A0AA82N8N0_SCHMA Loading...

Kinetochore protein SPC25 AlphaSync

AlphaFold DB , UniProt , Accession A0AA82N8N0, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 37 aa.

						>A0AA82N8N0_SCHMA|A0AA82N8N0
MFQVVSKLREKRTKLVNSYKLNSTRNEHLKNLFITKY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	69.6	Low	88	Confident	208 Å²	208	135.7 Å²	135.7	100%	1.025	65%	0.65	S	S	*	*				0	-47	0	-88.8	55	175.3	0	0	114.6	Q3 V4	M1-Q3 PolarHBondContact O-N 3.01Å; M1-V4 PolarHBondContact O-N 3.34Å
2	F	84.8	Confident	88.4	Confident	172 Å²	172	139.6 Å²	139.6	75%	0.754	65%	0.653	S	S	*	*	H	α-helix	trans	-55.4	-40.7	-172.1	-170.3	-104.3	0	0	0	115.1	V4 V5 S6	F2-V4 VanDerWaalsContact C-N 3.3Å; F2-V4 PolarHBondContact O-N 3.49Å; F2-V5 PolarHBondContact O-N 3.22Å; F2-S6 PolarHBondContact O-N 3.49Å; F2-S6 PolarHBondContact O-OG 3.08Å
3	Q	87	Confident	88.6	Confident	156 Å²	156	133.8 Å²	133.8	73%	0.729	63%	0.633	S	S	*	*	H	α-helix	trans	-58.7	-36.4	-179.3	-70.3	-178.3	-29.2	0	0	113.9	M1 S6 K7	M1-Q3 PolarHBondContact O-N 3.01Å; Q3-S6 PolarHBondContact O-N 3.48Å; Q3-K7 WeakPolarHBondContact O-CG 3.41Å; Q3-K7 PolarHBondContact O-N 3.27Å; Q3-K7 VanDerWaalsContact O-N 3.08Å
4	V	88.5	Confident	88.8	Confident	96 Å²	96	133.6 Å²	133.6	58%	0.582	63%	0.628	S	S	*	*	H	α-helix	trans	-69.1	-42.9	-179.2	179.3	0	0	0	0	110.3	M1 F2 S6 K7 L8	M1-V4 PolarHBondContact O-N 3.34Å; F2-V4 VanDerWaalsContact C-N 3.3Å; F2-V4 PolarHBondContact O-N 3.49Å; V4-S6 VanDerWaalsContact C-N 3.35Å; V4-S6 PolarHBondContact O-N 3.23Å; V4-K7 PolarHBondContact O-N 3.26Å; V4-L8 HydrophobicContact CG1-CD1 4.34Å; V4-L8 WeakPolarHBondContact O-CG 3.5Å; V4-L8 PolarHBondContact O-N 3.19Å
5	V	89.3	Confident	89	Confident	92 Å²	92	130 Å²	130	56%	0.558	61%	0.614	S	S	*	*	H	α-helix	trans	-63.6	-42	177.4	-177.8	0	0	0	0	110.7	F2 K7 L8 R9	F2-V5 PolarHBondContact O-N 3.22Å; V5-K7 PolarHBondContact O-N 3.24Å; V5-L8 PolarHBondContact O-N 3.05Å; V5-R9 WeakPolarHBondContact O-CB 3.42Å; V5-R9 PolarHBondContact O-N 2.95Å
6	S	90.5	Very high	89.1	Confident	50 Å²	50	127.1 Å²	127.1	35%	0.35	61%	0.607	S	S	.	*	H	α-helix	trans	-61.9	-43.6	176.5	-59	0	0	0	0	112.3	F2 Q3 V4 L8 R9 E10	F2-S6 PolarHBondContact O-N 3.49Å; F2-S6 PolarHBondContact O-OG 3.08Å; Q3-S6 PolarHBondContact O-N 3.48Å; V4-S6 VanDerWaalsContact C-N 3.35Å; V4-S6 PolarHBondContact O-N 3.23Å; S6-L8 PolarHBondContact O-N 3.21Å; S6-R9 PolarHBondContact O-N 3.47Å; S6-E10 PolarHBondContact O-N 3.44Å
