C1M1E5_SCHMA Loading...

ATP-binding protein

AlphaFold DB , UniProt , Accession C1M1E5, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 35 aa.

						>C1M1E5_SCHMA|C1M1E5
MNVLVSAGWRWDEELSNQPGLLVGDHLHWVWPVRE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	90.8	Very high	80.2	Confident	174 Å²	174	115.1 Å²	115.1	86%	0.857	56%	0.562	S	S	*	*				0	151.5	0	179.7	173.2	-170.9	0	0	109.4	V33	M1-V33 WeakPolarHBondContact O-CA 3.37Å; M1-V33 PolarHBondContact N-O 2.73Å; M1-V33 PolarHBondContact O-N 2.73Å; M1-V33 WeakPolarHBondContact O-CB 3.37Å
2	N	85.2	Confident	79.4	Confident	109 Å²	109	112.3 Å²	112.3	58%	0.583	55%	0.551	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-102.4	138.2	173.2	-65.7	-42.9	0	0	0	110.5	V30 W31 P32	N2-V30 HydrophobicContact CB-CG1 3.73Å; N2-W31 WeakPolarHBondContact CA-O 3.38Å; N2-P32 WeakPolarHBondContact OD1-CA 3.34Å
3	V	86.2	Confident	78.8	Confident	63 Å²	63	115.4 Å²	115.4	38%	0.382	56%	0.564	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-114.8	128.8	176.8	178.6	0	0	0	0	109.1	V5 W31 V33	V3-V5 HydrophobicContact CG1-CG2 4.13Å; V3-W31 PolarHBondContact N-O 3.31Å; V3-W31 PolarHBondContact O-N 2.95Å; V3-V33 HydrophobicContact CB-CG2 4.46Å; V3-V33 HydrophobicContact CG2-CG2 3.62Å
4	L	86.2	Confident	78.5	Confident	116 Å²	116	118.4 Å²	118.4	61%	0.607	58%	0.576	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-82	120.7	169.8	180	65.1	0	0	0	108.6	H28 V30	L4-H28 HydrophobicContact CD1-CB 4.18Å; L4-V30 HydrophobicContact CD1-CG2 4.39Å
5	V	83.8	Confident	77.8	Confident	51 Å²	51	112.5 Å²	112.5	31%	0.309	55%	0.548	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.5	135.2	175.3	-172.4	0	0	0	0	108.1	V3 H28 W29 W31	V3-V5 HydrophobicContact CG1-CG2 4.13Å; V5-H28 WeakPolarHBondContact O-CA 3.48Å; V5-W29 HydrophobicContact CB-CD2 4.22Å; V5-W29 HydrophobicContact CB-CG 4.4Å; V5-W29 HydrophobicContact CB-CZ2 3.87Å; V5-W29 HydrophobicContact CG1-CH2 4.11Å; V5-W29 HydrophobicContact CG1-CZ2 3.3Å; V5-W29 PolarHBondContact N-O 2.97Å; V5-W29 PolarHBondContact O-N 3.26Å; V5-W31 HydrophobicContact CG2-CB 4.39Å
6	S	86.6	Confident	77.2	Confident	62 Å²	62	108.5 Å²	108.5	43%	0.434	54%	0.535	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.8	126.5	-180	-45.2	0	0	0	0	109	L27 H28	S6-L27 WeakPolarHBondContact CA-O 3.22Å; S6-H28 WeakPolarHBondContact CB-ND1 3.34Å; S6-H28 PolarHBondContact OG-CE1 2.87Å; S6-H28 VanDerWaalsContact OG-CE1 3.26Å; S6-H28 PolarHBondContact OG-ND1 3.03Å
