C4QF92_SCHMA Loading...

Secreted protein

AlphaFold DB , UniProt , Accession C4QF92, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 74 aa.

						>C4QF92_SCHMA|C4QF92
MVDVVDLSFLLMSNCEVIVCGLMVLDQEARGRERLSSLWFISDWQCGHMMWSSEAILSVMRHDDTGVCCVVLAE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	35.4	Very low	40.2	Very low	160 Å²	160	76.7 Å²	76.7	79%	0.788	42%	0.423	S	S	*	.				0	127.6	0	-168.6	170.2	81.5	0	0	105.6	D3 Q27	M1-D3 WeakPolarHBondContact CE-OD1 3.28Å; M1-Q27 VanDerWaalsContact O-CD 3.27Å; M1-Q27 WeakPolarHBondContact O-CG 3.49Å; M1-Q27 PolarHBondContact O-OE1 3.28Å
2	V	32.8	Very low	39.6	Very low	91 Å²	91	84.5 Å²	84.5	55%	0.552	46%	0.458	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-92.4	111.3	177.7	173.8	0	0	0	0	107	V4 V24	V2-V4 HydrophobicContact CG1-CG2 4.2Å; V2-V4 PolarHBondContact O-N 3.45Å; V2-V24 HydrophobicContact CG1-CB 4.49Å; V2-V24 HydrophobicContact CG1-CG1 3.75Å
3	D	34.7	Very low	39.3	Very low	60 Å²	60	85.2 Å²	85.2	32%	0.321	47%	0.473	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.8	114.4	170.3	-65.6	-46.1	0	0	0	107.3	M1 L25 Q27	M1-D3 WeakPolarHBondContact CE-OD1 3.28Å; D3-L25 HydrophobicContact CB-CB 4.23Å; D3-L25 HydrophobicContact CB-CD1 3.97Å; D3-L25 PolarHBondContact O-N 2.93Å; D3-Q27 PolarHBondContact OD2-NE2 3.34Å
4	V	36.1	Very low	39.3	Very low	90 Å²	90	91.6 Å²	91.6	55%	0.545	51%	0.506	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.1	108.9	174	178	0	0	0	0	106.9	V2 L22	V2-V4 HydrophobicContact CG1-CG2 4.2Å; V2-V4 PolarHBondContact O-N 3.45Å; V4-L22 HydrophobicContact CG1-CD1 3.72Å; V4-L22 HydrophobicContact CG1-CD2 4.2Å; V4-L22 HydrophobicContact CG1-CG 3.78Å
5	V	41.4	Very low	39.4	Very low	36 Å²	36	89.3 Å²	89.3	22%	0.218	50%	0.498	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.8	111.1	170.5	-169.9	0	0	0	0	107.4	L7 M23 L25	V5-L7 HydrophobicContact CB-CD2 4.35Å; V5-L7 HydrophobicContact CG1-CD2 3.61Å; V5-L7 HydrophobicContact CG1-CG 4.19Å; V5-L7 PolarHBondContact O-N 2.85Å; V5-M23 HydrophobicContact CB-CB 4.28Å; V5-M23 PolarHBondContact N-O 3.47Å; V5-M23 PolarHBondContact O-N 2.84Å; V5-L25 HydrophobicContact CG2-CD1 3.91Å; V5-L25 HydrophobicContact CG2-CG 4.45Å
6	D	42.8	Very low	39.9	Very low	117 Å²	117	93.4 Å²	93.4	63%	0.626	51%	0.512	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-70.5	109.8	166.3	-172.7	-15.7	0	0	0	107.6	S8	D6-S8 PolarHBondContact OD1-OG 2.97Å