7	K	90.5	Very high	89.1	Confident	157 Å²	157	124.8 Å²	124.8	68%	0.683	60%	0.6	S	S	*	*	H	α-helix	trans	-61.8	-42.2	174.9	-73.5	179.8	-179.7	-176.7	0	112.1	Q3 V4 V5 E10 K11	Q3-K7 WeakPolarHBondContact O-CG 3.41Å; Q3-K7 PolarHBondContact O-N 3.27Å; Q3-K7 VanDerWaalsContact O-N 3.08Å; V4-K7 PolarHBondContact O-N 3.26Å; V5-K7 PolarHBondContact O-N 3.24Å; K7-E10 PolarHBondContact O-N 3.04Å; K7-K11 PolarHBondContact O-N 2.8Å
8	L	91.7	Very high	89.1	Confident	109 Å²	109	121.4 Å²	121.4	57%	0.571	59%	0.591	S	S	*	*	H	α-helix	trans	-62.4	-44.1	175.7	-73.7	171.5	0	0	0	111.5	V4 V5 S6 K11 R12	V4-L8 HydrophobicContact CG1-CD1 4.34Å; V4-L8 WeakPolarHBondContact O-CG 3.5Å; V4-L8 PolarHBondContact O-N 3.19Å; V5-L8 PolarHBondContact O-N 3.05Å; S6-L8 PolarHBondContact O-N 3.21Å; L8-K11 PolarHBondContact O-N 3.44Å; L8-R12 WeakPolarHBondContact O-CB 3.32Å; L8-R12 VanDerWaalsContact O-CG 3.24Å; L8-R12 WeakPolarHBondContact O-CG 3.47Å; L8-R12 PolarHBondContact O-N 2.89Å
9	R	92.7	Very high	89.2	Confident	187 Å²	187	123.5 Å²	123.5	71%	0.706	59%	0.593	S	S	*	*	H	α-helix	trans	-62.5	-45.7	176.9	-175.3	176.9	175.2	178.2	-1.1	111.4	V5 S6 K11 R12 T13	V5-R9 WeakPolarHBondContact O-CB 3.42Å; V5-R9 PolarHBondContact O-N 2.95Å; S6-R9 PolarHBondContact O-N 3.47Å; R9-K11 PolarHBondContact O-N 2.9Å; R9-R12 WeakPolarHBondContact O-CB 3.24Å; R9-R12 PolarHBondContact O-N 3.5Å; R9-T13 WeakPolarHBondContact O-CB 3.44Å; R9-T13 PolarHBondContact O-N 3.09Å; R9-T13 PolarHBondContact O-OG1 3.45Å; R9-T13 VanDerWaalsContact O-OG1 3.09Å
10	E	92.1	Very high	89.2	Confident	110 Å²	110	124.6 Å²	124.6	51%	0.514	60%	0.595	S	S	.	*	H	α-helix	trans	-61	-44.7	178.7	-168	-172.4	108.6	0	0	111.7	S6 K7 R12 T13 K14	S6-E10 PolarHBondContact O-N 3.44Å; K7-E10 PolarHBondContact O-N 3.04Å; E10-R12 VanDerWaalsContact C-N 3.34Å; E10-R12 PolarHBondContact O-N 2.69Å; E10-T13 PolarHBondContact O-N 3.09Å; E10-K14 HydrophobicContact CG-CD 4.37Å; E10-K14 WeakPolarHBondContact O-CB 3.47Å; E10-K14 WeakPolarHBondContact O-CG 3.49Å; E10-K14 PolarHBondContact O-N 3.45Å; E10-K14 WeakPolarHBondContact OE1-CE 3.42Å; E10-K14 IonicContact OE1-NZ 2.69Å; E10-K14 PolarHBondContact OE1-NZ 2.92Å
