophobicContact CB-CG 4.04Å; P39-K41 PolarHBondContact O-N 3.46Å; K41-K44 WeakPolarHBondContact O-CE 3.49Å
42	F	88.8	Confident	85.1	Confident	96 Å²	96	110.7 Å²	110.7	42%	0.421	53%	0.526	S	S	.	.	G	3₁₀ helix	trans	-96.8	-9.1	178.8	-60.5	-54.6	0	0	0	113.3	I38 P39 K40 K44 V49	I38-F42 HydrophobicContact CG2-CB 4.16Å; P39-F42 HydrophobicContact CB-CD2 3.71Å; P39-F42 HydrophobicContact CB-CE2 4.05Å; P39-F42 HydrophobicContact CG-CD2 3.79Å; P39-F42 HydrophobicContact CG-CE2 3.89Å; P39-F42 PolarHBondContact O-N 2.9Å; K40-F42 PolarHBondContact O-N 3.48Å; F42-K44 PolarHBondContact O-N 3.48Å; F42-V49 HydrophobicContact CB-CG2 3.92Å
43	I	86.8	Confident	85.8	Confident	25 Å²	25	111 Å²	111	13%	0.128	53%	0.528	C	S	.	.			trans	-85.6	94.9	179.6	-53.3	177.5	0	0	0	108	L11 I38 K40	L11-I43 HydrophobicContact CB-CG2 3.7Å; L11-I43 HydrophobicContact CD1-CG2 3.91Å; L11-I43 HydrophobicContact CG-CG2 4.48Å; I38-I43 HydrophobicContact CB-CG1 4.49Å; I38-I43 HydrophobicContact CG2-CD1 4.42Å; I38-I43 HydrophobicContact CG2-CG1 3.8Å; K40-I43 PolarHBondContact O-N 3.16Å
44	K	85.5	Confident	86.6	Confident	120 Å²	120	112.5 Å²	112.5	52%	0.522	54%	0.542	S	S	.	.			trans	-139.2	154.5	179.7	-65.8	-178.4	-178.8	-176.7	0	111	E8 K41 F42 R46 I47	E8-K44 WeakPolarHBondContact OE1-CA 3.36Å; K41-K44 WeakPolarHBondContact O-CE 3.49Å; F42-K44 PolarHBondContact O-N 3.48Å; K44-R46 PolarHBondContact O-N 3.27Å; K44-I47 HydrophobicContact CB-CB 4.4Å; K44-I47 HydrophobicContact CB-CG1 3.69Å; K44-I47 PolarHBondContact O-N 2.93Å
45	S	84.8	Confident	87.3	Confident	90 Å²	90	113.7 Å²	113.7	63%	0.629	55%	0.554	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55.5	132.6	175.1	-169.7	0	0	0	0	111.8	E8 I47	E8-S45 PolarHBondContact OE1-N 3.31Å; S45-I47 VanDerWaalsContact C-N 3.29Å; S45-I47 PolarHBondContact O-N 3.13Å
46	R	86.5	Confident	87.6	Confident	249 Å²	249	109 Å²	109	94%	0.94	54%	0.54	S	S	*	.	T	Hydrogen-bonded Turn	trans	61.3	26.3	178.3	-53.1	178	-179.8	-134.5	0.4	115.5	K44	K44-R46 PolarHBondContact O-N 3.27Å
47	I	88.1	Confident	87.9	Confident	103 Å²	103	105.5 Å²	105.5	53%	0.528	52%	0.523	S	S	.	.			trans	-102.9	136.9	172.4	-61.8	-55.1	0	0	0	110.7	K44 S45 V49	K44-I47 HydrophobicContact CB-CB 4.4Å; K44-I47 HydrophobicContact CB-CG1 3.69Å; K44-I47 PolarHBondContact O-N 2.93Å; S45-I47 VanDerWaalsContact C-N 3.29Å; S45-I47 PolarHBondContact O-N 3.13Å; I47-V49 HydrophobicContact CG2-CG2 4.24Å
48	L	89.7	Confident	88.2	Confident	136 Å²	136	99.4 Å²	99.4	71%	0.712	50%	0.495	S	S	*	.			trans	-99.7	129.7	167.8	179.8	63.4	0	0	0	108.7	E50	L48-E50 HydrophobicContact CD2-CG 4.07Å; L48-E50 VanDerWaalsContact CD2-OE1 3.29Å; L48-E50 WeakPolarHBondContact CD2-OE1 3.35Å; L48-E50 HydrophobicContact CG-CG 4.01Å
49	V	89	Confident	88.4	Confident	48 Å²	48	101.9 Å²	101.9	29%	0.291	51%	0.505	S	S	.	.			trans	-111.2	112.7	174.8	-178.2	0	0	0	0	107.7	I38 F42 I47 F51	I38-V49 HydrophobicContact CG2-CG1 4.39Å; I38-V49 HydrophobicContact CG2-CG2 4.36Å; F42-V49 HydrophobicContact CB-CG2 3.92Å; I47-V49 HydrophobicContact CG2-CG2 4.24Å; V49-F51 HydrophobicContact CG1-CD2 4.43Å; V49-F51 HydrophobicContact CG1-CE2 3.83Å; V49-F51 HydrophobicContact CG1-CZ 4.17Å
50	E	90.2	Very high	88.7	Confident	154 Å²	154	103.1 Å²	103.1	72%	0.72	51%	0.507	S	S	*	.			trans	-101.7	142.8	176.1	-66.5	-177.1	171.4	0	0	110.2	L48	L48-E50 HydrophobicContact CD2-CG 4.07Å; L48-E50 VanDerWaalsContact CD2-OE1 3.29Å; L48-E50 WeakPolarHBondContact CD2-OE1 3.35Å; L48-E50 HydrophobicContact CG-CG 4.01Å
51	F	87.5	Confident	89.2	Confident	87 Å²	87	100.6 Å²	100.6	38%	0.382	50%	0.496	S	S	.	.			trans	-113.9	121.9	175.5	-70.5	-94.1	0	0	0	108.4	I15 I36 I38 V49	I15-F51 HydrophobicContact CD1-CD2 3.31Å; I15-F51 HydrophobicContact CD1-CE2 3.47Å; I15-F51 VanDerWaalsContact CD1-CE2 3.47Å; I15-F51 HydrophobicContact CD1-CG 4.21Å; I15-F51 HydrophobicContact CD1-CZ 4.46Å; I15-F51 HydrophobicContact CG1-CE2 4.27Å; I36-F51 HydrophobicContact CG2-CD1 3.93Å; I36-F51 HydrophobicContact CG2-CE1 3.38Å; I36-F51 HydrophobicContact CG2-CZ 3.79Å; I38-F51 HydrophobicContact CD1-CE2 4.4Å; I38-F51 HydrophobicContact CG1-CE2 3.83Å; I38-F51 HydrophobicContact CG1-CZ 3.67Å; V49-F51 HydrophobicContact CG1-CD2 4.43Å; V49-F51 HydrophobicContact CG1-CE2 3.83Å; V49-F51 HydrophobicContact CG1-CZ 4.17Å
52	E	89.2	Confident	89.5	Confident	175 Å²	175	99.7 Å²	99.7	82%	0.818	50%	0.503	S	S	*	.	P	Polyproline II helix	trans	-88.3	132.2	170.5	-66.6	-179.1	172.6	0	0	109
53	P	84.8	Confident	89.9	Confident	113 Å²	113	96.7 Å²	96.7	73%	0.734	49%	0.494	S	S	*	.	P	Polyproline II helix	trans	-65.3	139	173.9	28.4	-32.9	0	0	0	109.3	T55	P53-T55 PolarHBondContact O-N 3.48Å
54	N	83.5	Confident	90.4	Very high	125 Å²	125	98.1 Å²	98.1	67%	0.668	50%	0.502	S	S	*	.	P	Polyproline II helix	trans	-58.3	125.4	171.2	-70.2	-7.7	0	0	0	109.1	E56	N54-E56 PolarHBondContact O-N 2.76Å
55	T	88.2	Confident	90.9	Very high	132 Å²	132	98.1 Å²	98.1	81%	0.81	50%	0.503	S	S	*	.	S	Bend	trans	-76.3	-14.7	177.4	52.7	0	0	0	0	112.5	P53	P53-T55 PolarHBondContact O-N 3.48Å
56	E	89.2	Confident	91.5	Very high	93 Å²	93	96.8 Å²	96.8	44%	0.435	49%	0.491	S	S	.	.			trans	-133.7	133.8	178.1	-61.3	-173.7	154.5	0	0	110.8	N54 K72	N54-E56 PolarHBondContact O-N 2.76Å; E56-K72 IonicContact OE2-NZ 2.71Å; E56-K72 PolarHBondContact OE2-NZ 3.27Å
57	S	91.6	Very high	92	Very high	13 Å²	13	84.9 Å²	84.9	9%	0.091	45%	0.447	C	S	.	.			trans	-154.5	161.2	171.5	-166.7	0	0	0	0	110.1	F59 M60	S57-F59 PolarHBondContact O-N 3.32Å; S57-F59 WeakPolarHBondContact OG-CD1 3.32Å; S57-M60 WeakPolarHBondContact O-CB 3.24Å; S57-M60 PolarHBondContact O-N 3Å
58	C	95.6	Very high	92.4	Very high	0 Å²	0	84 Å²	84	0%	0	44%	0.442	C	S	.	.	G	3₁₀ helix	trans	-57.6	-48.7	-179.3	-54.6	0	0	0	0	111.6	M60 K61 C77 C86 N88	C58-M60 PolarHBondContact O-N 3.19Å; C58-K61 WeakPolarHBondContact O-CB 3.32Å; C58-K61 PolarHBondContact O-N 3.46Å; C58-C77 VanDerWaalsContact CA-SG 3.52Å; C58-C77 HydrophobicContact CB-CB 3.73Å; C58-C77 WeakPolarHBondContact CB-SG 3.34Å; C58-C77 WeakPolarHBondContact SG-CA 3.48Å; C58-C77 WeakPolarHBondContact SG-CB 3.03Å; C58-C77 CovalentContact SG-SG 2.02Å; C58-C77 PolarHBondContact SG-SG 3.25Å; C58-C86 WeakPolarHBondContact O-CB 3.36Å; C58-C86 PolarHBondContact O-SG 2.74Å; C58-N88 HydrophobicContact CB-CB 4.35Å
