B9ELW4_SALSA Loading...

Stress-associated endoplasmic reticulum protein

Interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. Protects unfolded target proteins against degradation during ER stress. May facilitate glycosylation of target proteins after termination of ER stress. May modulate the use of N-glycosylation sites on target proteins. Interacts with target proteins during translocation into the lumen of the endoplasmic reticulum. Protects unfolded target proteins against degradation and facilitate correct glycosylation.

AlphaFold DB , UniProt , Accession B9ELW4, Species SALSA (Salmo salar, Atlantic salmon), Gene SERP1, Length 66 aa.

						>B9ELW4_SALSA|B9ELW4|SERP1
MVAKQRIRMANEKHSKNITQRGNVSKSTRNPQDDKVAVGPWLLALFIFVVCGSAIFQIIQSIRMGM
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.1	Low	68.3	Low	226 Å²	226	125.5 Å²	125.5	100%	1.113	62%	0.621	S	S	*	*				0	40.7	0	-77.3	-168	-83	0	0	113.6
2	V	58.8	Low	69.1	Low	85 Å²	85	122.5 Å²	122.5	52%	0.515	61%	0.605	S	S	.	*			trans	-110	-28.2	-178.6	-169.1	0	0	0	0	112.5	Q5 R6	V2-Q5 PolarHBondContact O-N 3.31Å; V2-R6 VanDerWaalsContact CG1-NH2 3.27Å; V2-R6 WeakPolarHBondContact O-CG 2.96Å; V2-R6 PolarHBondContact O-N 3.39Å; V2-R6 PolarHBondContact O-NE 3.48Å
3	A	62.2	Low	69.7	Low	63 Å²	63	123.7 Å²	123.7	52%	0.521	60%	0.604	S	S	.	*	H	α-helix	trans	-66.4	-41.2	-177.9	0	0	0	0	0	113.7	Q5 R6 I7	A3-Q5 VanDerWaalsContact C-N 3.26Å; A3-Q5 PolarHBondContact O-N 3.26Å; A3-R6 PolarHBondContact O-N 3.35Å; A3-I7 WeakPolarHBondContact O-CG1 3.47Å; A3-I7 PolarHBondContact O-N 3.23Å
4	K	61.7	Low	70	Confident	187 Å²	187	123.9 Å²	123.9	81%	0.813	60%	0.603	S	S	*	*	H	α-helix	trans	-60.4	-34.4	176.5	-90.6	-170.8	174	-170	0	112.9	R8	K4-R8 PolarHBondContact O-N 3.05Å
5	Q	67.6	Low	70.4	Confident	118 Å²	118	120.5 Å²	120.5	55%	0.551	60%	0.597	S	S	*	*	H	α-helix	trans	-73.3	-36.5	-177.2	-162.3	170.8	-10.7	0	0	112.1	V2 A3 R8 M9	V2-Q5 PolarHBondContact O-N 3.31Å; A3-Q5 VanDerWaalsContact C-N 3.26Å; A3-Q5 PolarHBondContact O-N 3.26Å; Q5-R8 PolarHBondContact O-N 3.11Å; Q5-M9 PolarHBondContact O-N 3.46Å; Q5-M9 VanDerWaalsContact O-N 3.11Å
6	R	66.4	Low	70.5	Confident	167 Å²	167	123.4 Å²	123.4	63%	0.63	61%	0.605	S	S	*	*	H	α-helix	trans	-66.9	-42.8	175.5	-14.4	-177.2	175.4	-171.8	-6	111.3	V2 A3 M9 A10	V2-R6 VanDerWaalsContact CG1-NH2 3.27Å; V2-R6 WeakPolarHBondContact O-CG 2.96Å; V2-R6 PolarHBondContact O-N 3.39Å; V2-R6 PolarHBondContact O-NE 3.48Å; A3-R6 PolarHBondContact O-N 3.35Å; R6-M9 PolarHBondContact O-N 2.95Å; R6-A10 WeakPolarHBondContact O-CB 3.38Å; R6-A10 PolarHBondContact O-N 2.94Å
7	I	73.8	Confident	70.3	Confident	108 Å²	108	123.6 Å²	123.6	55%	0.554	61%	0.609	S	S	*	*	H	α-helix	trans	-65.4	-40.6	177.6	-65.7	-178.8	0	0	0	110.8	A3 M9 A10 N11	A3-I7 WeakPolarHBondContact O-CG1 3.47Å; A3-I7 PolarHBondContact O-N 3.23Å; I7-M9 PolarHBondContact O-N 3.5Å; I7-A10 PolarHBondContact O-N 3.48Å; I7-N11 PolarHBondContact O-N 2.96Å
8	R	76.3	Confident	70.3	Confident	160 Å²	160	120.9 Å²	120.9	60%	0.604	60%	0.597	S	S	*	*	H	α-helix	trans	-61.2	-45.5	176.2	-160.4	176.1	84	-150.6	4.9	111.9	K4 Q5 A10 N11 E12	K4-R8 PolarHBondContact O-N 3.05Å; Q5-R8 PolarHBondContact O-N 3.11Å; R8-A10 VanDerWaalsContact C-N 3.35Å; R8-A10 PolarHBondContact O-N 3.32Å; R8-N11 PolarHBondContact O-N 3.09Å; R8-E12 IonicContact NE-OE1 3.7Å; R8-E12 WeakPolarHBondContact O-CG 3.43Å; R8-E12 PolarHBondContact O-N 3.4Å