11	K	92	Very high	89.1	Confident	156 Å²	156	124.3 Å²	124.3	68%	0.678	60%	0.596	S	S	*	*	H	α-helix	trans	-61.8	-42.3	175.7	-171.1	171.2	-177.3	177.5	0	111.6	K7 L8 R9 L15	K7-K11 PolarHBondContact O-N 2.8Å; L8-K11 PolarHBondContact O-N 3.44Å; R9-K11 PolarHBondContact O-N 2.9Å; K11-L15 WeakPolarHBondContact O-CB 3.26Å; K11-L15 PolarHBondContact O-N 3.28Å; K11-L15 VanDerWaalsContact O-N 3.09Å
12	R	92.4	Very high	89.7	Confident	182 Å²	182	118.9 Å²	118.9	69%	0.687	57%	0.571	S	S	*	*	H	α-helix	trans	-62.9	-46.2	175	-73	-75.7	-173.8	-175.5	0.8	111.4	L8 R9 E10 L15 V16	L8-R12 WeakPolarHBondContact O-CB 3.32Å; L8-R12 VanDerWaalsContact O-CG 3.24Å; L8-R12 WeakPolarHBondContact O-CG 3.47Å; L8-R12 PolarHBondContact O-N 2.89Å; R9-R12 WeakPolarHBondContact O-CB 3.24Å; R9-R12 PolarHBondContact O-N 3.5Å; E10-R12 VanDerWaalsContact C-N 3.34Å; E10-R12 PolarHBondContact O-N 2.69Å; R12-L15 PolarHBondContact O-N 3.48Å; R12-V16 WeakPolarHBondContact O-CB 3.16Å; R12-V16 VanDerWaalsContact O-CG2 3.25Å; R12-V16 WeakPolarHBondContact O-CG2 3.42Å; R12-V16 PolarHBondContact O-N 3.45Å
13	T	91.1	Very high	89.5	Confident	64 Å²	64	114.4 Å²	114.4	39%	0.393	56%	0.562	S	S	.	*	H	α-helix	trans	-64.1	-43.3	179.7	-62.5	0	0	0	0	111.8	R9 E10 L15 V16 N17	R9-T13 WeakPolarHBondContact O-CB 3.44Å; R9-T13 PolarHBondContact O-N 3.09Å; R9-T13 PolarHBondContact O-OG1 3.45Å; R9-T13 VanDerWaalsContact O-OG1 3.09Å; E10-T13 PolarHBondContact O-N 3.09Å; T13-L15 VanDerWaalsContact C-N 3.33Å; T13-L15 PolarHBondContact O-N 2.87Å; T13-V16 PolarHBondContact O-N 3Å; T13-N17 VanDerWaalsContact O-CB 3.26Å; T13-N17 WeakPolarHBondContact O-CB 3.49Å; T13-N17 PolarHBondContact O-N 3.21Å; T13-N17 PolarHBondContact O-ND2 3.3Å
14	K	91.3	Very high	89.3	Confident	131 Å²	131	110.8 Å²	110.8	57%	0.57	55%	0.55	S	S	*	*	H	α-helix	trans	-58.8	-45.6	174.3	-76.5	173.4	174.4	168.4	0	111.7	E10 S18	E10-K14 HydrophobicContact CG-CD 4.37Å; E10-K14 WeakPolarHBondContact O-CB 3.47Å; E10-K14 WeakPolarHBondContact O-CG 3.49Å; E10-K14 PolarHBondContact O-N 3.45Å; E10-K14 WeakPolarHBondContact OE1-CE 3.42Å; E10-K14 IonicContact OE1-NZ 2.69Å; E10-K14 PolarHBondContact OE1-NZ 2.92Å; K14-S18 PolarHBondContact O-N 3.01Å