59	F	94.1	Very high	92.7	Very high	66 Å²	66	84 Å²	84	29%	0.289	44%	0.443	S	S	.	.	G	3₁₀ helix	trans	-59.6	-18.3	-177.9	81.8	-90.8	0	0	0	114.9	S57 K61 C86 D91 T92 H93	S57-F59 PolarHBondContact O-N 3.32Å; S57-F59 WeakPolarHBondContact OG-CD1 3.32Å; F59-K61 VanDerWaalsContact C-N 3.31Å; F59-C86 WeakPolarHBondContact CA-O 3.42Å; F59-D91 HydrophobicContact CB-CB 4.17Å; F59-D91 HydrophobicContact CD1-CB 3.89Å; F59-D91 HydrophobicContact CG-CB 4.41Å; F59-T92 WeakPolarHBondContact CB-OG1 3.04Å; F59-T92 HydrophobicContact CD2-CG2 4.4Å; F59-T92 WeakPolarHBondContact CD2-OG1 3.39Å; F59-T92 HydrophobicContact CE2-CG2 4.27Å; F59-T92 WeakPolarHBondContact CG-OG1 3.48Å; F59-T92 HydrophobicContact CZ-CG2 4.33Å; F59-H93 HydrophobicContact CB-CB 4.47Å; F59-H93 PolarHBondContact O-CE1 3.36Å
60	M	94.9	Very high	93	Very high	85 Å²	85	82.3 Å²	82.3	42%	0.419	43%	0.434	S	S	.	.	G	3₁₀ helix	trans	-80.3	-12.9	177.4	-56.8	-180	-177.1	0	0	112.8	S57 C58	S57-M60 WeakPolarHBondContact O-CB 3.24Å; S57-M60 PolarHBondContact O-N 3Å; C58-M60 PolarHBondContact O-N 3.19Å
61	K	96.5	Very high	93.2	Very high	54 Å²	54	77.3 Å²	77.3	24%	0.235	42%	0.416	C	S	.	.			trans	-86.2	134.4	-177.5	-52	-60.7	174.6	174.1	0	110.4	C58 F59 T66 C67 A70 C86	C58-K61 WeakPolarHBondContact O-CB 3.32Å; C58-K61 PolarHBondContact O-N 3.46Å; F59-K61 VanDerWaalsContact C-N 3.31Å; K61-T66 WeakPolarHBondContact CG-O 3.26Å; K61-C67 HydrophobicContact CB-CB 4.16Å; K61-A70 HydrophobicContact CD-CB 4.11Å; K61-A70 HydrophobicContact CG-CB 3.86Å; K61-C86 HydrophobicContact CB-CB 4.1Å
62	V	95.7	Very high	93.4	Very high	130 Å²	130	77.5 Å²	77.5	79%	0.788	42%	0.417	S	S	*	.			trans	-109.5	-6.5	-168.7	-61.5	0	0	0	0	113.9	W79	V62-W79 WeakPolarHBondContact O-CH2 3.39Å
63	S	96.9	Very high	93.3	Very high	33 Å²	33	76.3 Å²	76.3	23%	0.231	42%	0.424	C	S	.	.	S	Bend	trans	-127.9	160.9	175.1	90.8	0	0	0	0	110.9	E65 T66 C67 W79	S63-E65 VanDerWaalsContact CB-OE2 3.3Å; S63-E65 WeakPolarHBondContact CB-OE2 2.98Å; S63-E65 PolarHBondContact OG-N 3.03Å; S63-E65 PolarHBondContact OG-OE2 3.39Å; S63-T66 PolarHBondContact N-OG1 3.37Å; S63-T66 PolarHBondContact O-OG1 2.88Å; S63-T66 WeakPolarHBondContact OG-CG2 3Å; S63-T66 PolarHBondContact OG-N 2.88Å; S63-T66 VanDerWaalsContact OG-N 3.13Å; S63-T66 PolarHBondContact OG-OG1 2.81Å; S63-C67 WeakPolarHBondContact O-CB 3.43Å; S63-C67 PolarHBondContact O-N 3.3Å; S63-W79 VanDerWaalsContact C-CZ3 3.42Å; S63-W79 WeakPolarHBondContact O-CZ3 2.97Å
64	N	97	Very high	93.3	Very high	55 Å²	55	77.3 Å²	77.3	29%	0.294	42%	0.423	S	S	.	.	H	α-helix	trans	-59.8	-47.9	176.5	-177.1	20.3	0	0	0	111.2	C67 L68 W79	N64-C67 WeakPolarHBondContact O-CB 3.42Å; N64-C67 PolarHBondContact O-N 3.28Å; N64-L68 WeakPolarHBondContact O-CG 3.23Å; N64-L68 PolarHBondContact O-N 3.43Å; N64-L68 WeakPolarHBondContact OD1-CD1 3.43Å; N64-W79 HydrophobicContact CB-CB 4.45Å; N64-W79 HydrophobicContact CB-CD2 3.93Å; N64-W79 HydrophobicContact CB-CG 3.79Å; N64-W79 WeakPolarHBondContact OD1-CB 3.33Å
65	E	97.1	Very high	93.5	Very high	120 Å²	120	72.6 Å²	72.6	56%	0.561	40%	0.398	S	S	*	.	H	α-helix	trans	-60.6	-52.8	-178.1	-52.6	73	-154.7	0	0	110.1	S63 C67 L68 D69	S63-E65 VanDerWaalsContact CB-OE2 3.3Å; S63-E65 WeakPolarHBondContact CB-OE2 2.98Å; S63-E65 PolarHBondContact OG-N 3.03Å; S63-E65 PolarHBondContact OG-OE2 3.39Å; E65-C67 PolarHBondContact O-N 3.37Å; E65-L68 PolarHBondContact O-N 2.97Å; E65-D69 WeakPolarHBondContact O-CB 3.34Å; E65-D69 PolarHBondContact O-N 2.85Å
66	T	97	Very high	93.8	Very high	61 Å²	61	71.5 Å²	71.5	37%	0.374	38%	0.383	S	S	.	.	H	α-helix	trans	-65.5	-25.6	179.8	58.3	0	0	0	0	113.4	K61 S63 A70	K61-T66 WeakPolarHBondContact CG-O 3.26Å; S63-T66 PolarHBondContact N-OG1 3.37Å; S63-T66 PolarHBondContact O-OG1 2.88Å; S63-T66 WeakPolarHBondContact OG-CG2 3Å; S63-T66 PolarHBondContact OG-N 2.88Å; S63-T66 VanDerWaalsContact OG-N 3.13Å; S63-T66 PolarHBondContact OG-OG1 2.81Å; T66-A70 WeakPolarHBondContact O-CB 3.46Å; T66-A70 PolarHBondContact O-N 2.97Å
67	C	97.2	Very high	94.1	Very high	0 Å²	0	67.1 Å²	67.1	0%	0	36%	0.363	C	S	.	.	H	α-helix	trans	-70.8	-51.5	174.3	177	0	0	0	0	111.5	K61 S63 N64 E65 A70 C77 H78 W79 C86	K61-C67 HydrophobicContact CB-CB 4.16Å; S63-C67 WeakPolarHBondContact O-CB 3.43Å; S63-C67 PolarHBondContact O-N 3.3Å; N64-C67 WeakPolarHBondContact O-CB 3.42Å; N64-C67 PolarHBondContact O-N 3.28Å; E65-C67 PolarHBondContact O-N 3.37Å; C67-A70 WeakPolarHBondContact O-CB 3.27Å; C67-A70 PolarHBondContact O-N 3.19Å; C67-C77 WeakPolarHBondContact O-CB 3.47Å; C67-H78 PolarHBondContact SG-O 2.99Å; C67-H78 VanDerWaalsContact SG-O 3.37Å; C67-W79 HydrophobicContact CB-CB 4.44Å; C67-W79 HydrophobicContact CB-CD2 4.5Å; C67-W79 HydrophobicContact CB-CE3 3.62Å; C67-W79 HydrophobicContact CB-CZ3 4.3Å; C67-C86 WeakPolarHBondContact CA-SG 3.45Å; C67-C86 HydrophobicContact CB-CB 3.54Å; C67-C86 WeakPolarHBondContact CB-SG 3.34Å; C67-C86 VanDerWaalsContact SG-CA 3.58Å; C67-C86 WeakPolarHBondContact SG-CB 3.21Å; C67-C86 CovalentContact SG-SG 2.01Å; C67-C86 PolarHBondContact SG-SG 3.28Å
68	L	95.9	Very high	94.3	Very high	84 Å²	84	68.8 Å²	68.8	44%	0.44	37%	0.369	S	S	.	.	H	α-helix	trans	-67.1	-41.5	-177.5	-63.4	178.5	0	0	0	111	N64 E65 A70 S71	N64-L68 WeakPolarHBondContact O-CG 3.23Å; N64-L68 PolarHBondContact O-N 3.43Å; N64-L68 WeakPolarHBondContact OD1-CD1 3.43Å; E65-L68 PolarHBondContact O-N 2.97Å; L68-A70 PolarHBondContact O-N 2.98Å; L68-S71 VanDerWaalsContact O-CB 3.29Å; L68-S71 WeakPolarHBondContact O-CB 3.32Å; L68-S71 PolarHBondContact O-N 3.4Å; L68-S71 VanDerWaalsContact O-N 3.1Å; L68-S71 PolarHBondContact O-OG 2.88Å
69	D	96	Very high	94.4	Very high	136 Å²	136	70.7 Å²	70.7	73%	0.727	38%	0.376	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.2	-22.4	176.4	-70.4	-11.4	0	0	0	113.1	E65 S71	E65-D69 WeakPolarHBondContact O-CB 3.34Å; E65-D69 PolarHBondContact O-N 2.85Å; D69-S71 PolarHBondContact O-N 3.5Å
70	A	95.1	Very high	94.5	Very high	12 Å²	12	67.6 Å²	67.6	10%	0.099	36%	0.363	C	S	.	.	T	Hydrogen-bonded Turn	trans	-78.8	-6.8	177.9	0	0	0	0	0	113.8	K61 T66 C67 L68	K61-A70 HydrophobicContact CD-CB 4.11Å; K61-A70 HydrophobicContact CG-CB 3.86Å; T66-A70 WeakPolarHBondContact O-CB 3.46Å; T66-A70 PolarHBondContact O-N 2.97Å; C67-A70 WeakPolarHBondContact O-CB 3.27Å; C67-A70 PolarHBondContact O-N 3.19Å; L68-A70 PolarHBondContact O-N 2.98Å