9	M	77.6	Confident	70.6	Confident	107 Å²	107	121.1 Å²	121.1	53%	0.527	61%	0.605	S	S	.	*	H	α-helix	trans	-67.5	-34.8	178.9	-168	-179.9	-79.2	0	0	112.4	Q5 R6 I7 K13	Q5-M9 PolarHBondContact O-N 3.46Å; Q5-M9 VanDerWaalsContact O-N 3.11Å; R6-M9 PolarHBondContact O-N 2.95Å; I7-M9 PolarHBondContact O-N 3.5Å; M9-K13 WeakPolarHBondContact O-CG 3.38Å; M9-K13 PolarHBondContact O-N 3.33Å; M9-K13 VanDerWaalsContact O-N 3.09Å
10	A	74.6	Confident	70.3	Confident	54 Å²	54	121.4 Å²	121.4	45%	0.446	61%	0.605	S	S	.	*	H	α-helix	trans	-66.3	-43.5	173.5	0	0	0	0	0	111.9	R6 I7 R8 E12 K13 H14	R6-A10 WeakPolarHBondContact O-CB 3.38Å; R6-A10 PolarHBondContact O-N 2.94Å; I7-A10 PolarHBondContact O-N 3.48Å; R8-A10 VanDerWaalsContact C-N 3.35Å; R8-A10 PolarHBondContact O-N 3.32Å; A10-E12 PolarHBondContact O-N 2.83Å; A10-K13 PolarHBondContact O-N 3.36Å; A10-H14 WeakPolarHBondContact O-CB 3.48Å; A10-H14 PolarHBondContact O-N 3.45Å
11	N	77.8	Confident	70.3	Confident	105 Å²	105	125.6 Å²	125.6	56%	0.561	61%	0.614	S	S	*	*	H	α-helix	trans	-64.6	-39.2	176.1	-78	13.3	0	0	0	112.2	I7 R8 H14 S15	I7-N11 PolarHBondContact O-N 2.96Å; R8-N11 PolarHBondContact O-N 3.09Å; N11-H14 PolarHBondContact O-N 3.48Å; N11-S15 VanDerWaalsContact O-CB 3.24Å; N11-S15 WeakPolarHBondContact O-CB 3.24Å; N11-S15 PolarHBondContact O-N 3.29Å
12	E	78.6	Confident	71	Confident	90 Å²	90	117.7 Å²	117.7	42%	0.421	59%	0.59	S	S	.	*	H	α-helix	trans	-63.9	-38.9	175.1	-76.5	170.2	-172.9	0	0	112.1	R8 A10 K16	R8-E12 IonicContact NE-OE1 3.7Å; R8-E12 WeakPolarHBondContact O-CG 3.43Å; R8-E12 PolarHBondContact O-N 3.4Å; A10-E12 PolarHBondContact O-N 2.83Å; E12-K16 WeakPolarHBondContact O-CD 3.45Å; E12-K16 VanDerWaalsContact O-CG 3.22Å; E12-K16 WeakPolarHBondContact O-CG 3.22Å; E12-K16 PolarHBondContact O-N 3.16Å
13	K	76.6	Confident	71.4	Confident	138 Å²	138	119.2 Å²	119.2	60%	0.6	60%	0.595	S	S	*	*	H	α-helix	trans	-67.3	-43.6	173.8	-74.1	179.1	-178.9	-173.5	0	111.7	M9 A10 K16	M9-K13 WeakPolarHBondContact O-CG 3.38Å; M9-K13 PolarHBondContact O-N 3.33Å; M9-K13 VanDerWaalsContact O-N 3.09Å; A10-K13 PolarHBondContact O-N 3.36Å; K13-K16 PolarHBondContact O-N 2.91Å
14	H	74.1	Confident	71.6	Confident	126 Å²	126	121.4 Å²	121.4	58%	0.583	60%	0.602	S	S	*	*	H	α-helix	trans	-66.2	-42.5	179.6	-171	15.2	0	0	0	111.8	A10 N11 K16 N17	A10-H14 WeakPolarHBondContact O-CB 3.48Å; A10-H14 PolarHBondContact O-N 3.45Å; N11-H14 PolarHBondContact O-N 3.48Å; H14-K16 VanDerWaalsContact C-N 3.27Å; H14-K16 PolarHBondContact O-N 3.3Å; H14-N17 PolarHBondContact O-N 3.35Å; H14-N17 VanDerWaalsContact O-N 3.16Å
15	S	75.3	Confident	71.8	Confident	73 Å²	73	118.4 Å²	118.4	51%	0.51	60%	0.604	S	S	.	*	H	α-helix	trans	-64.2	-28.5	-179.8	-169.5	0	0	0	0	113.4	N11 N17	N11-S15 VanDerWaalsContact O-CB 3.24Å; N11-S15 WeakPolarHBondContact O-CB 3.24Å; N11-S15 PolarHBondContact O-N 3.29Å; S15-N17 VanDerWaalsContact C-N 3.33Å
16	K	73.2	Confident	71.8	Confident	168 Å²	168	122.1 Å²	122.1	73%	0.73	62%	0.619	S	S	*	*	H	α-helix	trans	-73.2	-23.5	177.2	-72.2	171.1	-172.4	-169.7	0	113.3	E12 K13 H14	E12-K16 WeakPolarHBondContact O-CD 3.45Å; E12-K16 VanDerWaalsContact O-CG 3.22Å; E12-K16 WeakPolarHBondContact O-CG 3.22Å; E12-K16 PolarHBondContact O-N 3.16Å; K13-K16 PolarHBondContact O-N 2.91Å; H14-K16 VanDerWaalsContact C-N 3.27Å; H14-K16 PolarHBondContact O-N 3.3Å