15	L	91.3	Very high	89.1	Confident	80 Å²	80	114 Å²	114	42%	0.419	55%	0.552	S	S	.	*	H	α-helix	trans	-65.2	-49.2	179	-177.9	141.4	0	0	0	111.6	K11 R12 T13 N17 S18 Y19	K11-L15 WeakPolarHBondContact O-CB 3.26Å; K11-L15 PolarHBondContact O-N 3.28Å; K11-L15 VanDerWaalsContact O-N 3.09Å; R12-L15 PolarHBondContact O-N 3.48Å; T13-L15 VanDerWaalsContact C-N 3.33Å; T13-L15 PolarHBondContact O-N 2.87Å; L15-N17 VanDerWaalsContact C-N 3.33Å; L15-N17 PolarHBondContact O-N 3.33Å; L15-S18 PolarHBondContact O-N 3.41Å; L15-Y19 HydrophobicContact CD1-CE2 4.32Å; L15-Y19 HydrophobicContact CD2-CD2 3.66Å; L15-Y19 HydrophobicContact CD2-CE2 3.48Å; L15-Y19 VanDerWaalsContact CD2-CE2 3.48Å; L15-Y19 HydrophobicContact CG-CD2 3.96Å; L15-Y19 HydrophobicContact CG-CE2 3.64Å; L15-Y19 WeakPolarHBondContact O-CD2 3.25Å; L15-Y19 PolarHBondContact O-N 2.88Å
16	V	91.4	Very high	88.8	Confident	83 Å²	83	115 Å²	115	50%	0.503	55%	0.554	S	S	.	*	H	α-helix	trans	-60.6	-41.8	177.3	170.5	0	0	0	0	111.5	R12 T13 Y19 K20	R12-V16 WeakPolarHBondContact O-CB 3.16Å; R12-V16 VanDerWaalsContact O-CG2 3.25Å; R12-V16 WeakPolarHBondContact O-CG2 3.42Å; R12-V16 PolarHBondContact O-N 3.45Å; T13-V16 PolarHBondContact O-N 3Å; V16-Y19 PolarHBondContact O-N 2.83Å; V16-K20 WeakPolarHBondContact O-CB 3.25Å; V16-K20 PolarHBondContact O-N 3.31Å
17	N	89.1	Confident	88.5	Confident	89 Å²	89	118.1 Å²	118.1	48%	0.476	56%	0.563	S	S	.	*	H	α-helix	trans	-64.8	-40.8	177	-75.2	-11.1	0	0	0	111.8	T13 L15 K20 L21	T13-N17 VanDerWaalsContact O-CB 3.26Å; T13-N17 WeakPolarHBondContact O-CB 3.49Å; T13-N17 PolarHBondContact O-N 3.21Å; T13-N17 PolarHBondContact O-ND2 3.3Å; L15-N17 VanDerWaalsContact C-N 3.33Å; L15-N17 PolarHBondContact O-N 3.33Å; N17-K20 PolarHBondContact O-N 3.25Å; N17-L21 VanDerWaalsContact O-CB 3.25Å; N17-L21 WeakPolarHBondContact O-CB 3.26Å; N17-L21 PolarHBondContact O-N 2.83Å
18	S	89.5	Confident	88.3	Confident	64 Å²	64	116.6 Å²	116.6	45%	0.448	56%	0.558	S	S	.	*	H	α-helix	trans	-62	-43.4	175	-177.8	0	0	0	0	111.7	K14 L15 L21 N22	K14-S18 PolarHBondContact O-N 3.01Å; L15-S18 PolarHBondContact O-N 3.41Å; S18-L21 PolarHBondContact O-N 3.41Å; S18-N22 WeakPolarHBondContact O-CB 3.32Å; S18-N22 VanDerWaalsContact O-CG 3.28Å; S18-N22 PolarHBondContact O-N 3.46Å; S18-N22 PolarHBondContact O-OD1 3.12Å