71	S	94.3	Very high	94.5	Very high	49 Å²	49	69.8 Å²	69.8	34%	0.343	38%	0.376	S	S	.	.			trans	-66	132.8	179.8	-61.1	0	0	0	0	111.5	L68 D69 M75 C77	L68-S71 VanDerWaalsContact O-CB 3.29Å; L68-S71 WeakPolarHBondContact O-CB 3.32Å; L68-S71 PolarHBondContact O-N 3.4Å; L68-S71 VanDerWaalsContact O-N 3.1Å; L68-S71 PolarHBondContact O-OG 2.88Å; D69-S71 PolarHBondContact O-N 3.5Å; S71-M75 CarbonylContact C-O 3.52Å; S71-M75 WeakPolarHBondContact CA-O 3.36Å; S71-C77 WeakPolarHBondContact OG-CB 3.29Å; S71-C77 PolarHBondContact OG-N 2.84Å; S71-C77 PolarHBondContact OG-O 3.31Å
72	K	91.5	Very high	94.4	Very high	92 Å²	92	72.3 Å²	72.3	40%	0.4	40%	0.396	S	S	.	.	B	Isolated β-bridge	trans	-128	162.1	178.3	-63.9	176.9	-170.8	176.5	0	109.5	E56 D74 M75	E56-K72 IonicContact OE2-NZ 2.71Å; E56-K72 PolarHBondContact OE2-NZ 3.27Å; K72-D74 WeakPolarHBondContact CB-OD1 3.47Å; K72-D74 PolarHBondContact O-N 3.02Å; K72-M75 PolarHBondContact N-O 3.32Å; K72-M75 CarbonylContact O-C 3.59Å; K72-M75 VanDerWaalsContact O-C 3.24Å; K72-M75 PolarHBondContact O-N 3.5Å; K72-M75 VanDerWaalsContact O-O 3.13Å
73	P	88.1	Confident	94.3	Very high	149 Å²	149	67.3 Å²	67.3	97%	0.968	37%	0.368	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54	-26.4	-178.6	-28.7	36.2	0	0	0	115.4
74	D	84.3	Confident	94.3	Very high	135 Å²	135	71.5 Å²	71.5	72%	0.722	39%	0.388	S	S	*	.	T	Hydrogen-bonded Turn	trans	-103.1	-8.3	179.5	63.5	-37	0	0	0	114.1	K72	K72-D74 WeakPolarHBondContact CB-OD1 3.47Å; K72-D74 PolarHBondContact O-N 3.02Å
75	M	88.3	Confident	94.3	Very high	26 Å²	26	69.9 Å²	69.9	13%	0.128	38%	0.379	C	S	.	.	B	Isolated β-bridge	trans	-145.1	93.6	-177.9	-177.1	-178	75.8	0	0	109.9	S71 K72 N88	S71-M75 CarbonylContact C-O 3.52Å; S71-M75 WeakPolarHBondContact CA-O 3.36Å; K72-M75 PolarHBondContact N-O 3.32Å; K72-M75 CarbonylContact O-C 3.59Å; K72-M75 VanDerWaalsContact O-C 3.24Å; K72-M75 PolarHBondContact O-N 3.5Å; K72-M75 VanDerWaalsContact O-O 3.13Å; M75-N88 HydrophobicContact CG-CB 4.38Å
76	E	93.1	Very high	94.3	Very high	108 Å²	108	64.2 Å²	64.2	51%	0.505	35%	0.353	S	S	.	.			trans	-82.8	124.3	174.5	-162.7	175	172.7	0	0	109.8	H78 N88	E76-H78 IonicContact OE1-CE1 3.34Å; E76-H78 PolarHBondContact OE1-CE1 3.4Å; E76-H78 IonicContact OE1-NE2 3.84Å; E76-N88 WeakPolarHBondContact O-CA 3.29Å; E76-N88 WeakPolarHBondContact O-CB 3.17Å
77	C	95.2	Very high	94.2	Very high	2 Å²	2	61.3 Å²	61.3	1%	0.014	34%	0.335	C	S	.	.			trans	-103.2	137.9	178.8	-60.9	0	0	0	0	110.3	C58 C67 S71	C58-C77 VanDerWaalsContact CA-SG 3.52Å; C58-C77 HydrophobicContact CB-CB 3.73Å; C58-C77 WeakPolarHBondContact CB-SG 3.34Å; C58-C77 WeakPolarHBondContact SG-CA 3.48Å; C58-C77 WeakPolarHBondContact SG-CB 3.03Å; C58-C77 CovalentContact SG-SG 2.02Å; C58-C77 PolarHBondContact SG-SG 3.25Å; C67-C77 WeakPolarHBondContact O-CB 3.47Å; S71-C77 WeakPolarHBondContact OG-CB 3.29Å; S71-C77 PolarHBondContact OG-N 2.84Å; S71-C77 PolarHBondContact OG-O 3.31Å
78	H	96.3	Very high	93.9	Very high	48 Å²	48	62.7 Å²	62.7	22%	0.222	34%	0.342	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.3	140.9	176.7	-56	-85.2	0	0	0	110.2	C67 E76 C86 S87 W97 I105	C67-H78 PolarHBondContact SG-O 2.99Å; C67-H78 VanDerWaalsContact SG-O 3.37Å; E76-H78 IonicContact OE1-CE1 3.34Å; E76-H78 PolarHBondContact OE1-CE1 3.4Å; E76-H78 IonicContact OE1-NE2 3.84Å; H78-C86 WeakPolarHBondContact O-CA 3.35Å; H78-S87 PolarHBondContact N-O 3.17Å; H78-S87 PolarHBondContact O-N 2.96Å; H78-W97 HydrophobicContact CB-CH2 3.58Å; H78-W97 HydrophobicContact CB-CZ2 4.12Å; H78-W97 HydrophobicContact CB-CZ3 4.4Å; H78-W97 WeakPolarHBondContact O-CH2 3.35Å; H78-W97 VanDerWaalsContact O-CZ3 3.26Å; H78-W97 WeakPolarHBondContact O-CZ3 3.44Å; H78-I105 HydrophobicContact CB-CD1 3.99Å; H78-I105 HydrophobicContact CB-CG1 4.09Å; H78-I105 VanDerWaalsContact CD2-CG2 3.43Å; H78-I105 WeakPolarHBondContact CD2-CG2 3.18Å; H78-I105 WeakPolarHBondContact NE2-CG2 3.4Å
79	W	97	Very high	93.6	Very high	39 Å²	39	59.5 Å²	59.5	15%	0.148	33%	0.33	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.3	131.4	174	-174.2	-105.2	0	0	0	110.6	V62 S63 N64 C67 N84 C86	V62-W79 WeakPolarHBondContact O-CH2 3.39Å; S63-W79 VanDerWaalsContact C-CZ3 3.42Å; S63-W79 WeakPolarHBondContact O-CZ3 2.97Å; N64-W79 HydrophobicContact CB-CB 4.45Å; N64-W79 HydrophobicContact CB-CD2 3.93Å; N64-W79 HydrophobicContact CB-CG 3.79Å; N64-W79 WeakPolarHBondContact OD1-CB 3.33Å; C67-W79 HydrophobicContact CB-CB 4.44Å; C67-W79 HydrophobicContact CB-CD2 4.5Å; C67-W79 HydrophobicContact CB-CE3 3.62Å; C67-W79 HydrophobicContact CB-CZ3 4.3Å; W79-N84 HydrophobicContact CZ2-CB 4.36Å; W79-C86 HydrophobicContact CE3-CB 3.79Å; W79-C86 HydrophobicContact CZ3-CB 3.95Å
80	C	96.8	Very high	93.1	Very high	2 Å²	2	58.6 Å²	58.6	1%	0.014	32%	0.316	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.1	108	170.7	-179.6	0	0	0	0	110.9	T82 A83 N84 L85 W97 C102	C80-T82 VanDerWaalsContact C-N 3.34Å; C80-T82 PolarHBondContact O-N 3.34Å; C80-A83 HydrophobicContact CB-CB 4.12Å; C80-A83 PolarHBondContact O-N 3.06Å; C80-N84 WeakPolarHBondContact O-CA 3.17Å; C80-N84 PolarHBondContact O-N 3.24Å; C80-L85 HydrophobicContact CB-CD1 4.44Å; C80-L85 PolarHBondContact N-O 2.01Å; C80-L85 PolarHBondContact O-N 3.5Å; C80-W97 HydrophobicContact CB-CD2 4.37Å; C80-W97 HydrophobicContact CB-CE3 3.82Å; C80-W97 HydrophobicContact CB-CH2 3.63Å; C80-W97 HydrophobicContact CB-CZ2 4.19Å; C80-W97 HydrophobicContact CB-CZ3 3.44Å; C80-W97 VanDerWaalsContact CB-CZ3 3.44Å; C80-C102 HydrophobicContact CB-CB 3.7Å; C80-C102 WeakPolarHBondContact CB-SG 3.3Å; C80-C102 WeakPolarHBondContact SG-CB 2.97Å; C80-C102 CovalentContact SG-SG 2.01Å; C80-C102 PolarHBondContact SG-SG 2.91Å
81	L	95	Very high	92.8	Very high	130 Å²	130	58.5 Å²	58.5	68%	0.681	31%	0.314	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.2	-42.6	177.3	-69.6	167.2	0	0	0	112.5	A83 N84	L81-A83 VanDerWaalsContact C-N 3.26Å; L81-A83 PolarHBondContact O-N 3.45Å; L81-N84 PolarHBondContact O-N 2.99Å; L81-N84 PolarHBondContact O-OD1 3.18Å