17	N	66.6	Low	71.8	Confident	127 Å²	127	118.3 Å²	118.3	68%	0.679	62%	0.617	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.5	-1.1	178.6	-72	-33.3	0	0	0	113.4	H14 S15 T19	H14-N17 PolarHBondContact O-N 3.35Å; H14-N17 VanDerWaalsContact O-N 3.16Å; S15-N17 VanDerWaalsContact C-N 3.33Å; N17-T19 VanDerWaalsContact C-N 3.34Å; N17-T19 PolarHBondContact O-N 3.09Å
18	I	70.9	Confident	71.3	Confident	74 Å²	74	120.2 Å²	120.2	38%	0.379	63%	0.634	S	S	.	*			trans	-81.5	83.9	173	-50.6	-65.2	0	0	0	108.5	Q20 R21	I18-Q20 VanDerWaalsContact C-N 3.29Å; I18-R21 HydrophobicContact CB-CB 4.4Å; I18-R21 HydrophobicContact CG2-CB 3.57Å; I18-R21 HydrophobicContact CG2-CG 3.98Å
19	T	75.1	Confident	70.4	Confident	124 Å²	124	120.8 Å²	120.8	76%	0.761	64%	0.637	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76	-18	178.9	54	0	0	0	0	113.3	N17	N17-T19 VanDerWaalsContact C-N 3.34Å; N17-T19 PolarHBondContact O-N 3.09Å
20	Q	65.3	Low	69.6	Low	127 Å²	127	120.7 Å²	120.7	59%	0.593	64%	0.638	S	S	*	*	T	Hydrogen-bonded Turn	trans	-105.7	16.4	-176	-63.7	-74.9	87.4	0	0	112.9	I18 G22 N23	I18-Q20 VanDerWaalsContact C-N 3.29Å; Q20-G22 PolarHBondContact O-N 2.96Å; Q20-N23 HydrophobicContact CB-CB 4.37Å; Q20-N23 PolarHBondContact NE2-ND2 3.04Å; Q20-N23 PolarHBondContact O-N 2.92Å
21	R	70.3	Confident	68.7	Low	211 Å²	211	123.3 Å²	123.3	80%	0.796	65%	0.65	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.6	110.7	-178.2	-150.5	173.3	-176.2	-114.2	0.1	109.2	I18	I18-R21 HydrophobicContact CB-CB 4.4Å; I18-R21 HydrophobicContact CG2-CB 3.57Å; I18-R21 HydrophobicContact CG2-CG 3.98Å
22	G	69.1	Low	67.7	Low	59 Å²	59	124.4 Å²	124.4	61%	0.608	65%	0.652	S	S	*	*	T	Hydrogen-bonded Turn	trans	89.7	5.6	-177.7	0	0	0	0	0	115	Q20 V24	Q20-G22 PolarHBondContact O-N 2.96Å; G22-V24 PolarHBondContact O-N 3.03Å
23	N	66.2	Low	66.6	Low	118 Å²	118	126.7 Å²	126.7	63%	0.631	67%	0.667	S	S	*	*			trans	-78.9	60.6	167.9	-164	54.1	0	0	0	110.6	Q20	Q20-N23 HydrophobicContact CB-CB 4.37Å; Q20-N23 PolarHBondContact NE2-ND2 3.04Å; Q20-N23 PolarHBondContact O-N 2.92Å
24	V	67.6	Low	65.7	Low	108 Å²	108	125.9 Å²	125.9	66%	0.655	67%	0.669	S	S	*	*	S	Bend	trans	-115	132	173.1	-65.5	0	0	0	0	107.2	G22 K26	G22-V24 PolarHBondContact O-N 3.03Å; V24-K26 PolarHBondContact O-N 3.06Å
25	S	64.8	Low	65	Low	124 Å²	124	127.1 Å²	127.1	87%	0.867	67%	0.673	S	S	*	*			trans	-54.8	113.4	176.6	-80.8	0	0	0	0	109.2	S27	S25-S27 PolarHBondContact O-N 3.36Å; S25-S27 VanDerWaalsContact O-N 3.09Å
26	K	68.4	Low	64.4	Low	197 Å²	197	128.5 Å²	128.5	86%	0.857	68%	0.679	S	S	*	*	S	Bend	trans	-74	102.8	173.4	-62.5	-166.3	-174.6	-174.8	0	107	V24	V24-K26 PolarHBondContact O-N 3.06Å
27	S	66.6	Low	64.3	Low	86 Å²	86	126 Å²	126	60%	0.601	69%	0.689	S	S	*	*			trans	73	131.9	176.3	-164.9	0	0	0	0	115.7	S25 R29	S25-S27 PolarHBondContact O-N 3.36Å; S25-S27 VanDerWaalsContact O-N 3.09Å; S27-R29 WeakPolarHBondContact OG-CB 3.37Å; S27-R29 PolarHBondContact OG-N 3.14Å; S27-R29 VanDerWaalsContact OG-N 3.14Å
28	T	61.9	Low	64.6	Low	148 Å²	148	122.9 Å²	122.9	91%	0.908	67%	0.674	S	S	*	*	S	Bend	trans	-78.8	-6.8	167.8	-41.5	0	0	0	0	111.8	N30	T28-N30 PolarHBondContact O-N 3.15Å; T28-N30 VanDerWaalsContact O-N 3.15Å