19	Y	89.9	Confident	88	Confident	161 Å²	161	114.4 Å²	114.4	63%	0.631	55%	0.547	S	S	*	.	H	α-helix	trans	-63.1	-43.9	174.3	-79.1	-69.4	0	0	0	112.5	L15 V16 N22 S23	L15-Y19 HydrophobicContact CD1-CE2 4.32Å; L15-Y19 HydrophobicContact CD2-CD2 3.66Å; L15-Y19 HydrophobicContact CD2-CE2 3.48Å; L15-Y19 VanDerWaalsContact CD2-CE2 3.48Å; L15-Y19 HydrophobicContact CG-CD2 3.96Å; L15-Y19 HydrophobicContact CG-CE2 3.64Å; L15-Y19 WeakPolarHBondContact O-CD2 3.25Å; L15-Y19 PolarHBondContact O-N 2.88Å; V16-Y19 PolarHBondContact O-N 2.83Å; Y19-N22 PolarHBondContact O-N 2.91Å; Y19-S23 VanDerWaalsContact O-CB 3.29Å; Y19-S23 WeakPolarHBondContact O-CB 3.41Å; Y19-S23 PolarHBondContact O-N 2.91Å
20	K	89.3	Confident	87.6	Confident	145 Å²	145	111.7 Å²	111.7	63%	0.63	54%	0.54	S	S	*	.	H	α-helix	trans	-61.9	-45.6	177.9	-173.4	173	-177.7	-179.4	0	111.3	V16 N17 S23 T24	V16-K20 WeakPolarHBondContact O-CB 3.25Å; V16-K20 PolarHBondContact O-N 3.31Å; N17-K20 PolarHBondContact O-N 3.25Å; K20-S23 PolarHBondContact O-N 3.33Å; K20-T24 PolarHBondContact O-N 3.3Å; K20-T24 PolarHBondContact O-OG1 2.85Å; K20-T24 VanDerWaalsContact O-OG1 3.12Å
21	L	86.7	Confident	87.1	Confident	118 Å²	118	110.7 Å²	110.7	62%	0.618	54%	0.538	S	S	*	.	H	α-helix	trans	-68.6	-39.8	-178.6	-152.3	150.6	0	0	0	111.2	N17 S18 R25	N17-L21 VanDerWaalsContact O-CB 3.25Å; N17-L21 WeakPolarHBondContact O-CB 3.26Å; N17-L21 PolarHBondContact O-N 2.83Å; S18-L21 PolarHBondContact O-N 3.41Å; L21-R25 WeakPolarHBondContact O-CB 3.12Å; L21-R25 PolarHBondContact O-N 3.33Å
22	N	83.1	Confident	86.8	Confident	94 Å²	94	108.2 Å²	108.2	50%	0.503	53%	0.532	S	S	.	.	H	α-helix	trans	-66	-39	173	-74.7	19	0	0	0	112.1	S18 Y19 R25 N26	S18-N22 WeakPolarHBondContact O-CB 3.32Å; S18-N22 VanDerWaalsContact O-CG 3.28Å; S18-N22 PolarHBondContact O-N 3.46Å; S18-N22 PolarHBondContact O-OD1 3.12Å; Y19-N22 PolarHBondContact O-N 2.91Å; N22-R25 PolarHBondContact O-N 3.46Å; N22-N26 VanDerWaalsContact O-CB 3.26Å; N22-N26 WeakPolarHBondContact O-CB 3.26Å; N22-N26 PolarHBondContact O-N 2.86Å
23	S	80.8	Confident	86.2	Confident	79 Å²	79	105.7 Å²	105.7	55%	0.552	53%	0.526	S	S	*	.	H	α-helix	trans	-63.3	-49.3	176.1	-168.5	0	0	0	0	111	Y19 K20 R25 N26 E27	Y19-S23 VanDerWaalsContact O-CB 3.29Å; Y19-S23 WeakPolarHBondContact O-CB 3.41Å; Y19-S23 PolarHBondContact O-N 2.91Å; K20-S23 PolarHBondContact O-N 3.33Å; S23-R25 VanDerWaalsContact C-N 3.33Å; S23-R25 PolarHBondContact O-N 3.41Å; S23-N26 PolarHBondContact O-N 2.83Å; S23-E27 WeakPolarHBondContact O-CB 3.42Å; S23-E27 PolarHBondContact O-N 2.81Å