7	L	45.2	Very low	40.1	Very low	5 Å²	5	89.7 Å²	89.7	3%	0.026	49%	0.493	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.6	94.2	178	-57.4	170	0	0	0	107.6	V5 F9 C20 G21 M23 L35 V59 C68	V5-L7 HydrophobicContact CB-CD2 4.35Å; V5-L7 HydrophobicContact CG1-CD2 3.61Å; V5-L7 HydrophobicContact CG1-CG 4.19Å; V5-L7 PolarHBondContact O-N 2.85Å; L7-F9 HydrophobicContact CB-CD2 4.09Å; L7-F9 HydrophobicContact CB-CE2 3.23Å; L7-F9 HydrophobicContact CB-CZ 3.66Å; L7-F9 HydrophobicContact CD1-CE2 4.26Å; L7-F9 HydrophobicContact CD1-CZ 4Å; L7-F9 HydrophobicContact CG-CE2 4.33Å; L7-F9 HydrophobicContact CG-CZ 4.35Å; L7-F9 WeakPolarHBondContact O-CD2 3.41Å; L7-F9 VanDerWaalsContact O-CE2 3.27Å; L7-F9 WeakPolarHBondContact O-CE2 3.38Å; L7-C20 CarbonylContact O-C 3.48Å; L7-C20 WeakPolarHBondContact O-CA 3.48Å; L7-G21 PolarHBondContact N-O 2.77Å; L7-G21 PolarHBondContact O-N 2.79Å; L7-M23 HydrophobicContact CD1-CB 3.8Å; L7-M23 HydrophobicContact CD1-SD 4.06Å; L7-M23 HydrophobicContact CG-CB 4.4Å; L7-L35 HydrophobicContact CD1-CD1 3.86Å; L7-V59 HydrophobicContact CD1-CG1 4.43Å; L7-C68 HydrophobicContact CB-CB 4.4Å; L7-C68 HydrophobicContact CD2-CB 3.9Å; L7-C68 WeakPolarHBondContact CD2-SG 3.15Å
8	S	44.1	Very low	40.7	Very low	57 Å²	57	88.9 Å²	88.9	40%	0.399	49%	0.487	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.2	116.6	170.8	-69.7	0	0	0	0	109.3	D6 V19	D6-S8 PolarHBondContact OD1-OG 2.97Å; S8-V19 CarbonylContact C-O 3.5Å; S8-V19 WeakPolarHBondContact CA-O 3.47Å
9	F	49.8	Very low	41.2	Very low	13 Å²	13	85.2 Å²	85.2	6%	0.057	47%	0.467	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113	134.5	178.3	-40.7	-130	0	0	0	108.5	L7 I18 V19 L38 V67 C68 C69 V70	L7-F9 HydrophobicContact CB-CD2 4.09Å; L7-F9 HydrophobicContact CB-CE2 3.23Å; L7-F9 HydrophobicContact CB-CZ 3.66Å; L7-F9 HydrophobicContact CD1-CE2 4.26Å; L7-F9 HydrophobicContact CD1-CZ 4Å; L7-F9 HydrophobicContact CG-CE2 4.33Å; L7-F9 HydrophobicContact CG-CZ 4.35Å; L7-F9 WeakPolarHBondContact O-CD2 3.41Å; L7-F9 VanDerWaalsContact O-CE2 3.27Å; L7-F9 WeakPolarHBondContact O-CE2 3.38Å; F9-I18 WeakPolarHBondContact O-CA 3.45Å; F9-V19 HydrophobicContact CB-CB 4.01Å; F9-V19 HydrophobicContact CD2-CB 3.92Å; F9-V19 HydrophobicContact CD2-CG1 3.97Å; F9-V19 WeakPolarHBondContact CD2-O 3.25Å; F9-V19 HydrophobicContact CE2-CG1 4.36Å; F9-V19 HydrophobicContact CG-CB 4.2Å; F9-V19 PolarHBondContact N-O 3.18Å; F9-V19 PolarHBondContact O-N 3.14Å; F9-L38 HydrophobicContact CE2-CD2 4.02Å; F9-L38 HydrophobicContact CZ-CD2 4.32Å; F9-V67 HydrophobicContact CB-CG1 4.48Å; F9-C68 HydrophobicContact CD1-CB 3.64Å; F9-C68 WeakPolarHBondContact CD1-O 3.36Å; F9-C68 HydrophobicContact CD2-CB 4.47Å; F9-C68 VanDerWaalsContact CE1-CA 3.41Å; F9-C68 HydrophobicContact CE1-CB 3.03Å; F9-C68 WeakPolarHBondContact CE1-O 3.36Å; F9-C68 HydrophobicContact CE2-CB 4.08Å; F9-C68 HydrophobicContact CG-CB 4.25Å; F9-C68 HydrophobicContact CZ-CB 3.28Å; F9-C69 VanDerWaalsContact CE1-N 3.29Å; F9-V70 HydrophobicContact CE1-CG2 3.53Å; F9-V70 HydrophobicContact CZ-CG2 3.57Å