7	A	82.4	Confident	77.1	Confident	37 Å²	37	111.1 Å²	111.1	31%	0.306	55%	0.551	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-126.1	155.3	173.2	0	0	0	0	0	110	H26 L27 W29	A7-H26 CarbonylContact O-C 3.59Å; A7-H26 WeakPolarHBondContact O-CA 3.48Å; A7-L27 PolarHBondContact N-O 3Å; A7-L27 PolarHBondContact O-N 3.37Å; A7-W29 HydrophobicContact CB-CH2 3.61Å; A7-W29 HydrophobicContact CB-CZ3 4.1Å
8	G	78.5	Confident	77	Confident	35 Å²	35	108.1 Å²	108.1	36%	0.361	54%	0.536	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-62.9	155.4	167.9	0	0	0	0	0	110.5	R10	G8-R10 PolarHBondContact O-N 2.82Å
9	W	70.1	Confident	77.1	Confident	193 Å²	193	109.1 Å²	109.1	73%	0.731	55%	0.551	S	S	*	*	S	Bend	trans	-55.9	8.7	-177.3	69.1	-69.7	0	0	0	117.1	W11 D25	W9-W11 PolarHBondContact O-N 2.78Å; W9-D25 WeakPolarHBondContact CB-O 3.37Å; W9-D25 HydrophobicContact CG-CB 4.46Å; W9-D25 PolarHBondContact N-O 3.35Å
10	R	66.7	Low	77.4	Confident	226 Å²	226	105.8 Å²	105.8	85%	0.853	55%	0.546	S	S	*	.			trans	-61.7	111.6	168.4	-71.9	-162.1	164.6	-161.4	-4.5	107.5	G8 D12	G8-R10 PolarHBondContact O-N 2.82Å; R10-D12 PolarHBondContact O-N 2.87Å
11	W	65.4	Low	77.8	Confident	200 Å²	200	106.3 Å²	106.3	76%	0.758	55%	0.549	S	S	*	.			trans	-55.4	106.1	176.1	-176.2	-87.1	0	0	0	108.7	W9	W9-W11 PolarHBondContact O-N 2.78Å
12	D	70.4	Confident	77.6	Confident	81 Å²	81	103.4 Å²	103.4	43%	0.433	54%	0.536	S	S	.	.			trans	-95.3	114.7	169.2	-169.2	-39.5	0	0	0	106.9	R10 E14 L15 S16	R10-D12 PolarHBondContact O-N 2.87Å; D12-E14 PolarHBondContact OD1-N 3.24Å; D12-E14 WeakPolarHBondContact OD1-CB 3.41Å; D12-E14 PolarHBondContact O-N 3.13Å; D12-L15 HydrophobicContact CB-CB 4.15Å; D12-L15 HydrophobicContact CB-CD1 3.71Å; D12-L15 HydrophobicContact CB-CG 4.04Å; D12-L15 PolarHBondContact O-N 3.29Å; D12-S16 PolarHBondContact O-N 2.8Å; D12-S16 VanDerWaalsContact O-N 3.08Å
13	E	72.5	Confident	77.6	Confident	153 Å²	153	102 Å²	102	72%	0.715	53%	0.531	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.6	-30.7	-178.6	-68.9	-169.4	158.2	0	0	111.9	L15 S16	E13-L15 PolarHBondContact O-N 2.97Å; E13-S16 PolarHBondContact O-N 2.87Å; E13-S16 PolarHBondContact O-OG 2.93Å; E13-S16 WeakPolarHBondContact O-CB 3.47Å
14	E	73.6	Confident	77.7	Confident	158 Å²	158	102.3 Å²	102.3	74%	0.738	55%	0.548	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.6	-29.8	177.6	-164.1	177.2	157.9	0	0	111.8	D12	D12-E14 PolarHBondContact OD1-N 3.24Å; D12-E14 WeakPolarHBondContact OD1-CB 3.41Å; D12-E14 PolarHBondContact O-N 3.13Å