29	R	58.6	Low	65.4	Low	173 Å²	173	121.2 Å²	121.2	65%	0.653	68%	0.676	S	S	*	*			trans	-80.4	99.1	179.8	-169.5	175.5	176.6	134	-1	109	S27 P31 D34	S27-R29 WeakPolarHBondContact OG-CB 3.37Å; S27-R29 PolarHBondContact OG-N 3.14Å; S27-R29 VanDerWaalsContact OG-N 3.14Å; R29-P31 VanDerWaalsContact O-CD 3.27Å; R29-P31 WeakPolarHBondContact O-CD 3.27Å; R29-P31 VanDerWaalsContact O-N 3.16Å; R29-D34 IonicContact NH2-OD2 3.36Å; R29-D34 PolarHBondContact NH2-OD2 3.25Å
30	N	59.9	Low	65.9	Low	105 Å²	105	120.9 Å²	120.9	56%	0.561	68%	0.676	S	S	*	*			trans	-51.7	118.4	165.1	-101.2	17.9	0	0	0	108.6	T28 Q32 D33	T28-N30 PolarHBondContact O-N 3.15Å; T28-N30 VanDerWaalsContact O-N 3.15Å; N30-Q32 PolarHBondContact O-N 3.49Å; N30-D33 PolarHBondContact O-N 3.28Å
31	P	57	Low	67	Low	108 Å²	108	125.4 Å²	125.4	70%	0.701	69%	0.687	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.4	-0.1	173.6	27.5	-33.4	0	0	0	112.9	R29	R29-P31 VanDerWaalsContact O-CD 3.27Å; R29-P31 WeakPolarHBondContact O-CD 3.27Å; R29-P31 VanDerWaalsContact O-N 3.16Å
32	Q	55.8	Low	68	Low	128 Å²	128	120.6 Å²	120.6	60%	0.598	68%	0.677	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80	-17.8	175	-114.7	96.1	28	0	0	114	N30 D34 K35	N30-Q32 PolarHBondContact O-N 3.49Å; Q32-D34 PolarHBondContact O-N 3.31Å; Q32-K35 PolarHBondContact O-N 3.14Å; Q32-K35 VanDerWaalsContact O-N 3.14Å
33	D	56	Low	68.9	Low	139 Å²	139	121.3 Å²	121.3	74%	0.743	67%	0.667	S	S	*	*	T	Hydrogen-bonded Turn	trans	-70.3	-18.6	-174.1	-119.3	-101.3	0	0	0	113.5	N30 K35	N30-D33 PolarHBondContact O-N 3.28Å; D33-K35 VanDerWaalsContact C-N 3.3Å
34	D	57.5	Low	70.1	Confident	120 Å²	120	118.6 Å²	118.6	64%	0.642	66%	0.66	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.4	0.6	175.9	-77.7	-77.4	0	0	0	112.9	R29 Q32 V36	R29-D34 IonicContact NH2-OD2 3.36Å; R29-D34 PolarHBondContact NH2-OD2 3.25Å; Q32-D34 PolarHBondContact O-N 3.31Å; D34-V36 PolarHBondContact O-N 3.02Å
35	K	59.7	Low	71.4	Confident	152 Å²	152	118 Å²	118	66%	0.661	65%	0.653	S	S	*	*	S	Bend	trans	-94.2	102.4	173.4	-68.4	-171.5	-175.5	-68.9	0	108.4	Q32 D33 A37	Q32-K35 PolarHBondContact O-N 3.14Å; Q32-K35 VanDerWaalsContact O-N 3.14Å; D33-K35 VanDerWaalsContact C-N 3.3Å; K35-A37 PolarHBondContact O-N 2.72Å
36	V	62.3	Low	72.7	Confident	103 Å²	103	118.6 Å²	118.6	62%	0.624	64%	0.64	S	S	*	*			trans	3.5	109.9	160	-155.6	0	0	0	0	111.8	D34 V38	D34-V36 PolarHBondContact O-N 3.02Å; V36-V38 HydrophobicContact CG1-CG2 3.68Å; V36-V38 CarbonylContact O-C 3.06Å; V36-V38 PolarHBondContact O-N 3.34Å
37	A	70.4	Confident	73.9	Confident	115 Å²	115	113.7 Å²	113.7	95%	0.95	62%	0.622	S	S	*	*	S	Bend	trans	-54.3	-6.4	-175.7	0	0	0	0	0	114.9	K35	K35-A37 PolarHBondContact O-N 2.72Å
38	V	74.1	Confident	75.3	Confident	61 Å²	61	116.6 Å²	116.6	37%	0.37	62%	0.624	S	S	.	*	S	Bend	trans	-109.2	127.9	171.5	-63.7	0	0	0	0	110.7	V36 L42 L43	V36-V38 HydrophobicContact CG1-CG2 3.68Å; V36-V38 CarbonylContact O-C 3.06Å; V36-V38 PolarHBondContact O-N 3.34Å; V38-L42 HydrophobicContact CB-CD2 4.21Å; V38-L42 HydrophobicContact CG1-CD2 4.15Å; V38-L43 HydrophobicContact CG2-CB 4.38Å; V38-L43 HydrophobicContact CG2-CD1 4.26Å