24	T	82.7	Confident	85.6	Confident	80 Å²	80	107.3 Å²	107.3	49%	0.491	53%	0.532	S	S	.	.	H	α-helix	trans	-63.5	-39.2	176.2	-58.2	0	0	0	0	111.5	K20 E27 H28	K20-T24 PolarHBondContact O-N 3.3Å; K20-T24 PolarHBondContact O-OG1 2.85Å; K20-T24 VanDerWaalsContact O-OG1 3.12Å; T24-E27 PolarHBondContact O-N 3.49Å; T24-H28 VanDerWaalsContact O-CB 3.27Å; T24-H28 WeakPolarHBondContact O-CB 3.29Å; T24-H28 PolarHBondContact O-N 2.88Å
25	R	84.6	Confident	84.9	Confident	164 Å²	164	106.9 Å²	106.9	62%	0.619	54%	0.54	S	S	*	.	H	α-helix	trans	-66	-41.5	177	-172.9	166.2	116.6	109.1	-2.3	111.7	L21 N22 S23 H28 L29	L21-R25 WeakPolarHBondContact O-CB 3.12Å; L21-R25 PolarHBondContact O-N 3.33Å; N22-R25 PolarHBondContact O-N 3.46Å; S23-R25 VanDerWaalsContact C-N 3.33Å; S23-R25 PolarHBondContact O-N 3.41Å; R25-H28 PolarHBondContact O-N 3.46Å; R25-L29 HydrophobicContact CG-CD1 4.34Å; R25-L29 WeakPolarHBondContact O-CB 3.27Å; R25-L29 VanDerWaalsContact O-CG 3.26Å; R25-L29 WeakPolarHBondContact O-CG 3.2Å; R25-L29 PolarHBondContact O-N 2.8Å
26	N	82.5	Confident	83.9	Confident	111 Å²	111	111.8 Å²	111.8	59%	0.594	56%	0.558	S	S	*	*	H	α-helix	trans	-67.7	-39.8	176.9	-169.3	55.5	0	0	0	111.6	N22 S23 L29 K30	N22-N26 VanDerWaalsContact O-CB 3.26Å; N22-N26 WeakPolarHBondContact O-CB 3.26Å; N22-N26 PolarHBondContact O-N 2.86Å; S23-N26 PolarHBondContact O-N 2.83Å; N26-L29 PolarHBondContact O-N 2.9Å; N26-K30 WeakPolarHBondContact O-CB 3.39Å; N26-K30 PolarHBondContact O-N 2.82Å
27	E	84.9	Confident	82.4	Confident	117 Å²	117	120 Å²	120	55%	0.547	58%	0.582	S	S	.	*	H	α-helix	trans	-64.5	-43	173.3	-173.7	171.5	79	0	0	111.7	S23 T24 K30 N31	S23-E27 WeakPolarHBondContact O-CB 3.42Å; S23-E27 PolarHBondContact O-N 2.81Å; T24-E27 PolarHBondContact O-N 3.49Å; E27-K30 PolarHBondContact O-N 3.33Å; E27-N31 WeakPolarHBondContact O-CB 3.15Å; E27-N31 PolarHBondContact O-N 3.43Å
28	H	86.2	Confident	82.1	Confident	124 Å²	124	121.6 Å²	121.6	57%	0.574	59%	0.587	S	S	*	*	H	α-helix	trans	-63.4	-43.6	176.2	-174.9	69.1	0	0	0	112	T24 R25 N31 L32	T24-H28 VanDerWaalsContact O-CB 3.27Å; T24-H28 WeakPolarHBondContact O-CB 3.29Å; T24-H28 PolarHBondContact O-N 2.88Å; R25-H28 PolarHBondContact O-N 3.46Å; H28-N31 PolarHBondContact O-N 3.31Å; H28-L32 WeakPolarHBondContact O-CB 3.46Å; H28-L32 PolarHBondContact O-N 2.81Å