10	L	38.6	Very low	41.7	Very low	105 Å²	105	82.7 Å²	82.7	55%	0.55	46%	0.455	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106	98.2	172.7	-135.7	139.4	0	0	0	107.4	M12	L10-M12 HydrophobicContact CD2-CG 3.81Å; L10-M12 PolarHBondContact O-N 3.38Å
11	L	41.5	Very low	42.2	Very low	110 Å²	110	78.9 Å²	78.9	58%	0.576	44%	0.436	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-81.1	96.6	174.3	-87.2	162.6	0	0	0	108.1	S13 V17 V19	L11-S13 PolarHBondContact O-N 2.92Å; L11-V17 HydrophobicContact CB-CB 4.49Å; L11-V17 PolarHBondContact N-O 3.14Å; L11-V17 VanDerWaalsContact N-O 3.12Å; L11-V19 HydrophobicContact CD1-CG2 3.74Å
12	M	32.4	Very low	42.8	Very low	170 Å²	170	74.7 Å²	74.7	84%	0.837	42%	0.416	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-80.4	91.9	173.4	-66.2	-160.9	-56.3	0	0	110.4	L10	L10-M12 HydrophobicContact CD2-CG 3.81Å; L10-M12 PolarHBondContact O-N 3.38Å
13	S	35.5	Very low	43.7	Very low	93 Å²	93	71 Å²	71	65%	0.65	39%	0.393	S	S	*	.	S	Bend	trans	-144.5	88	159.1	171.2	0	0	0	0	109.4	L11 C15	L11-S13 PolarHBondContact O-N 2.92Å; S13-C15 PolarHBondContact O-N 3.28Å
14	N	40.4	Very low	44.3	Very low	176 Å²	176	70.2 Å²	70.2	94%	0.941	39%	0.39	S	S	*	.	S	Bend	trans	52.7	-6.6	173.3	-61.3	-16	0	0	0	118.3
15	C	40	Very low	44.8	Very low	56 Å²	56	67.7 Å²	67.7	38%	0.378	37%	0.373	S	S	.	.	S	Bend	trans	-125.7	129.2	169.6	-66.2	0	0	0	0	105.9	S13 V17	S13-C15 PolarHBondContact O-N 3.28Å; C15-V17 VanDerWaalsContact C-N 3.25Å; C15-V17 HydrophobicContact CB-CG2 3.99Å; C15-V17 PolarHBondContact O-N 3.41Å
16	E	47.1	Very low	45.2	Very low	156 Å²	156	69.6 Å²	69.6	73%	0.729	38%	0.382	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-75.2	85.8	176	-71.5	-175.7	166.8	0	0	107.7	D43	E16-D43 PolarHBondContact N-OD1 2.88Å; E16-D43 PolarHBondContact O-N 3.3Å
17	V	44.7	Very low	45.5	Very low	30 Å²	30	68.8 Å²	68.8	18%	0.182	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.7	106.9	174.4	-172	0	0	0	0	108.7	L11 C15 V19 F40	L11-V17 HydrophobicContact CB-CB 4.49Å; L11-V17 PolarHBondContact N-O 3.14Å; L11-V17 VanDerWaalsContact N-O 3.12Å; C15-V17 VanDerWaalsContact C-N 3.25Å; C15-V17 HydrophobicContact CB-CG2 3.99Å; C15-V17 PolarHBondContact O-N 3.41Å; V17-V19 HydrophobicContact CG1-CG2 4.14Å; V17-F40 HydrophobicContact CG1-CB 4.12Å; V17-F40 HydrophobicContact CG1-CD2 4.21Å; V17-F40 HydrophobicContact CG1-CG 4.5Å