39	G	86.5	Confident	76.8	Confident	40 Å²	40	113.2 Å²	113.2	41%	0.412	60%	0.604	S	S	.	*			trans	-61.2	148.8	178.9	0	0	0	0	0	112.2	W41 L42 L43	G39-W41 PolarHBondContact O-N 3.47Å; G39-W41 VanDerWaalsContact O-N 3.07Å; G39-L42 WeakPolarHBondContact O-CB 3.32Å; G39-L42 PolarHBondContact O-N 2.97Å; G39-L43 PolarHBondContact O-N 2.83Å
40	P	85.9	Confident	78.5	Confident	116 Å²	116	108.7 Å²	108.7	75%	0.753	60%	0.595	S	S	*	*	H	α-helix	trans	-52.5	-35.5	-179.4	-27.7	33.9	0	0	0	113.9	A44	P40-A44 WeakPolarHBondContact O-CB 3.21Å; P40-A44 PolarHBondContact O-N 2.95Å
41	W	89.1	Confident	80.1	Confident	222 Å²	222	107.3 Å²	107.3	84%	0.841	59%	0.592	S	S	*	*	H	α-helix	trans	-67.6	-43	176.9	-123.1	65.2	0	0	0	112.7	G39 L43 A44 L45	G39-W41 PolarHBondContact O-N 3.47Å; G39-W41 VanDerWaalsContact O-N 3.07Å; W41-L43 VanDerWaalsContact C-N 3.34Å; W41-A44 PolarHBondContact O-N 3.07Å; W41-L45 WeakPolarHBondContact O-CB 3.46Å; W41-L45 PolarHBondContact O-N 3.44Å
42	L	90	Very high	81.8	Confident	110 Å²	110	102.7 Å²	102.7	58%	0.576	56%	0.564	S	S	*	*	H	α-helix	trans	-66.2	-40.7	177.2	-160.1	85.2	0	0	0	110.5	V38 G39 L45 F46	V38-L42 HydrophobicContact CB-CD2 4.21Å; V38-L42 HydrophobicContact CG1-CD2 4.15Å; G39-L42 WeakPolarHBondContact O-CB 3.32Å; G39-L42 PolarHBondContact O-N 2.97Å; L42-L45 PolarHBondContact O-N 3.37Å; L42-F46 WeakPolarHBondContact O-CB 3.44Å; L42-F46 PolarHBondContact O-N 2.98Å
43	L	89.8	Confident	83.6	Confident	75 Å²	75	99.1 Å²	99.1	39%	0.393	55%	0.554	S	S	.	*	H	α-helix	trans	-64.3	-44.5	176.7	-173.9	64.9	0	0	0	111.7	V38 G39 W41 F46 I47	V38-L43 HydrophobicContact CG2-CB 4.38Å; V38-L43 HydrophobicContact CG2-CD1 4.26Å; G39-L43 PolarHBondContact O-N 2.83Å; W41-L43 VanDerWaalsContact C-N 3.34Å; L43-F46 PolarHBondContact O-N 3.43Å; L43-I47 HydrophobicContact CD1-CD1 4.34Å; L43-I47 HydrophobicContact CG-CD1 4.13Å; L43-I47 VanDerWaalsContact O-CG1 3.32Å; L43-I47 WeakPolarHBondContact O-CG1 3.36Å; L43-I47 PolarHBondContact O-N 3.08Å
44	A	91.1	Very high	85.2	Confident	60 Å²	60	94.7 Å²	94.7	50%	0.496	54%	0.536	S	S	.	.	H	α-helix	trans	-62.4	-44.6	176	0	0	0	0	0	111.8	P40 W41 I47 F48	P40-A44 WeakPolarHBondContact O-CB 3.21Å; P40-A44 PolarHBondContact O-N 2.95Å; W41-A44 PolarHBondContact O-N 3.07Å; A44-I47 PolarHBondContact O-N 2.97Å; A44-F48 VanDerWaalsContact O-CB 3.31Å; A44-F48 WeakPolarHBondContact O-CB 3.36Å; A44-F48 PolarHBondContact O-N 3.47Å
45	L	93.9	Very high	86.9	Confident	96 Å²	96	93.6 Å²	93.6	50%	0.503	53%	0.53	S	S	.	.	H	α-helix	trans	-63.8	-42.8	176.7	-167.9	155.5	0	0	0	111.2	W41 L42 F48 V49	W41-L45 WeakPolarHBondContact O-CB 3.46Å; W41-L45 PolarHBondContact O-N 3.44Å; L42-L45 PolarHBondContact O-N 3.37Å; L45-F48 PolarHBondContact O-N 2.96Å; L45-V49 HydrophobicContact CD2-CG2 3.85Å; L45-V49 WeakPolarHBondContact O-CB 3.36Å; L45-V49 WeakPolarHBondContact O-CG2 3.25Å; L45-V49 PolarHBondContact O-N 2.89Å
46	F	93.3	Very high	88.3	Confident	136 Å²	136	92.2 Å²	92.2	60%	0.596	52%	0.524	S	S	*	.	H	α-helix	trans	-59.7	-49.4	177.3	-177	-102.6	0	0	0	111.7	L42 L43 F48 V49 V50	L42-F46 WeakPolarHBondContact O-CB 3.44Å; L42-F46 PolarHBondContact O-N 2.98Å; L43-F46 PolarHBondContact O-N 3.43Å; F46-F48 PolarHBondContact O-N 2.9Å; F46-V49 PolarHBondContact O-N 3.49Å; F46-V50 HydrophobicContact CD2-CG2 4.24Å; F46-V50 HydrophobicContact CE1-CG2 4.33Å; F46-V50 HydrophobicContact CE2-CG2 3.98Å; F46-V50 HydrophobicContact CZ-CG2 4.03Å; F46-V50 WeakPolarHBondContact O-CB 3.4Å; F46-V50 VanDerWaalsContact O-CG2 3.25Å; F46-V50 WeakPolarHBondContact O-CG2 3.33Å; F46-V50 PolarHBondContact O-N 3.33Å