15	L	68.6	Low	77.7	Confident	29 Å²	29	101.2 Å²	101.2	15%	0.152	54%	0.542	C	S	.	.	T	Hydrogen-bonded Turn	trans	-93.8	-14.2	-179.1	-60.9	170.4	0	0	0	113	D12 E13 N17 Q18 W29	D12-L15 HydrophobicContact CB-CB 4.15Å; D12-L15 HydrophobicContact CB-CD1 3.71Å; D12-L15 HydrophobicContact CB-CG 4.04Å; D12-L15 PolarHBondContact O-N 3.29Å; E13-L15 PolarHBondContact O-N 2.97Å; L15-N17 PolarHBondContact O-N 3Å; L15-N17 VanDerWaalsContact O-N 3.13Å; L15-Q18 PolarHBondContact O-N 2.79Å; L15-W29 HydrophobicContact CG-CH2 4.16Å; L15-W29 HydrophobicContact CG-CZ2 4.06Å; L15-W29 HydrophobicContact CD2-CZ2 3.58Å; L15-W29 HydrophobicContact CD2-CH2 4.17Å; L15-W29 HydrophobicContact CD1-CZ3 3.83Å; L15-W29 HydrophobicContact CD1-CZ2 3.32Å; L15-W29 HydrophobicContact CD1-CH2 3.1Å; L15-W29 HydrophobicContact CD2-CD2 4.42Å
16	S	67.8	Low	77.7	Confident	49 Å²	49	102.8 Å²	102.8	34%	0.343	55%	0.546	S	S	.	.	T	Hydrogen-bonded Turn	trans	-58.5	-28.8	-175.8	67.9	0	0	0	0	114.5	D12 E13 Q18	D12-S16 PolarHBondContact O-N 2.8Å; D12-S16 VanDerWaalsContact O-N 3.08Å; E13-S16 PolarHBondContact O-N 2.87Å; E13-S16 PolarHBondContact O-OG 2.93Å; E13-S16 WeakPolarHBondContact O-CB 3.47Å; S16-Q18 VanDerWaalsContact C-N 3.33Å
17	N	75.8	Confident	77.7	Confident	152 Å²	152	102.4 Å²	102.4	81%	0.813	54%	0.539	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.6	-2.7	179.6	-67	-53.3	0	0	0	113.4	L15	L15-N17 PolarHBondContact O-N 3Å; L15-N17 VanDerWaalsContact O-N 3.13Å
18	Q	75.6	Confident	77.8	Confident	58 Å²	58	102.9 Å²	102.9	27%	0.271	54%	0.535	S	S	.	.	S	Bend	trans	-99.3	131.6	-178.6	-66.2	178	61.4	0	0	110.6	L15 S16 G20 W31	L15-Q18 PolarHBondContact O-N 2.79Å; S16-Q18 VanDerWaalsContact C-N 3.33Å; Q18-G20 PolarHBondContact O-N 2.7Å; Q18-W31 VanDerWaalsContact OE1-CE3 3.31Å
19	P	77.8	Confident	78.1	Confident	126 Å²	126	102.1 Å²	102.1	82%	0.818	52%	0.521	S	S	*	.			trans	-64.9	124	175.4	27.2	-32.9	0	0	0	109.9
20	G	83.6	Confident	78.9	Confident	44 Å²	44	97.2 Å²	97.2	45%	0.454	51%	0.512	S	S	.	.			trans	-133.5	166.3	176.6	0	0	0	0	0	112.3	Q18 H28	Q18-G20 PolarHBondContact O-N 2.7Å; G20-H28 CarbonylContact C-O 3.42Å; G20-H28 WeakPolarHBondContact CA-O 3.09Å
21	L	86.8	Confident	79.7	Confident	116 Å²	116	92.2 Å²	92.2	61%	0.607	49%	0.493	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-106	125.6	172.8	179.8	66.8	0	0	0	109.4	V23 H28	L21-V23 HydrophobicContact CD2-CG2 3.83Å; L21-V23 HydrophobicContact CG-CG2 3.86Å; L21-H28 PolarHBondContact N-O 3.06Å; L21-H28 PolarHBondContact O-N 2.88Å
22	L	85.1	Confident	80.6	Confident	114 Å²	114	86.3 Å²	86.3	60%	0.597	48%	0.481	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-85.3	123	171.5	-176.6	68.4	0	0	0	109.6	H26	L22-H26 WeakPolarHBondContact CA-O 3.49Å