29	L	83.7	Confident	81.7	Confident	63 Å²	63	124.6 Å²	124.6	33%	0.33	59%	0.594	S	S	.	*	H	α-helix	trans	-64.3	-45.4	174.1	-71.1	173.8	0	0	0	111	R25 N26 N31 L32 F33	R25-L29 HydrophobicContact CG-CD1 4.34Å; R25-L29 WeakPolarHBondContact O-CB 3.27Å; R25-L29 VanDerWaalsContact O-CG 3.26Å; R25-L29 WeakPolarHBondContact O-CG 3.2Å; R25-L29 PolarHBondContact O-N 2.8Å; N26-L29 PolarHBondContact O-N 2.9Å; L29-N31 VanDerWaalsContact C-N 3.31Å; L29-N31 PolarHBondContact O-N 3.41Å; L29-L32 CarbonylContact O-C 3.6Å; L29-L32 WeakPolarHBondContact O-CB 3.35Å; L29-L32 PolarHBondContact O-N 3.35Å; L29-L32 VanDerWaalsContact O-N 3.11Å; L29-F33 WeakPolarHBondContact O-CD2 3.44Å; L29-F33 PolarHBondContact O-N 3.43Å
30	K	84.8	Confident	81.3	Confident	131 Å²	131	122.6 Å²	122.6	57%	0.57	59%	0.592	S	S	*	*	H	α-helix	trans	-57.4	-45.6	176.1	-178.5	-179.3	175.2	-173.9	0	110.8	N26 E27 F33 I34	N26-K30 WeakPolarHBondContact O-CB 3.39Å; N26-K30 PolarHBondContact O-N 2.82Å; E27-K30 PolarHBondContact O-N 3.33Å; K30-F33 PolarHBondContact O-N 3.27Å; K30-I34 HydrophobicContact CD-CD1 4.35Å; K30-I34 HydrophobicContact CG-CD1 3.71Å; K30-I34 HydrophobicContact CG-CG1 4.41Å; K30-I34 WeakPolarHBondContact O-CB 3.44Å; K30-I34 WeakPolarHBondContact O-CG1 3.4Å; K30-I34 PolarHBondContact O-N 3.01Å
31	N	82.9	Confident	80.8	Confident	88 Å²	88	121.2 Å²	121.2	47%	0.471	59%	0.59	S	S	.	*	H	α-helix	trans	-63.1	-43	174.9	-77.7	4.2	0	0	0	111.5	E27 H28 L29 F33 I34 T35	E27-N31 WeakPolarHBondContact O-CB 3.15Å; E27-N31 PolarHBondContact O-N 3.43Å; H28-N31 PolarHBondContact O-N 3.31Å; L29-N31 VanDerWaalsContact C-N 3.31Å; L29-N31 PolarHBondContact O-N 3.41Å; N31-F33 VanDerWaalsContact C-N 3.32Å; N31-F33 PolarHBondContact O-N 2.85Å; N31-I34 PolarHBondContact O-N 2.85Å; N31-T35 WeakPolarHBondContact O-CB 3.43Å; N31-T35 PolarHBondContact O-N 3.11Å; N31-T35 PolarHBondContact O-OG1 3.4Å