82	T	93.9	Very high	92.4	Very high	108 Å²	108	59.2 Å²	59.2	66%	0.663	32%	0.317	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64.4	-31	-178.7	-47.7	0	0	0	0	113	C80	C80-T82 VanDerWaalsContact C-N 3.34Å; C80-T82 PolarHBondContact O-N 3.34Å
83	A	94.9	Very high	92.5	Very high	24 Å²	24	57.3 Å²	57.3	20%	0.198	31%	0.309	C	S	.	.	T	Hydrogen-bonded Turn	trans	-104.7	-10.8	-175.4	0	0	0	0	0	113.5	C80 L81 L85 K100	C80-A83 HydrophobicContact CB-CB 4.12Å; C80-A83 PolarHBondContact O-N 3.06Å; L81-A83 VanDerWaalsContact C-N 3.26Å; L81-A83 PolarHBondContact O-N 3.45Å; A83-L85 VanDerWaalsContact C-N 3.29Å; A83-L85 HydrophobicContact CB-CD1 4.43Å; A83-L85 HydrophobicContact CB-CD2 3.79Å; A83-L85 HydrophobicContact CB-CG 3.67Å; A83-L85 PolarHBondContact O-N 2.8Å; A83-K100 HydrophobicContact CB-CB 3.7Å; A83-K100 HydrophobicContact CB-CG 3.85Å
84	N	96.2	Very high	92.5	Very high	121 Å²	121	52 Å²	52	65%	0.647	28%	0.275	S	S	*	.	T	Hydrogen-bonded Turn	trans	48.7	48.4	-172	-70	-43.8	0	0	0	112.9	W79 C80 L81	W79-N84 HydrophobicContact CZ2-CB 4.36Å; C80-N84 WeakPolarHBondContact O-CA 3.17Å; C80-N84 PolarHBondContact O-N 3.24Å; L81-N84 PolarHBondContact O-N 2.99Å; L81-N84 PolarHBondContact O-OD1 3.18Å
85	L	96.4	Very high	92.6	Very high	22 Å²	22	50.5 Å²	50.5	12%	0.115	26%	0.263	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.5	155.1	179	62.8	76.2	0	0	0	111.8	C80 A83 H93 A96 W97	C80-L85 HydrophobicContact CB-CD1 4.44Å; C80-L85 PolarHBondContact N-O 2.01Å; C80-L85 PolarHBondContact O-N 3.5Å; A83-L85 VanDerWaalsContact C-N 3.29Å; A83-L85 HydrophobicContact CB-CD1 4.43Å; A83-L85 HydrophobicContact CB-CD2 3.79Å; A83-L85 HydrophobicContact CB-CG 3.67Å; A83-L85 PolarHBondContact O-N 2.8Å; L85-H93 HydrophobicContact CD1-CB 3.94Å; L85-H93 HydrophobicContact CD2-CB 4.43Å; L85-A96 HydrophobicContact CD2-CB 3.81Å; L85-W97 HydrophobicContact CD1-CE3 3.51Å; L85-W97 HydrophobicContact CD1-CZ3 4Å
86	C	97	Very high	92.8	Very high	0 Å²	0	51 Å²	51	0%	0	27%	0.271	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.8	142.4	174.5	-172.2	0	0	0	0	110.5	C58 F59 K61 C67 H78 W79 H93	C58-C86 WeakPolarHBondContact O-CB 3.36Å; C58-C86 PolarHBondContact O-SG 2.74Å; F59-C86 WeakPolarHBondContact CA-O 3.42Å; K61-C86 HydrophobicContact CB-CB 4.1Å; C67-C86 WeakPolarHBondContact CA-SG 3.45Å; C67-C86 HydrophobicContact CB-CB 3.54Å; C67-C86 WeakPolarHBondContact CB-SG 3.34Å; C67-C86 VanDerWaalsContact SG-CA 3.58Å; C67-C86 WeakPolarHBondContact SG-CB 3.21Å; C67-C86 CovalentContact SG-SG 2.01Å; C67-C86 PolarHBondContact SG-SG 3.28Å; H78-C86 WeakPolarHBondContact O-CA 3.35Å; W79-C86 HydrophobicContact CE3-CB 3.79Å; W79-C86 HydrophobicContact CZ3-CB 3.95Å; C86-H93 PolarHBondContact O-ND1 2.85Å
87	S	95.3	Very high	92.8	Very high	0 Å²	0	46.5 Å²	46.5	0%	0	25%	0.249	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-155.2	153.4	174.3	-172.5	0	0	0	0	112.6	H78 G89 D91 W97	H78-S87 PolarHBondContact N-O 3.17Å; H78-S87 PolarHBondContact O-N 2.96Å; S87-G89 PolarHBondContact OG-N 3.1Å; S87-D91 WeakPolarHBondContact CA-OD2 3.14Å; S87-D91 VanDerWaalsContact OG-CG 3.25Å; S87-D91 PolarHBondContact OG-OD1 3.12Å; S87-D91 PolarHBondContact OG-OD2 2.95Å; S87-W97 VanDerWaalsContact CB-CE3 3.42Å
88	N	92.2	Very high	92.6	Very high	29 Å²	29	53.4 Å²	53.4	16%	0.155	28%	0.283	C	S	.	.			trans	-96.9	10.4	164.2	65	12.5	0	0	0	113.6	C58 M75 E76 R90 D91	C58-N88 HydrophobicContact CB-CB 4.35Å; M75-N88 HydrophobicContact CG-CB 4.38Å; E76-N88 WeakPolarHBondContact O-CA 3.29Å; E76-N88 WeakPolarHBondContact O-CB 3.17Å; N88-R90 PolarHBondContact O-N 3.33Å; N88-R90 WeakPolarHBondContact OD1-CA 3.44Å; N88-R90 PolarHBondContact OD1-N 3.48Å; N88-D91 PolarHBondContact N-OD2 2.73Å; N88-D91 WeakPolarHBondContact OD1-CB 3.16Å; N88-D91 PolarHBondContact OD1-N 3.16Å; N88-D91 PolarHBondContact OD1-OD2 2.75Å
89	G	88.5	Confident	92.4	Very high	18 Å²	18	57.3 Å²	57.3	19%	0.186	30%	0.304	C	S	.	.	S	Bend	trans	77.2	-7	-178.4	0	0	0	0	0	115.1	S87 S94	S87-G89 PolarHBondContact OG-N 3.1Å; G89-S94 WeakPolarHBondContact O-CB 3.44Å
90	R	85.3	Confident	92.2	Very high	116 Å²	116	60.9 Å²	60.9	44%	0.438	32%	0.321	S	S	.	.	S	Bend	trans	-125.5	-1.2	-179.1	-71	-178.6	-85.3	-171.5	-12.1	114	N88 K108	N88-R90 PolarHBondContact O-N 3.33Å; N88-R90 WeakPolarHBondContact OD1-CA 3.44Å; N88-R90 PolarHBondContact OD1-N 3.48Å; R90-K108 PolarHBondContact NH2-O 2.82Å
91	D	88.4	Confident	92	Very high	11 Å²	11	67.7 Å²	67.7	6%	0.059	36%	0.357	C	S	.	.	S	Bend	trans	-89.4	-172.3	178.5	60.1	34.7	0	0	0	112.9	F59 S87 N88 H93 S94	F59-D91 HydrophobicContact CB-CB 4.17Å; F59-D91 HydrophobicContact CD1-CB 3.89Å; F59-D91 HydrophobicContact CG-CB 4.41Å; S87-D91 WeakPolarHBondContact CA-OD2 3.14Å; S87-D91 VanDerWaalsContact OG-CG 3.25Å; S87-D91 PolarHBondContact OG-OD1 3.12Å; S87-D91 PolarHBondContact OG-OD2 2.95Å; N88-D91 PolarHBondContact N-OD2 2.73Å; N88-D91 WeakPolarHBondContact OD1-CB 3.16Å; N88-D91 PolarHBondContact OD1-N 3.16Å; N88-D91 PolarHBondContact OD1-OD2 2.75Å; D91-H93 PolarHBondContact O-N 2.9Å; D91-H93 VanDerWaalsContact O-N 3.16Å; D91-H93 WeakPolarHBondContact OD1-CB 3.39Å; D91-H93 PolarHBondContact OD1-N 2.87Å; D91-S94 VanDerWaalsContact O-CB 3.27Å; D91-S94 WeakPolarHBondContact O-CB 3.41Å; D91-S94 PolarHBondContact O-N 2.98Å; D91-S94 VanDerWaalsContact O-N 3.09Å; D91-S94 PolarHBondContact O-OG 2.97Å
92	T	87.5	Confident	92	Very high	63 Å²	63	62.2 Å²	62.2	39%	0.387	33%	0.329	S	S	.	.	T	Hydrogen-bonded Turn	trans	-56.9	-26.1	179.6	52.7	0	0	0	0	113	Y33 F59	Y33-T92 WeakPolarHBondContact OH-CA 3.43Å; Y33-T92 WeakPolarHBondContact OH-CG2 3.07Å; F59-T92 WeakPolarHBondContact CB-OG1 3.04Å; F59-T92 HydrophobicContact CD2-CG2 4.4Å; F59-T92 WeakPolarHBondContact CD2-OG1 3.39Å; F59-T92 HydrophobicContact CE2-CG2 4.27Å; F59-T92 WeakPolarHBondContact CG-OG1 3.48Å; F59-T92 HydrophobicContact CZ-CG2 4.33Å
93	H	92	Very high	91.8	Very high	52 Å²	52	61.6 Å²	61.6	24%	0.241	33%	0.327	C	S	.	.	T	Hydrogen-bonded Turn	trans	-86.4	-5.6	-179.3	-70	173.1	0	0	0	113.5	F59 L85 C86 D91 K95 A96 W97	F59-H93 HydrophobicContact CB-CB 4.47Å; F59-H93 PolarHBondContact O-CE1 3.36Å; L85-H93 HydrophobicContact CD1-CB 3.94Å; L85-H93 HydrophobicContact CD2-CB 4.43Å; C86-H93 PolarHBondContact O-ND1 2.85Å; D91-H93 PolarHBondContact O-N 2.9Å; D91-H93 VanDerWaalsContact O-N 3.16Å; D91-H93 WeakPolarHBondContact OD1-CB 3.39Å; D91-H93 PolarHBondContact OD1-N 2.87Å; H93-K95 VanDerWaalsContact C-N 3.32Å; H93-K95 PolarHBondContact O-N 3.36Å; H93-A96 PolarHBondContact O-N 3.47Å; H93-W97 WeakPolarHBondContact O-CB 3.46Å; H93-W97 PolarHBondContact O-N 3.41Å