47	I	93.5	Very high	89.5	Confident	94 Å²	94	93.4 Å²	93.4	48%	0.482	52%	0.523	S	S	.	.	H	α-helix	trans	-63.1	-43.5	177.4	-65.6	167.1	0	0	0	110.8	L43 A44 C51	L43-I47 HydrophobicContact CD1-CD1 4.34Å; L43-I47 HydrophobicContact CG-CD1 4.13Å; L43-I47 VanDerWaalsContact O-CG1 3.32Å; L43-I47 WeakPolarHBondContact O-CG1 3.36Å; L43-I47 PolarHBondContact O-N 3.08Å; A44-I47 PolarHBondContact O-N 2.97Å; I47-C51 WeakPolarHBondContact O-CB 3.1Å; I47-C51 PolarHBondContact O-N 3.21Å
48	F	95	Very high	90.4	Very high	147 Å²	147	92.5 Å²	92.5	65%	0.645	50%	0.501	S	S	*	.	H	α-helix	trans	-61.8	-46.3	179.1	176.2	-100.1	0	0	0	112.4	A44 L45 F46 G52	A44-F48 VanDerWaalsContact O-CB 3.31Å; A44-F48 WeakPolarHBondContact O-CB 3.36Å; A44-F48 PolarHBondContact O-N 3.47Å; L45-F48 PolarHBondContact O-N 2.96Å; F46-F48 PolarHBondContact O-N 2.9Å; F48-G52 WeakPolarHBondContact O-CA 3.48Å; F48-G52 PolarHBondContact O-N 2.95Å
49	V	93.9	Very high	91	Very high	78 Å²	78	94 Å²	94	47%	0.473	51%	0.506	S	S	.	.	H	α-helix	trans	-68.5	-46.2	-180	171.5	0	0	0	0	111	L45 F46 S53	L45-V49 HydrophobicContact CD2-CG2 3.85Å; L45-V49 WeakPolarHBondContact O-CB 3.36Å; L45-V49 WeakPolarHBondContact O-CG2 3.25Å; L45-V49 PolarHBondContact O-N 2.89Å; F46-V49 PolarHBondContact O-N 3.49Å; V49-S53 WeakPolarHBondContact O-CB 3.31Å; V49-S53 PolarHBondContact O-N 2.94Å; V49-S53 PolarHBondContact O-OG 3.27Å
50	V	93.4	Very high	91	Very high	77 Å²	77	97 Å²	97	47%	0.467	51%	0.509	S	S	.	.	H	α-helix	trans	-69.4	-54.8	-176.9	175.9	0	0	0	0	111.6	F46 S53	F46-V50 HydrophobicContact CD2-CG2 4.24Å; F46-V50 HydrophobicContact CE1-CG2 4.33Å; F46-V50 HydrophobicContact CE2-CG2 3.98Å; F46-V50 HydrophobicContact CZ-CG2 4.03Å; F46-V50 WeakPolarHBondContact O-CB 3.4Å; F46-V50 VanDerWaalsContact O-CG2 3.25Å; F46-V50 WeakPolarHBondContact O-CG2 3.33Å; F46-V50 PolarHBondContact O-N 3.33Å; V50-S53 PolarHBondContact O-OG 2.83Å; V50-S53 VanDerWaalsContact O-OG 3.08Å
51	C	94.6	Very high	90.8	Very high	76 Å²	76	94.4 Å²	94.4	51%	0.514	49%	0.494	S	S	.	.	H	α-helix	trans	-73	-38.6	179.1	-81.2	0	0	0	0	112.5	I47 A54 I55	I47-C51 WeakPolarHBondContact O-CB 3.1Å; I47-C51 PolarHBondContact O-N 3.21Å; C51-A54 PolarHBondContact O-N 3.35Å; C51-I55 WeakPolarHBondContact O-CG1 3.34Å; C51-I55 PolarHBondContact O-N 2.93Å
52	G	92.6	Very high	90.6	Very high	11 Å²	11	90.1 Å²	90.1	11%	0.113	49%	0.486	C	S	.	.	H	α-helix	trans	-64.1	-42.4	-179.5	0	0	0	0	0	112	F48 A54 I55 F56	F48-G52 WeakPolarHBondContact O-CA 3.48Å; F48-G52 PolarHBondContact O-N 2.95Å; G52-A54 VanDerWaalsContact C-N 3.31Å; G52-A54 PolarHBondContact O-N 3.34Å; G52-I55 PolarHBondContact O-N 3.49Å; G52-F56 WeakPolarHBondContact O-CD2 3.37Å; G52-F56 PolarHBondContact O-N 2.89Å
53	S	92.7	Very high	89.9	Confident	54 Å²	54	95.6 Å²	95.6	38%	0.378	50%	0.499	S	S	.	.	H	α-helix	trans	-63.7	-34.9	179.2	62.5	0	0	0	0	113.1	V49 V50 Q57	V49-S53 WeakPolarHBondContact O-CB 3.31Å; V49-S53 PolarHBondContact O-N 2.94Å; V49-S53 PolarHBondContact O-OG 3.27Å; V50-S53 PolarHBondContact O-OG 2.83Å; V50-S53 VanDerWaalsContact O-OG 3.08Å; S53-Q57 WeakPolarHBondContact O-CB 3.13Å; S53-Q57 WeakPolarHBondContact O-CG 3.35Å; S53-Q57 PolarHBondContact O-N 3.37Å; S53-Q57 PolarHBondContact O-NE2 3.45Å