23	V	87.1	Confident	81.2	Confident	79 Å²	79	85.6 Å²	85.6	48%	0.479	48%	0.479	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.3	112.3	174.9	-175.6	0	0	0	0	108.2	L21 D25 H26	L21-V23 HydrophobicContact CD2-CG2 3.83Å; L21-V23 HydrophobicContact CG-CG2 3.86Å; V23-D25 PolarHBondContact O-N 3.08Å; V23-H26 PolarHBondContact N-O 3.22Å; V23-H26 PolarHBondContact O-N 2.96Å
24	G	87.3	Confident	81.8	Confident	70 Å²	70	89 Å²	89	72%	0.722	49%	0.486	S	S	*	.	T	Hydrogen-bonded Turn	trans	60.4	-127.4	-170.8	0	0	0	0	0	110.7
25	D	86.5	Confident	82.2	Confident	93 Å²	93	94 Å²	94	50%	0.497	51%	0.509	S	S	.	.	T	Hydrogen-bonded Turn	trans	-97.6	16.8	175.4	65.9	-41.7	0	0	0	113.3	W9 V23	W9-D25 WeakPolarHBondContact CB-O 3.37Å; W9-D25 HydrophobicContact CG-CB 4.46Å; W9-D25 PolarHBondContact N-O 3.35Å; V23-D25 PolarHBondContact O-N 3.08Å
26	H	82.8	Confident	82.9	Confident	83 Å²	83	97.3 Å²	97.3	38%	0.384	53%	0.527	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.1	135.2	-179.2	-71.5	-100.8	0	0	0	112.5	A7 L22 V23	A7-H26 CarbonylContact O-C 3.59Å; A7-H26 WeakPolarHBondContact O-CA 3.48Å; L22-H26 WeakPolarHBondContact CA-O 3.49Å; V23-H26 PolarHBondContact N-O 3.22Å; V23-H26 PolarHBondContact O-N 2.96Å
27	L	86.3	Confident	83.7	Confident	54 Å²	54	99.8 Å²	99.8	28%	0.283	54%	0.536	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.5	129.2	170.7	-174.2	66.1	0	0	0	109.6	S6 A7 W29	S6-L27 WeakPolarHBondContact CA-O 3.22Å; A7-L27 PolarHBondContact N-O 3Å; A7-L27 PolarHBondContact O-N 3.37Å; L27-W29 HydrophobicContact CB-CZ3 4.14Å; L27-W29 HydrophobicContact CD2-CE3 4.07Å; L27-W29 HydrophobicContact CD2-CZ3 3.94Å; L27-W29 HydrophobicContact CG-CE3 3.93Å; L27-W29 HydrophobicContact CG-CZ3 3.96Å
28	H	85.1	Confident	84.1	Confident	47 Å²	47	96.9 Å²	96.9	22%	0.218	52%	0.521	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.2	128.6	-179.8	-62.7	-88	0	0	0	110.9	L4 V5 S6 G20 L21	L4-H28 HydrophobicContact CD1-CB 4.18Å; V5-H28 WeakPolarHBondContact O-CA 3.48Å; S6-H28 WeakPolarHBondContact CB-ND1 3.34Å; S6-H28 PolarHBondContact OG-CE1 2.87Å; S6-H28 VanDerWaalsContact OG-CE1 3.26Å; S6-H28 PolarHBondContact OG-ND1 3.03Å; G20-H28 CarbonylContact C-O 3.42Å; G20-H28 WeakPolarHBondContact CA-O 3.09Å; L21-H28 PolarHBondContact N-O 3.06Å; L21-H28 PolarHBondContact O-N 2.88Å