94	S	88.4	Confident	91.5	Very high	37 Å²	37	70.1 Å²	70.1	26%	0.259	36%	0.359	S	S	.	.	H	α-helix	trans	-51.5	-44.2	-180	54.8	0	0	0	0	114	G89 D91 W97 M98	G89-S94 WeakPolarHBondContact O-CB 3.44Å; D91-S94 VanDerWaalsContact O-CB 3.27Å; D91-S94 WeakPolarHBondContact O-CB 3.41Å; D91-S94 PolarHBondContact O-N 2.98Å; D91-S94 VanDerWaalsContact O-N 3.09Å; D91-S94 PolarHBondContact O-OG 2.97Å; S94-W97 WeakPolarHBondContact O-CB 3.19Å; S94-M98 WeakPolarHBondContact O-CG 3.46Å; S94-M98 PolarHBondContact O-N 3.37Å
95	K	87.3	Confident	91.1	Very high	105 Å²	105	65.3 Å²	65.3	46%	0.457	33%	0.334	S	S	.	.	H	α-helix	trans	-64.7	-47.3	175.6	-72.6	-173.8	173.4	-173.1	0	112.1	Y19 E31 H93 W97 M98 I99	Y19-K95 PolarHBondContact OH-NZ 2.84Å; E31-K95 IonicContact OE2-NZ 2.73Å; E31-K95 PolarHBondContact OE2-NZ 3.3Å; H93-K95 VanDerWaalsContact C-N 3.32Å; H93-K95 PolarHBondContact O-N 3.36Å; K95-W97 VanDerWaalsContact C-N 3.31Å; K95-W97 PolarHBondContact O-N 3.33Å; K95-M98 PolarHBondContact O-N 2.99Å; K95-I99 VanDerWaalsContact O-CG1 3.3Å; K95-I99 WeakPolarHBondContact O-CG1 3.31Å; K95-I99 PolarHBondContact O-N 3.23Å
96	A	91.2	Very high	90.1	Very high	36 Å²	36	71 Å²	71	30%	0.298	36%	0.364	S	S	.	.	H	α-helix	trans	-63.5	-38.7	179.4	0	0	0	0	0	111.6	L85 H93 M98 I99 K100	L85-A96 HydrophobicContact CD2-CB 3.81Å; H93-A96 PolarHBondContact O-N 3.47Å; A96-M98 PolarHBondContact O-N 3.25Å; A96-I99 PolarHBondContact O-N 3.21Å; A96-K100 WeakPolarHBondContact O-CB 3.14Å; A96-K100 WeakPolarHBondContact O-CG 3.42Å; A96-K100 PolarHBondContact O-N 3.1Å
97	W	93.4	Very high	88.5	Confident	14 Å²	14	75.3 Å²	75.3	5%	0.053	39%	0.387	C	S	.	.	H	α-helix	trans	-55.7	-48.3	174.5	-169.6	-80.9	0	0	0	111.7	H78 C80 L85 S87 H93 S94 K95 N101 C102 P103 I105	H78-W97 HydrophobicContact CB-CH2 3.58Å; H78-W97 HydrophobicContact CB-CZ2 4.12Å; H78-W97 HydrophobicContact CB-CZ3 4.4Å; H78-W97 WeakPolarHBondContact O-CH2 3.35Å; H78-W97 VanDerWaalsContact O-CZ3 3.26Å; H78-W97 WeakPolarHBondContact O-CZ3 3.44Å; C80-W97 HydrophobicContact CB-CD2 4.37Å; C80-W97 HydrophobicContact CB-CE3 3.82Å; C80-W97 HydrophobicContact CB-CH2 3.63Å; C80-W97 HydrophobicContact CB-CZ2 4.19Å; C80-W97 HydrophobicContact CB-CZ3 3.44Å; C80-W97 VanDerWaalsContact CB-CZ3 3.44Å; L85-W97 HydrophobicContact CD1-CE3 3.51Å; L85-W97 HydrophobicContact CD1-CZ3 4Å; S87-W97 VanDerWaalsContact CB-CE3 3.42Å; H93-W97 WeakPolarHBondContact O-CB 3.46Å; H93-W97 PolarHBondContact O-N 3.41Å; S94-W97 WeakPolarHBondContact O-CB 3.19Å; K95-W97 VanDerWaalsContact C-N 3.31Å; K95-W97 PolarHBondContact O-N 3.33Å; W97-N101 PolarHBondContact O-N 2.84Å; W97-C102 HydrophobicContact CD2-CB 3.56Å; W97-C102 HydrophobicContact CE3-CB 4.3Å; W97-C102 HydrophobicContact CG-CB 3.69Å; W97-C102 HydrophobicContact CZ2-CB 3.81Å; W97-C102 VanDerWaalsContact NE1-CB 3.29Å; W97-C102 WeakPolarHBondContact O-CB 3.49Å; W97-C102 PolarHBondContact O-N 3.16Å; W97-C102 VanDerWaalsContact O-N 3.13Å; W97-C102 PolarHBondContact O-SG 2.01Å; W97-P103 PolarHBondContact NE1-O 2.02Å; W97-I105 HydrophobicContact CD2-CD1 3.98Å; W97-I105 HydrophobicContact CE3-CD1 4.32Å; W97-I105 HydrophobicContact CH2-CD1 3.93Å; W97-I105 HydrophobicContact CH2-CG1 4.37Å; W97-I105 HydrophobicContact CZ2-CD1 3.54Å; W97-I105 HydrophobicContact CZ2-CG1 3.63Å; W97-I105 HydrophobicContact CZ3-CD1 4.29Å
98	M	90.6	Very high	86.9	Confident	147 Å²	147	82.5 Å²	82.5	72%	0.724	42%	0.419	S	S	*	.	H	α-helix	trans	-66.2	-47.1	176.6	-68.8	179.2	73.5	0	0	112.3	S94 K95 A96 K100 N101	S94-M98 WeakPolarHBondContact O-CG 3.46Å; S94-M98 PolarHBondContact O-N 3.37Å; K95-M98 PolarHBondContact O-N 2.99Å; A96-M98 PolarHBondContact O-N 3.25Å; M98-K100 VanDerWaalsContact C-N 3.25Å; M98-K100 PolarHBondContact O-N 3.03Å; M98-N101 PolarHBondContact O-N 2.83Å; M98-N101 VanDerWaalsContact O-N 3.16Å
99	I	92.1	Very high	85.3	Confident	129 Å²	129	85.7 Å²	85.7	66%	0.662	44%	0.441	S	S	*	.	H	α-helix	trans	-62	-35	-178	-69.7	166.5	0	0	0	111.6	K95 A96 N101	K95-I99 VanDerWaalsContact O-CG1 3.3Å; K95-I99 WeakPolarHBondContact O-CG1 3.31Å; K95-I99 PolarHBondContact O-N 3.23Å; A96-I99 PolarHBondContact O-N 3.21Å; I99-N101 VanDerWaalsContact C-N 3.29Å; I99-N101 PolarHBondContact O-N 2.92Å
100	K	94.1	Very high	83.7	Confident	115 Å²	115	92.6 Å²	92.6	50%	0.5	47%	0.47	S	S	.	.	T	Hydrogen-bonded Turn	trans	-88.7	10.8	-178.9	-64.6	-66.5	-172.8	175.8	0	113.9	A83 A96 M98 C102	A83-K100 HydrophobicContact CB-CB 3.7Å; A83-K100 HydrophobicContact CB-CG 3.85Å; A96-K100 WeakPolarHBondContact O-CB 3.14Å; A96-K100 WeakPolarHBondContact O-CG 3.42Å; A96-K100 PolarHBondContact O-N 3.1Å; M98-K100 VanDerWaalsContact C-N 3.25Å; M98-K100 PolarHBondContact O-N 3.03Å; K100-C102 PolarHBondContact O-N 3.21Å
101	N	92.1	Very high	82.4	Confident	145 Å²	145	95.2 Å²	95.2	78%	0.775	49%	0.485	S	S	*	.	T	Hydrogen-bonded Turn	trans	53.7	39.2	178	-60.5	-50.3	0	0	0	113.2	W97 M98 I99	W97-N101 PolarHBondContact O-N 2.84Å; M98-N101 PolarHBondContact O-N 2.83Å; M98-N101 VanDerWaalsContact O-N 3.16Å; I99-N101 VanDerWaalsContact C-N 3.29Å; I99-N101 PolarHBondContact O-N 2.92Å
102	C	94.5	Very high	81.2	Confident	14 Å²	14	100.1 Å²	100.1	10%	0.095	51%	0.511	C	S	.	.	P	Polyproline II helix	trans	-68	153.4	173.1	-59.1	0	0	0	0	110.6	C80 W97 K100	C80-C102 HydrophobicContact CB-CB 3.7Å; C80-C102 WeakPolarHBondContact CB-SG 3.3Å; C80-C102 WeakPolarHBondContact SG-CB 2.97Å; C80-C102 CovalentContact SG-SG 2.01Å; C80-C102 PolarHBondContact SG-SG 2.91Å; W97-C102 HydrophobicContact CD2-CB 3.56Å; W97-C102 HydrophobicContact CE3-CB 4.3Å; W97-C102 HydrophobicContact CG-CB 3.69Å; W97-C102 HydrophobicContact CZ2-CB 3.81Å; W97-C102 VanDerWaalsContact NE1-CB 3.29Å; W97-C102 WeakPolarHBondContact O-CB 3.49Å; W97-C102 PolarHBondContact O-N 3.16Å; W97-C102 VanDerWaalsContact O-N 3.13Å; W97-C102 PolarHBondContact O-SG 2.01Å; K100-C102 PolarHBondContact O-N 3.21Å