54	A	90.5	Very high	88.8	Confident	45 Å²	45	98.6 Å²	98.6	37%	0.372	51%	0.512	S	S	.	.	H	α-helix	trans	-65.7	-43.4	174.1	0	0	0	0	0	111.5	C51 G52 Q57 I58	C51-A54 PolarHBondContact O-N 3.35Å; G52-A54 VanDerWaalsContact C-N 3.31Å; G52-A54 PolarHBondContact O-N 3.34Å; A54-Q57 PolarHBondContact O-N 3.4Å; A54-I58 WeakPolarHBondContact O-CD1 3.14Å; A54-I58 VanDerWaalsContact O-CG1 3.24Å; A54-I58 WeakPolarHBondContact O-CG1 3.31Å; A54-I58 PolarHBondContact O-N 2.93Å
55	I	91.7	Very high	87.7	Confident	98 Å²	98	97.4 Å²	97.4	50%	0.503	51%	0.506	S	S	.	.	H	α-helix	trans	-63	-46.2	176.6	-65.4	167	0	0	0	110.7	C51 G52 Q57 I58 I59	C51-I55 WeakPolarHBondContact O-CG1 3.34Å; C51-I55 PolarHBondContact O-N 2.93Å; G52-I55 PolarHBondContact O-N 3.49Å; I55-Q57 PolarHBondContact O-N 2.76Å; I55-I58 PolarHBondContact O-N 2.9Å; I55-I59 HydrophobicContact CG2-CD1 3.71Å; I55-I59 HydrophobicContact CG2-CG1 4.41Å; I55-I59 VanDerWaalsContact O-CG1 3.31Å; I55-I59 WeakPolarHBondContact O-CG1 3.24Å; I55-I59 PolarHBondContact O-N 2.91Å
56	F	89.1	Confident	85.8	Confident	123 Å²	123	104.9 Å²	104.9	54%	0.539	54%	0.542	S	S	.	.	H	α-helix	trans	-63.4	-40.2	176.8	-80.5	-70.5	0	0	0	112.1	G52 I59 Q60	G52-F56 WeakPolarHBondContact O-CD2 3.37Å; G52-F56 PolarHBondContact O-N 2.89Å; F56-I59 PolarHBondContact O-N 3.13Å; F56-Q60 WeakPolarHBondContact O-CB 3.37Å; F56-Q60 VanDerWaalsContact O-CG 3.22Å; F56-Q60 WeakPolarHBondContact O-CG 3.46Å; F56-Q60 PolarHBondContact O-N 3.31Å
57	Q	88.1	Confident	85.4	Confident	128 Å²	128	103.4 Å²	103.4	60%	0.598	54%	0.539	S	S	*	.	H	α-helix	trans	-60.6	-43.2	173.5	-85	175.1	78.1	0	0	112.1	S53 A54 I55 Q60 S61	S53-Q57 WeakPolarHBondContact O-CB 3.13Å; S53-Q57 WeakPolarHBondContact O-CG 3.35Å; S53-Q57 PolarHBondContact O-N 3.37Å; S53-Q57 PolarHBondContact O-NE2 3.45Å; A54-Q57 PolarHBondContact O-N 3.4Å; I55-Q57 PolarHBondContact O-N 2.76Å; Q57-Q60 PolarHBondContact O-N 3.06Å; Q57-S61 VanDerWaalsContact O-CB 3.3Å; Q57-S61 WeakPolarHBondContact O-CB 3.25Å; Q57-S61 PolarHBondContact O-N 3.33Å; Q57-S61 PolarHBondContact O-OG 2.92Å; Q57-S61 VanDerWaalsContact O-OG 3.13Å
58	I	89.2	Confident	85	Confident	96 Å²	96	103.8 Å²	103.8	49%	0.492	54%	0.542	S	S	.	.	H	α-helix	trans	-65.8	-45.8	178.4	-68.4	161.8	0	0	0	111.2	A54 I55 Q60 S61 I62	A54-I58 WeakPolarHBondContact O-CD1 3.14Å; A54-I58 VanDerWaalsContact O-CG1 3.24Å; A54-I58 WeakPolarHBondContact O-CG1 3.31Å; A54-I58 PolarHBondContact O-N 2.93Å; I55-I58 PolarHBondContact O-N 2.9Å; I58-Q60 VanDerWaalsContact C-N 3.31Å; I58-Q60 PolarHBondContact O-N 3.19Å; I58-S61 WeakPolarHBondContact CA-OG 3.16Å; I58-S61 PolarHBondContact O-N 2.76Å; I58-S61 PolarHBondContact O-OG 3.38Å; I58-I62 HydrophobicContact CG2-CD1 3.68Å; I58-I62 HydrophobicContact CG2-CG1 4.48Å; I58-I62 WeakPolarHBondContact O-CB 3.22Å; I58-I62 VanDerWaalsContact O-CG1 3.23Å; I58-I62 WeakPolarHBondContact O-CG1 3.17Å; I58-I62 PolarHBondContact O-N 2.96Å
59	I	88.1	Confident	84.5	Confident	92 Å²	92	101.4 Å²	101.4	47%	0.472	54%	0.536	S	S	.	.	H	α-helix	trans	-63.7	-41.7	178.2	-67.2	169	0	0	0	110.1	I55 F56 R63	I55-I59 HydrophobicContact CG2-CD1 3.71Å; I55-I59 HydrophobicContact CG2-CG1 4.41Å; I55-I59 VanDerWaalsContact O-CG1 3.31Å; I55-I59 WeakPolarHBondContact O-CG1 3.24Å; I55-I59 PolarHBondContact O-N 2.91Å; F56-I59 PolarHBondContact O-N 3.13Å; I59-R63 WeakPolarHBondContact O-CB 3.37Å; I59-R63 PolarHBondContact O-N 3.46Å