32	L	83.9	Confident	80.4	Confident	104 Å²	104	121.4 Å²	121.4	55%	0.545	59%	0.588	S	S	.	*	H	α-helix	trans	-61.9	-38.8	176.8	-171.9	71.4	0	0	0	112.2	H28 L29 K36	H28-L32 WeakPolarHBondContact O-CB 3.46Å; H28-L32 PolarHBondContact O-N 2.81Å; L29-L32 CarbonylContact O-C 3.6Å; L29-L32 WeakPolarHBondContact O-CB 3.35Å; L29-L32 PolarHBondContact O-N 3.35Å; L29-L32 VanDerWaalsContact O-N 3.11Å; L32-K36 WeakPolarHBondContact O-CB 3.38Å; L32-K36 PolarHBondContact O-N 2.86Å
33	F	81.5	Confident	80.2	Confident	129 Å²	129	123.3 Å²	123.3	57%	0.566	59%	0.594	S	S	*	*	H	α-helix	trans	-69.1	-44.9	174.1	-81.2	-73.1	0	0	0	111.5	L29 K30 N31 T35 K36 Y37	L29-F33 WeakPolarHBondContact O-CD2 3.44Å; L29-F33 PolarHBondContact O-N 3.43Å; K30-F33 PolarHBondContact O-N 3.27Å; N31-F33 VanDerWaalsContact C-N 3.32Å; N31-F33 PolarHBondContact O-N 2.85Å; F33-T35 PolarHBondContact O-N 3.21Å; F33-K36 PolarHBondContact O-N 3.48Å; F33-Y37 WeakPolarHBondContact O-CD2 3.21Å; F33-Y37 PolarHBondContact O-N 3.44Å
34	I	77	Confident	80.2	Confident	99 Å²	99	126.4 Å²	126.4	51%	0.508	60%	0.597	S	S	.	*	H	α-helix	trans	-63.4	-40.3	178.5	-68.9	167	0	0	0	111.3	K30 N31 K36	K30-I34 HydrophobicContact CD-CD1 4.35Å; K30-I34 HydrophobicContact CG-CD1 3.71Å; K30-I34 HydrophobicContact CG-CG1 4.41Å; K30-I34 WeakPolarHBondContact O-CB 3.44Å; K30-I34 WeakPolarHBondContact O-CG1 3.4Å; K30-I34 PolarHBondContact O-N 3.01Å; N31-I34 PolarHBondContact O-N 2.85Å; I34-K36 VanDerWaalsContact C-N 3.25Å; I34-K36 PolarHBondContact O-N 3.38Å
35	T	76.8	Confident	80	Confident	121 Å²	121	130 Å²	130	74%	0.742	61%	0.605	S	S	*	*	H	α-helix	trans	-71	-19.9	178.3	-57	0	0	0	0	112.9	N31 F33	N31-T35 WeakPolarHBondContact O-CB 3.43Å; N31-T35 PolarHBondContact O-N 3.11Å; N31-T35 PolarHBondContact O-OG1 3.4Å; F33-T35 PolarHBondContact O-N 3.21Å
36	K	70.6	Confident	79.6	Confident	183 Å²	183	127.2 Å²	127.2	80%	0.796	60%	0.604	S	S	*	*	H	α-helix	trans	-86.8	-17.8	-179.2	-169.5	174	178.7	-177.2	0	113.7	L32 F33 I34	L32-K36 WeakPolarHBondContact O-CB 3.38Å; L32-K36 PolarHBondContact O-N 2.86Å; F33-K36 PolarHBondContact O-N 3.48Å; I34-K36 VanDerWaalsContact C-N 3.25Å; I34-K36 PolarHBondContact O-N 3.38Å
37	Y	60.7	Low	79.4	Confident	256 Å²	256	128.6 Å²	128.6	100%	1.004	61%	0.605	S	S	*	*			trans	-97.9	0	173.2	-77.8	-79.8	0	0	0	110.9	F33	F33-Y37 WeakPolarHBondContact O-CD2 3.21Å; F33-Y37 PolarHBondContact O-N 3.44Å

Retrieved 37 of 37 residues in 52.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).