103	P	91.6	Very high	80.3	Confident	95 Å²	95	104.3 Å²	104.3	62%	0.617	52%	0.521	S	S	*	.	P	Polyproline II helix	trans	-53.7	143.2	177.7	-25.6	34.6	0	0	0	111.9	W97 I105	W97-P103 PolarHBondContact NE1-O 2.02Å; P103-I105 PolarHBondContact O-N 3.33Å
104	K	88.3	Confident	79.6	Confident	203 Å²	203	106.2 Å²	106.2	88%	0.883	53%	0.533	S	S	*	.	P	Polyproline II helix	trans	-62.4	127.9	177.5	-69.9	-176.7	179.6	177.8	0	109.3
105	I	86.9	Confident	79.1	Confident	21 Å²	21	113.7 Å²	113.7	11%	0.108	56%	0.556	C	S	.	*	P	Polyproline II helix	trans	-82.5	125.1	171	-65	169.1	0	0	0	107.2	H78 W97 P103 N107	H78-I105 HydrophobicContact CB-CD1 3.99Å; H78-I105 HydrophobicContact CB-CG1 4.09Å; H78-I105 VanDerWaalsContact CD2-CG2 3.43Å; H78-I105 WeakPolarHBondContact CD2-CG2 3.18Å; H78-I105 WeakPolarHBondContact NE2-CG2 3.4Å; W97-I105 HydrophobicContact CD2-CD1 3.98Å; W97-I105 HydrophobicContact CE3-CD1 4.32Å; W97-I105 HydrophobicContact CH2-CD1 3.93Å; W97-I105 HydrophobicContact CH2-CG1 4.37Å; W97-I105 HydrophobicContact CZ2-CD1 3.54Å; W97-I105 HydrophobicContact CZ2-CG1 3.63Å; W97-I105 HydrophobicContact CZ3-CD1 4.29Å; P103-I105 PolarHBondContact O-N 3.33Å; I105-N107 VanDerWaalsContact C-N 3.32Å; I105-N107 PolarHBondContact O-N 3.03Å
106	D	75.8	Confident	78.8	Confident	140 Å²	140	112.9 Å²	112.9	75%	0.749	56%	0.56	S	S	*	*			trans	-68.7	92.9	174.3	-74.5	-27.8	0	0	0	108.8	K108	D106-K108 VanDerWaalsContact C-N 3.32Å; D106-K108 PolarHBondContact O-N 3.09Å
107	N	64.1	Low	78.6	Confident	91 Å²	91	114.3 Å²	114.3	49%	0.487	56%	0.562	S	S	.	*			trans	-67	91.2	178.5	-72.6	-40.6	0	0	0	109.5	I105	I105-N107 VanDerWaalsContact C-N 3.32Å; I105-N107 PolarHBondContact O-N 3.03Å
108	K	61.7	Low	78.4	Confident	152 Å²	152	117.6 Å²	117.6	66%	0.661	58%	0.58	S	S	*	*			trans	-63.1	130.3	164.8	-72	-171.9	-171.8	179.3	0	108.4	R90 D106 M110	R90-K108 PolarHBondContact NH2-O 2.82Å; D106-K108 VanDerWaalsContact C-N 3.32Å; D106-K108 PolarHBondContact O-N 3.09Å; K108-M110 PolarHBondContact O-N 3.16Å
109	P	57.4	Low	78.5	Confident	96 Å²	96	114 Å²	114	62%	0.623	57%	0.568	S	S	*	*			trans	-55.2	135.6	176	22.7	-31.7	0	0	0	109.3	F111	P109-F111 CarbonylContact O-C 3.57Å; P109-F111 PolarHBondContact O-N 2.97Å
110	M	55.5	Low	78.4	Confident	163 Å²	163	111 Å²	111	80%	0.803	56%	0.558	S	S	*	*	S	Bend	trans	-59	-27.6	179	-168.9	175.7	145.9	0	0	111.7	K108 N112	K108-M110 PolarHBondContact O-N 3.16Å; M110-N112 PolarHBondContact O-N 3.19Å
111	F	58.7	Low	78.5	Confident	171 Å²	171	109.3 Å²	109.3	75%	0.75	56%	0.557	S	S	*	*	S	Bend	trans	-78.4	112.5	169.3	-71.9	-76.9	0	0	0	109.2	P109 Y113	P109-F111 CarbonylContact O-C 3.57Å; P109-F111 PolarHBondContact O-N 2.97Å; F111-Y113 PolarHBondContact O-N 3.27Å
112	N	61.9	Low	78.7	Confident	113 Å²	113	106.9 Å²	106.9	60%	0.604	54%	0.543	S	S	*	.			trans	-59.6	103.7	170.6	-164.7	-10.6	0	0	0	108	M110 L114 Y115	M110-N112 PolarHBondContact O-N 3.19Å; N112-L114 PolarHBondContact O-N 2.98Å; N112-L114 WeakPolarHBondContact OD1-CB 3.49Å; N112-L114 PolarHBondContact OD1-N 2.86Å; N112-Y115 WeakPolarHBondContact O-CB 3.47Å; N112-Y115 PolarHBondContact O-N 2.94Å
113	Y	69.7	Low	78.7	Confident	151 Å²	151	107.7 Å²	107.7	59%	0.592	55%	0.554	S	S	*	*	H	α-helix	trans	-53.3	-25.6	-177.9	-173.8	-121.5	0	0	0	111.6	F111 Y115 V116 L117	F111-Y113 PolarHBondContact O-N 3.27Å; Y113-Y115 VanDerWaalsContact C-N 3.26Å; Y113-Y115 PolarHBondContact O-N 2.63Å; Y113-V116 PolarHBondContact O-N 2.91Å; Y113-L117 HydrophobicContact CD1-CD1 3.17Å; Y113-L117 HydrophobicContact CD1-CD2 4.3Å; Y113-L117 HydrophobicContact CD1-CG 3.49Å; Y113-L117 VanDerWaalsContact CD1-CG 3.49Å; Y113-L117 HydrophobicContact CD2-CG 4.48Å; Y113-L117 HydrophobicContact CE1-CD1 3.14Å; Y113-L117 HydrophobicContact CE1-CD2 3.52Å; Y113-L117 HydrophobicContact CE1-CG 3.22Å; Y113-L117 HydrophobicContact CE2-CD2 4.49Å; Y113-L117 HydrophobicContact CE2-CG 4.25Å; Y113-L117 HydrophobicContact CG-CD1 4.14Å; Y113-L117 HydrophobicContact CG-CG 4.12Å; Y113-L117 WeakPolarHBondContact O-CB 3.05Å; Y113-L117 PolarHBondContact O-N 2.9Å; Y113-L117 WeakPolarHBondContact OH-CD2 3.36Å
114	L	75.9	Confident	78.9	Confident	93 Å²	93	108.3 Å²	108.3	49%	0.487	55%	0.552	S	S	.	*	H	α-helix	trans	-52.4	-40.2	171.8	-165	68.1	0	0	0	113.1	N112 V116 I118	N112-L114 PolarHBondContact O-N 2.98Å; N112-L114 WeakPolarHBondContact OD1-CB 3.49Å; N112-L114 PolarHBondContact OD1-N 2.86Å; L114-V116 VanDerWaalsContact C-N 3.26Å; L114-V116 PolarHBondContact O-N 3.01Å; L114-I118 HydrophobicContact CD1-CD1 3.75Å; L114-I118 HydrophobicContact CD1-CG1 4.01Å; L114-I118 HydrophobicContact CD2-CD1 4.2Å; L114-I118 HydrophobicContact CG-CD1 3.55Å; L114-I118 HydrophobicContact CG-CG1 4.14Å; L114-I118 WeakPolarHBondContact O-CB 3.42Å; L114-I118 VanDerWaalsContact O-CG1 3.23Å; L114-I118 WeakPolarHBondContact O-CG1 3.35Å; L114-I118 PolarHBondContact O-N 2.77Å
115	Y	78.2	Confident	79.3	Confident	193 Å²	193	102.5 Å²	102.5	76%	0.757	53%	0.533	S	S	*	.	H	α-helix	trans	-70.9	-22	179.9	-161.2	-93.4	0	0	0	113	N112 Y113 P119	N112-Y115 WeakPolarHBondContact O-CB 3.47Å; N112-Y115 PolarHBondContact O-N 2.94Å; Y113-Y115 VanDerWaalsContact C-N 3.26Å; Y113-Y115 PolarHBondContact O-N 2.63Å; Y115-P119 WeakPolarHBondContact O-CD 3.48Å; Y115-P119 VanDerWaalsContact O-CG 3.29Å; Y115-P119 WeakPolarHBondContact O-CG 3.41Å
116	V	82.3	Confident	79.7	Confident	89 Å²	89	106.9 Å²	106.9	54%	0.539	56%	0.556	S	S	.	*	H	α-helix	trans	-91.5	-41.4	176.4	-179.3	0	0	0	0	110.7	Y113 L114 S120	Y113-V116 PolarHBondContact O-N 2.91Å; L114-V116 VanDerWaalsContact C-N 3.26Å; L114-V116 PolarHBondContact O-N 3.01Å; V116-S120 WeakPolarHBondContact O-CB 3.07Å; V116-S120 PolarHBondContact O-N 3.17Å
117	L	85.6	Confident	80.7	Confident	65 Å²	65	103.9 Å²	103.9	34%	0.34	54%	0.543	S	S	.	.	H	α-helix	trans	-65	-47.5	178.6	-83.4	177.9	0	0	0	112.9	Y113 S120 V121	Y113-L117 HydrophobicContact CD1-CD1 3.17Å; Y113-L117 HydrophobicContact CD1-CD2 4.3Å; Y113-L117 HydrophobicContact CD1-CG 3.49Å; Y113-L117 VanDerWaalsContact CD1-CG 3.49Å; Y113-L117 HydrophobicContact CD2-CG 4.48Å; Y113-L117 HydrophobicContact CE1-CD1 3.14Å; Y113-L117 HydrophobicContact CE1-CD2 3.52Å; Y113-L117 HydrophobicContact CE1-CG 3.22Å; Y113-L117 HydrophobicContact CE2-CD2 4.49Å; Y113-L117 HydrophobicContact CE2-CG 4.25Å; Y113-L117 HydrophobicContact CG-CD1 4.14Å; Y113-L117 HydrophobicContact CG-CG 4.12Å; Y113-L117 WeakPolarHBondContact O-CB 3.05Å; Y113-L117 PolarHBondContact O-N 2.9Å; Y113-L117 WeakPolarHBondContact OH-CD2 3.36Å; L117-S120 PolarHBondContact O-N 3.22Å; L117-V121 WeakPolarHBondContact O-CG2 3.46Å; L117-V121 PolarHBondContact O-N 2.8Å