29	W	86	Confident	84.6	Confident	19 Å²	19	99.2 Å²	99.2	7%	0.072	54%	0.536	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.8	153.9	169.4	56.7	94.8	0	0	0	111.4	V5 A7 L15 L27	V5-W29 HydrophobicContact CB-CD2 4.22Å; V5-W29 HydrophobicContact CB-CG 4.4Å; V5-W29 HydrophobicContact CB-CZ2 3.87Å; V5-W29 HydrophobicContact CG1-CH2 4.11Å; V5-W29 HydrophobicContact CG1-CZ2 3.3Å; V5-W29 PolarHBondContact N-O 2.97Å; V5-W29 PolarHBondContact O-N 3.26Å; A7-W29 HydrophobicContact CB-CH2 3.61Å; A7-W29 HydrophobicContact CB-CZ3 4.1Å; L15-W29 HydrophobicContact CG-CH2 4.16Å; L15-W29 HydrophobicContact CG-CZ2 4.06Å; L15-W29 HydrophobicContact CD2-CZ2 3.58Å; L15-W29 HydrophobicContact CD2-CH2 4.17Å; L15-W29 HydrophobicContact CD1-CZ3 3.83Å; L15-W29 HydrophobicContact CD1-CZ2 3.32Å; L15-W29 HydrophobicContact CD1-CH2 3.1Å; L15-W29 HydrophobicContact CD2-CD2 4.42Å; L27-W29 HydrophobicContact CB-CZ3 4.14Å; L27-W29 HydrophobicContact CD2-CE3 4.07Å; L27-W29 HydrophobicContact CD2-CZ3 3.94Å; L27-W29 HydrophobicContact CG-CE3 3.93Å; L27-W29 HydrophobicContact CG-CZ3 3.96Å
30	V	85.9	Confident	85	Confident	91 Å²	91	97.5 Å²	97.5	55%	0.552	52%	0.518	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-102.5	113.3	177.1	-179.9	0	0	0	0	108.3	N2 L4	N2-V30 HydrophobicContact CB-CG1 3.73Å; L4-V30 HydrophobicContact CD1-CG2 4.39Å
31	W	84	Confident	85.1	Confident	121 Å²	121	101.1 Å²	101.1	46%	0.458	52%	0.522	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96	117.9	178.7	-167.3	-81.1	0	0	0	111.1	N2 V3 V5 Q18 V33	N2-W31 WeakPolarHBondContact CA-O 3.38Å; V3-W31 PolarHBondContact N-O 3.31Å; V3-W31 PolarHBondContact O-N 2.95Å; V5-W31 HydrophobicContact CG2-CB 4.39Å; Q18-W31 VanDerWaalsContact OE1-CE3 3.31Å; W31-V33 PolarHBondContact O-N 2.83Å
32	P	83.7	Confident	85	Confident	76 Å²	76	100 Å²	100	49%	0.494	52%	0.516	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.1	110.1	174.3	30.4	-32.1	0	0	0	110.7	N2	N2-P32 WeakPolarHBondContact OD1-CA 3.34Å
33	V	83.9	Confident	85	Confident	65 Å²	65	98.9 Å²	98.9	39%	0.394	51%	0.51	S	S	.	.			trans	-81.5	115.5	169.6	-176.1	0	0	0	0	108.6	M1 V3 W31	M1-V33 WeakPolarHBondContact O-CA 3.37Å; M1-V33 PolarHBondContact N-O 2.73Å; M1-V33 PolarHBondContact O-N 2.73Å; M1-V33 WeakPolarHBondContact O-CB 3.37Å; V3-V33 HydrophobicContact CB-CG2 4.46Å; V3-V33 HydrophobicContact CG2-CG2 3.62Å; W31-V33 PolarHBondContact O-N 2.83Å
34	R	83.8	Confident	84.8	Confident	226 Å²	226	100.6 Å²	100.6	85%	0.853	51%	0.512	S	S	*	.			trans	-87.4	129.1	167.3	-58.1	-176.9	-176.7	171.5	1.6	106.9
35	E	82.5	Confident	84.6	Confident	262 Å²	262	103.4 Å²	103.4	100%	1.224	49%	0.493	S	S	*	.			trans	-64.7	0	170.8	-72.3	-178.5	153.8	0	0	111.2

Retrieved 35 of 35 residues in 11.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).