60	Q	85.1	Confident	83.9	Confident	102 Å²	102	102.8 Å²	102.8	48%	0.477	54%	0.54	S	S	.	.	H	α-helix	trans	-65.3	-44	175.4	-78.9	-178.4	-6	0	0	111.6	F56 Q57 I58 I62 R63 M64	F56-Q60 WeakPolarHBondContact O-CB 3.37Å; F56-Q60 VanDerWaalsContact O-CG 3.22Å; F56-Q60 WeakPolarHBondContact O-CG 3.46Å; F56-Q60 PolarHBondContact O-N 3.31Å; Q57-Q60 PolarHBondContact O-N 3.06Å; I58-Q60 VanDerWaalsContact C-N 3.31Å; I58-Q60 PolarHBondContact O-N 3.19Å; Q60-I62 VanDerWaalsContact C-N 3.3Å; Q60-I62 PolarHBondContact O-N 2.75Å; Q60-R63 PolarHBondContact O-N 2.85Å; Q60-M64 HydrophobicContact CB-CE 3.54Å; Q60-M64 HydrophobicContact CG-CE 3.53Å; Q60-M64 WeakPolarHBondContact O-CA 3.3Å; Q60-M64 VanDerWaalsContact O-CB 3.25Å; Q60-M64 WeakPolarHBondContact O-CB 3.23Å; Q60-M64 PolarHBondContact O-N 3.44Å
61	S	82.5	Confident	83.3	Confident	63 Å²	63	104.4 Å²	104.4	44%	0.441	54%	0.544	S	S	.	.	H	α-helix	trans	-67.6	-29	179.1	64.8	0	0	0	0	113.1	Q57 I58 G65 M66	Q57-S61 VanDerWaalsContact O-CB 3.3Å; Q57-S61 WeakPolarHBondContact O-CB 3.25Å; Q57-S61 PolarHBondContact O-N 3.33Å; Q57-S61 PolarHBondContact O-OG 2.92Å; Q57-S61 VanDerWaalsContact O-OG 3.13Å; I58-S61 WeakPolarHBondContact CA-OG 3.16Å; I58-S61 PolarHBondContact O-N 2.76Å; I58-S61 PolarHBondContact O-OG 3.38Å; S61-G65 CarbonylContact O-C 3.42Å; S61-G65 WeakPolarHBondContact O-CA 3.48Å; S61-G65 PolarHBondContact O-N 3.42Å; S61-M66 PolarHBondContact O-N 3.33Å
62	I	85	Confident	82.5	Confident	131 Å²	131	106.3 Å²	106.3	67%	0.672	55%	0.546	S	S	*	.	H	α-helix	trans	-80.6	-38.5	175.4	-64.8	167.3	0	0	0	110.8	I58 Q60	I58-I62 HydrophobicContact CG2-CD1 3.68Å; I58-I62 HydrophobicContact CG2-CG1 4.48Å; I58-I62 WeakPolarHBondContact O-CB 3.22Å; I58-I62 VanDerWaalsContact O-CG1 3.23Å; I58-I62 WeakPolarHBondContact O-CG1 3.17Å; I58-I62 PolarHBondContact O-N 2.96Å; Q60-I62 VanDerWaalsContact C-N 3.3Å; Q60-I62 PolarHBondContact O-N 2.75Å
63	R	75.7	Confident	81.8	Confident	225 Å²	225	113.1 Å²	113.1	85%	0.849	58%	0.577	S	S	*	*	H	α-helix	trans	-83.5	-37.7	-176.4	-174.4	170.1	-179.1	164.3	1	114	I59 Q60	I59-R63 WeakPolarHBondContact O-CB 3.37Å; I59-R63 PolarHBondContact O-N 3.46Å; Q60-R63 PolarHBondContact O-N 2.85Å
64	M	66.6	Low	81	Confident	138 Å²	138	117.7 Å²	117.7	68%	0.68	59%	0.593	S	S	*	*	S	Bend	trans	-81.8	-1.4	171.6	-81.4	178.7	-90.3	0	0	112.1	Q60	Q60-M64 HydrophobicContact CB-CE 3.54Å; Q60-M64 HydrophobicContact CG-CE 3.53Å; Q60-M64 WeakPolarHBondContact O-CA 3.3Å; Q60-M64 VanDerWaalsContact O-CB 3.25Å; Q60-M64 WeakPolarHBondContact O-CB 3.23Å; Q60-M64 PolarHBondContact O-N 3.44Å
65	G	67.4	Low	80.2	Confident	35 Å²	35	123.8 Å²	123.8	36%	0.361	61%	0.611	S	S	.	*			trans	65.1	156.8	-167.3	0	0	0	0	0	110.1	S61	S61-G65 CarbonylContact O-C 3.42Å; S61-G65 WeakPolarHBondContact O-CA 3.48Å; S61-G65 PolarHBondContact O-N 3.42Å
66	M	54	Low	79.2	Confident	254 Å²	254	126.1 Å²	126.1	100%	1.251	62%	0.621	S	S	*	*				-48.2	0	110.3	-66.7	-174.5	-65	0	0	113.1	S61	S61-M66 PolarHBondContact O-N 3.33Å

Retrieved 66 of 66 residues in 41.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).