118	I	89.5	Confident	82.2	Confident	83 Å²	83	103 Å²	103	43%	0.426	54%	0.542	S	S	.	.	H	α-helix	trans	-58.8	-53.1	-172.8	-71.1	174.5	0	0	0	111	L114 S120 V121 I122	L114-I118 HydrophobicContact CD1-CD1 3.75Å; L114-I118 HydrophobicContact CD1-CG1 4.01Å; L114-I118 HydrophobicContact CD2-CD1 4.2Å; L114-I118 HydrophobicContact CG-CD1 3.55Å; L114-I118 HydrophobicContact CG-CG1 4.14Å; L114-I118 WeakPolarHBondContact O-CB 3.42Å; L114-I118 VanDerWaalsContact O-CG1 3.23Å; L114-I118 WeakPolarHBondContact O-CG1 3.35Å; L114-I118 PolarHBondContact O-N 2.77Å; I118-S120 VanDerWaalsContact C-N 3.3Å; I118-S120 PolarHBondContact O-N 3.43Å; I118-V121 PolarHBondContact O-N 2.93Å; I118-I122 HydrophobicContact CG2-CD1 3.59Å; I118-I122 HydrophobicContact CG2-CG1 4.43Å; I118-I122 VanDerWaalsContact O-CG1 3.24Å; I118-I122 WeakPolarHBondContact O-CG1 3.33Å; I118-I122 PolarHBondContact O-N 3.36Å
119	P	92.4	Very high	83.9	Confident	72 Å²	72	99.5 Å²	99.5	47%	0.468	53%	0.534	S	S	.	.	H	α-helix	trans	-63.9	-34.3	177.6	-22.7	35.1	0	0	0	113.2	Y115 G123	Y115-P119 WeakPolarHBondContact O-CD 3.48Å; Y115-P119 VanDerWaalsContact O-CG 3.29Å; Y115-P119 WeakPolarHBondContact O-CG 3.41Å; P119-G123 PolarHBondContact O-N 2.88Å
120	S	91	Very high	85.7	Confident	65 Å²	65	96.8 Å²	96.8	46%	0.455	52%	0.523	S	S	.	.	H	α-helix	trans	-64.2	-46	177.6	178.9	0	0	0	0	111.8	V116 L117 I118 G123 L124	V116-S120 WeakPolarHBondContact O-CB 3.07Å; V116-S120 PolarHBondContact O-N 3.17Å; L117-S120 PolarHBondContact O-N 3.22Å; I118-S120 VanDerWaalsContact C-N 3.3Å; I118-S120 PolarHBondContact O-N 3.43Å; S120-G123 PolarHBondContact O-N 3.12Å; S120-L124 WeakPolarHBondContact O-CG 3.49Å; S120-L124 PolarHBondContact O-N 2.89Å
121	V	95.5	Very high	87.6	Confident	80 Å²	80	95.3 Å²	95.3	49%	0.485	51%	0.513	S	S	.	.	H	α-helix	trans	-66.3	-43.8	177.3	175.2	0	0	0	0	110.8	L117 I118 G123 L124 V125	L117-V121 WeakPolarHBondContact O-CG2 3.46Å; L117-V121 PolarHBondContact O-N 2.8Å; I118-V121 PolarHBondContact O-N 2.93Å; V121-G123 VanDerWaalsContact C-N 3.32Å; V121-G123 PolarHBondContact O-N 3.13Å; V121-L124 PolarHBondContact O-N 3.15Å; V121-V125 HydrophobicContact CG1-CG2 4.49Å; V121-V125 WeakPolarHBondContact O-CG2 3.32Å; V121-V125 PolarHBondContact O-N 3.19Å
122	I	95.5	Very high	89.3	Confident	94 Å²	94	91.7 Å²	91.7	48%	0.482	50%	0.5	S	S	.	.	H	α-helix	trans	-59.5	-45.3	176.2	-68.1	167.8	0	0	0	110.6	I118 L124 V125 I126	I118-I122 HydrophobicContact CG2-CD1 3.59Å; I118-I122 HydrophobicContact CG2-CG1 4.43Å; I118-I122 VanDerWaalsContact O-CG1 3.24Å; I118-I122 WeakPolarHBondContact O-CG1 3.33Å; I118-I122 PolarHBondContact O-N 3.36Å; I122-L124 PolarHBondContact O-N 2.96Å; I122-V125 PolarHBondContact O-N 2.91Å; I122-I126 HydrophobicContact CG2-CD1 3.8Å; I122-I126 VanDerWaalsContact O-CG1 3.32Å; I122-I126 WeakPolarHBondContact O-CG1 3.44Å; I122-I126 PolarHBondContact O-N 2.96Å
123	G	95	Very high	90.9	Very high	32 Å²	32	90 Å²	90	33%	0.33	49%	0.493	S	S	.	.	H	α-helix	trans	-59.4	-46.4	176.7	0	0	0	0	0	112.6	P119 S120 V121 V125 I126 V127	P119-G123 PolarHBondContact O-N 2.88Å; S120-G123 PolarHBondContact O-N 3.12Å; V121-G123 VanDerWaalsContact C-N 3.32Å; V121-G123 PolarHBondContact O-N 3.13Å; G123-V125 PolarHBondContact O-N 2.96Å; G123-I126 PolarHBondContact O-N 3.4Å; G123-V127 WeakPolarHBondContact O-CG2 3.06Å; G123-V127 PolarHBondContact O-N 3.23Å
124	L	96.1	Very high	91.9	Very high	107 Å²	107	91 Å²	91	56%	0.56	50%	0.496	S	S	*	.	H	α-helix	trans	-61.3	-42.6	176.9	-74	168.4	0	0	0	112.2	S120 V121 I122 V127 C128	S120-L124 WeakPolarHBondContact O-CG 3.49Å; S120-L124 PolarHBondContact O-N 2.89Å; V121-L124 PolarHBondContact O-N 3.15Å; I122-L124 PolarHBondContact O-N 2.96Å; L124-V127 PolarHBondContact O-N 3.43Å; L124-C128 WeakPolarHBondContact O-CB 3.3Å; L124-C128 PolarHBondContact O-N 3.17Å; L124-C128 PolarHBondContact O-SG 2.82Å
125	V	96.4	Very high	92.7	Very high	82 Å²	82	93.2 Å²	93.2	50%	0.497	50%	0.502	S	S	.	.	H	α-helix	trans	-62.8	-44.3	177.3	172.8	0	0	0	0	111.1	V121 I122 G123 V127 C128 V129	V121-V125 HydrophobicContact CG1-CG2 4.49Å; V121-V125 WeakPolarHBondContact O-CG2 3.32Å; V121-V125 PolarHBondContact O-N 3.19Å; I122-V125 PolarHBondContact O-N 2.91Å; G123-V125 PolarHBondContact O-N 2.96Å; V125-V127 PolarHBondContact O-N 3.23Å; V125-C128 PolarHBondContact O-N 3.46Å; V125-V129 HydrophobicContact CG1-CG2 4.3Å; V125-V129 WeakPolarHBondContact O-CB 3.32Å; V125-V129 VanDerWaalsContact O-CG2 3.28Å; V125-V129 WeakPolarHBondContact O-CG2 3.15Å; V125-V129 PolarHBondContact O-N 2.89Å
126	I	96.6	Very high	93.3	Very high	112 Å²	112	92 Å²	92	57%	0.574	50%	0.496	S	S	*	.	H	α-helix	trans	-61.9	-44.4	177.6	-67	166	0	0	0	110.8	I122 G123 V129 G130	I122-I126 HydrophobicContact CG2-CD1 3.8Å; I122-I126 VanDerWaalsContact O-CG1 3.32Å; I122-I126 WeakPolarHBondContact O-CG1 3.44Å; I122-I126 PolarHBondContact O-N 2.96Å; G123-I126 PolarHBondContact O-N 3.4Å; I126-V129 PolarHBondContact O-N 2.89Å; I126-G130 PolarHBondContact O-N 3.31Å
127	V	96.5	Very high	93.6	Very high	78 Å²	78	93 Å²	93	47%	0.473	50%	0.498	S	S	.	.	H	α-helix	trans	-61.5	-48.1	176.6	170.7	0	0	0	0	110.5	G123 L124 V125 V129 G130 F131	G123-V127 WeakPolarHBondContact O-CG2 3.06Å; G123-V127 PolarHBondContact O-N 3.23Å; L124-V127 PolarHBondContact O-N 3.43Å; V125-V127 PolarHBondContact O-N 3.23Å; V127-V129 PolarHBondContact O-N 3.34Å; V127-G130 PolarHBondContact O-N 3.32Å; V127-F131 HydrophobicContact CG1-CD2 3.61Å; V127-F131 HydrophobicContact CG1-CE2 3.64Å; V127-F131 VanDerWaalsContact O-CD2 3.3Å; V127-F131 WeakPolarHBondContact O-CD2 3.35Å; V127-F131 PolarHBondContact O-N 3.13Å
128	C	96.1	Very high	93.7	Very high	71 Å²	71	93 Å²	93	48%	0.48	50%	0.503	S	S	.	.	H	α-helix	trans	-60.5	-45.5	178.1	-71.4	0	0	0	0	112.4	L124 V125 G130 F131 I132	L124-C128 WeakPolarHBondContact O-CB 3.3Å; L124-C128 PolarHBondContact O-N 3.17Å; L124-C128 PolarHBondContact O-SG 2.82Å; V125-C128 PolarHBondContact O-N 3.46Å; C128-G130 VanDerWaalsContact C-N 3.34Å; C128-G130 PolarHBondContact O-N 3.03Å; C128-F131 PolarHBondContact O-N 3.31Å; C128-I132 VanDerWaalsContact O-CG1 3.24Å; C128-I132 WeakPolarHBondContact O-CG1 3.19Å; C128-I132 PolarHBondContact O-N 2.84Å
129	V	96.2	Very high	93.4	Very high	80 Å²	80	97 Å²	97	49%	0.485	52%	0.518	S	S	.	.	H	α-helix	trans	-62.9	-42.6	176.7	172.7	0	0	0	0	110.5	V125 I126 V127 I132 V133	V125-V129 HydrophobicContact CG1-CG2 4.3Å; V125-V129 WeakPolarHBondContact O-CB 3.32Å; V125-V129 VanDerWaalsContact O-CG2 3.28Å; V125-V129 WeakPolarHBondContact O-CG2 3.15Å; V125-V129 PolarHBondContact O-N 2.89Å; I126-V129 PolarHBondContact O-N 2.89Å; V127-V129 PolarHBondContact O-N 3.34Å; V129-I132 PolarHBondContact O-N 2.75Å; V129-V133 HydrophobicContact CG1-CG2 4.32Å; V129-V133 VanDerWaalsContact O-CG2 3.31Å; V129-V133 WeakPolarHBondContact O-CG2 3.45Å; V129-V133 PolarHBondContact O-N 3.06Å
130	G	95.1	Very high	92.6	Very high	39 Å²	39	103.7 Å²	103.7	40%	0.402	53%	0.534	S	S	.	.	H	α-helix	trans	-59.7	-45.4	175.2	0	0	0	0	0	112.9	I126 V127 C128 V133 W134	I126-G130 PolarHBondContact O-N 3.31Å; V127-G130 PolarHBondContact O-N 3.32Å; C128-G130 VanDerWaalsContact C-N 3.34Å; C128-G130 PolarHBondContact O-N 3.03Å; G130-V133 PolarHBondContact O-N 3Å; G130-W134 VanDerWaalsContact O-CB 3.32Å; G130-W134 WeakPolarHBondContact O-CB 3.45Å; G130-W134 PolarHBondContact O-N 3.09Å
131	F	95.6	Very high	91.2	Very high	132 Å²	132	111.9 Å²	111.9	58%	0.579	57%	0.565	S	S	*	*	H	α-helix	trans	-62.7	-42.4	175.3	-92.6	-76.1	0	0	0	112.5	V127 C128 F135	V127-F131 HydrophobicContact CG1-CD2 3.61Å; V127-F131 HydrophobicContact CG1-CE2 3.64Å; V127-F131 VanDerWaalsContact O-CD2 3.3Å; V127-F131 WeakPolarHBondContact O-CD2 3.35Å; V127-F131 PolarHBondContact O-N 3.13Å; C128-F131 PolarHBondContact O-N 3.31Å; F131-F135 VanDerWaalsContact O-CB 3.28Å; F131-F135 WeakPolarHBondContact O-CB 3.34Å; F131-F135 PolarHBondContact O-N 3.32Å
132	I	94.8	Very high	90.9	Very high	94 Å²	94	113.5 Å²	113.5	48%	0.482	57%	0.569	S	S	.	*	H	α-helix	trans	-62	-53.5	176.8	-69.4	166.1	0	0	0	109.3	C128 V129 W134 F135 W136	C128-I132 VanDerWaalsContact O-CG1 3.24Å; C128-I132 WeakPolarHBondContact O-CG1 3.19Å; C128-I132 PolarHBondContact O-N 2.84Å; V129-I132 PolarHBondContact O-N 2.75Å; I132-W134 VanDerWaalsContact C-N 3.31Å; I132-W134 PolarHBondContact O-N 2.71Å; I132-F135 PolarHBondContact O-N 3.46Å; I132-F135 VanDerWaalsContact O-N 3.17Å; I132-W136 VanDerWaalsContact CG2-CD1 3.49Å; I132-W136 PolarHBondContact O-N 2.89Å
133	V	94.1	Very high	90.7	Very high	77 Å²	77	114.5 Å²	114.5	47%	0.467	57%	0.573	S	S	.	*	H	α-helix	trans	-58.5	-43.5	-179.7	172.9	0	0	0	0	111.4	V129 G130 W136 L137	V129-V133 HydrophobicContact CG1-CG2 4.32Å; V129-V133 VanDerWaalsContact O-CG2 3.31Å; V129-V133 WeakPolarHBondContact O-CG2 3.45Å; V129-V133 PolarHBondContact O-N 3.06Å; G130-V133 PolarHBondContact O-N 3Å; V133-W136 PolarHBondContact O-N 3.21Å; V133-L137 HydrophobicContact CG1-CD1 4.03Å; V133-L137 HydrophobicContact CG1-CG 4.49Å; V133-L137 WeakPolarHBondContact O-CG 3.29Å; V133-L137 PolarHBondContact O-N 3.21Å
134	W	92.3	Very high	90.5	Very high	174 Å²	174	119.1 Å²	119.1	66%	0.659	59%	0.587	S	S	*	*	H	α-helix	trans	-61.1	-48.8	175.7	-178.6	9.5	0	0	0	111.5	G130 I132 W136 L137 S138	G130-W134 VanDerWaalsContact O-CB 3.32Å; G130-W134 WeakPolarHBondContact O-CB 3.45Å; G130-W134 PolarHBondContact O-N 3.09Å; I132-W134 VanDerWaalsContact C-N 3.31Å; I132-W134 PolarHBondContact O-N 2.71Å; W134-W136 VanDerWaalsContact C-N 3.27Å; W134-W136 PolarHBondContact O-N 2.97Å; W134-L137 PolarHBondContact O-N 2.97Å; W134-S138 PolarHBondContact O-N 3.08Å; W134-S138 PolarHBondContact O-OG 3.18Å
135	F	92.4	Very high	90.1	Very high	139 Å²	139	119.8 Å²	119.8	61%	0.61	59%	0.588	S	S	*	*	H	α-helix	trans	-59.9	-37.3	178.4	-172.9	-96.9	0	0	0	112.6	F131 I132 S138 K139	F131-F135 VanDerWaalsContact O-CB 3.28Å; F131-F135 WeakPolarHBondContact O-CB 3.34Å; F131-F135 PolarHBondContact O-N 3.32Å; I132-F135 PolarHBondContact O-N 3.46Å; I132-F135 VanDerWaalsContact O-N 3.17Å; F135-S138 WeakPolarHBondContact CA-OG 3.49Å; F135-S138 PolarHBondContact O-OG 3.37Å; F135-K139 PolarHBondContact O-N 3.27Å
136	W	89.6	Confident	89.7	Confident	167 Å²	167	122.1 Å²	122.1	63%	0.633	59%	0.594	S	S	*	*	H	α-helix	trans	-67.2	-38.7	173.8	-82.5	100.2	0	0	0	112.7	I132 V133 W134	I132-W136 VanDerWaalsContact CG2-CD1 3.49Å; I132-W136 PolarHBondContact O-N 2.89Å; V133-W136 PolarHBondContact O-N 3.21Å; W134-W136 VanDerWaalsContact C-N 3.27Å; W134-W136 PolarHBondContact O-N 2.97Å
137	L	90.2	Very high	89.3	Confident	111 Å²	111	122.8 Å²	122.8	58%	0.581	60%	0.595	S	S	*	*	H	α-helix	trans	-70.9	-40.7	176.9	-71.9	172.1	0	0	0	112.1	V133 W134 K139 R140 Q141	V133-L137 HydrophobicContact CG1-CD1 4.03Å; V133-L137 HydrophobicContact CG1-CG 4.49Å; V133-L137 WeakPolarHBondContact O-CG 3.29Å; V133-L137 PolarHBondContact O-N 3.21Å; W134-L137 PolarHBondContact O-N 2.97Å; L137-K139 PolarHBondContact O-N 3.33Å; L137-R140 PolarHBondContact O-N 3.41Å; L137-R140 VanDerWaalsContact O-N 3.11Å; L137-Q141 PolarHBondContact O-N 3.24Å
138	S	87.6	Confident	88.8	Confident	64 Å²	64	126 Å²	126	45%	0.448	60%	0.604	S	S	.	*	H	α-helix	trans	-67.8	-22.2	179.5	65	0	0	0	0	113.4	W134 F135	W134-S138 PolarHBondContact O-N 3.08Å; W134-S138 PolarHBondContact O-OG 3.18Å; F135-S138 WeakPolarHBondContact CA-OG 3.49Å; F135-S138 PolarHBondContact O-OG 3.37Å
139	K	82.8	Confident	88.2	Confident	166 Å²	166	130.2 Å²	130.2	72%	0.722	61%	0.614	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.2	-11.4	175.7	-156.6	179.8	-179.5	-178.4	0	112.9	F135 L137	F135-K139 PolarHBondContact O-N 3.27Å; L137-K139 PolarHBondContact O-N 3.33Å
140	R	75.8	Confident	87.5	Confident	214 Å²	214	134.4 Å²	134.4	81%	0.808	62%	0.624	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.4	-15.9	176.7	-78.2	-167.9	-173.5	-170.9	3.9	113.6	L137	L137-R140 PolarHBondContact O-N 3.41Å; L137-R140 VanDerWaalsContact O-N 3.11Å
141	Q	60.2	Low	86.9	Confident	236 Å²	236	143.1 Å²	143.1	100%	1.103	65%	0.645	S	S	*	*			trans	-88.7	0	164.8	-67.1	-144.5	-27.1	0	0	110.1	L137	L137-Q141 PolarHBondContact O-N 3.24Å

Retrieved 141 of 141 residues in 278.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).