18	I	49.7	Very low	45.8	Very low	75 Å²	75	77.1 Å²	77.1	39%	0.385	41%	0.413	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.3	109.2	169.5	-56.1	176.1	0	0	0	107.1	F9 F40 I41	F9-I18 WeakPolarHBondContact O-CA 3.45Å; I18-F40 CarbonylContact O-C 3.55Å; I18-F40 WeakPolarHBondContact O-CA 3.21Å; I18-I41 HydrophobicContact CB-CB 4.49Å; I18-I41 PolarHBondContact N-O 3.29Å; I18-I41 PolarHBondContact O-N 3.26Å
19	V	50.9	Low	46.1	Very low	19 Å²	19	75.9 Å²	75.9	12%	0.115	41%	0.407	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.9	127.7	171	-174.3	0	0	0	0	107.6	S8 F9 L11 V17 L38 W39 F40	S8-V19 CarbonylContact C-O 3.5Å; S8-V19 WeakPolarHBondContact CA-O 3.47Å; F9-V19 HydrophobicContact CB-CB 4.01Å; F9-V19 HydrophobicContact CD2-CB 3.92Å; F9-V19 HydrophobicContact CD2-CG1 3.97Å; F9-V19 WeakPolarHBondContact CD2-O 3.25Å; F9-V19 HydrophobicContact CE2-CG1 4.36Å; F9-V19 HydrophobicContact CG-CB 4.2Å; F9-V19 PolarHBondContact N-O 3.18Å; F9-V19 PolarHBondContact O-N 3.14Å; L11-V19 HydrophobicContact CD1-CG2 3.74Å; V17-V19 HydrophobicContact CG1-CG2 4.14Å; V19-L38 HydrophobicContact CG1-CD2 4.14Å; V19-W39 CarbonylContact C-O 3.38Å; V19-W39 WeakPolarHBondContact CA-O 3.33Å; V19-W39 VanDerWaalsContact CG1-O 3.29Å; V19-W39 WeakPolarHBondContact CG1-O 3.39Å; V19-F40 HydrophobicContact CB-CB 4.18Å; V19-F40 HydrophobicContact CG1-CB 4.25Å; V19-F40 HydrophobicContact CG2-CB 3.89Å
20	C	51	Low	46.4	Very low	34 Å²	34	87 Å²	87	23%	0.23	45%	0.448	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116	106.3	173.3	-64.3	0	0	0	0	109	L7 W39	L7-C20 CarbonylContact O-C 3.48Å; L7-C20 WeakPolarHBondContact O-CA 3.48Å; C20-W39 CarbonylContact C-O 3.48Å; C20-W39 PolarHBondContact N-O 2.97Å; C20-W39 CarbonylContact O-C 3.49Å; C20-W39 VanDerWaalsContact O-CA 3.29Å; C20-W39 WeakPolarHBondContact O-CA 3.45Å; C20-W39 WeakPolarHBondContact O-CB 3.35Å; C20-W39 PolarHBondContact O-N 2.89Å
21	G	52.4	Low	47	Very low	4 Å²	4	85.4 Å²	85.4	4%	0.041	46%	0.457	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.5	146.3	176.9	0	0	0	0	0	113.1	L7	L7-G21 PolarHBondContact N-O 2.77Å; L7-G21 PolarHBondContact O-N 2.79Å
22	L	48.7	Very low	47.4	Very low	72 Å²	72	89.6 Å²	89.6	38%	0.377	47%	0.465	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.7	107.6	168.7	-160.9	139.4	0	0	0	108.9	V4 V24 S36 S37	V4-L22 HydrophobicContact CG1-CD1 3.72Å; V4-L22 HydrophobicContact CG1-CD2 4.2Å; V4-L22 HydrophobicContact CG1-CG 3.78Å; L22-V24 HydrophobicContact CD2-CG2 3.65Å; L22-S36 PolarHBondContact O-OG 2.69Å; L22-S37 PolarHBondContact N-O 2.77Å
23	M	51.1	Low	48.4	Very low	13 Å²	13	87.7 Å²	87.7	6%	0.064	45%	0.454	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.3	120.2	175.5	-167.2	160.6	173.4	0	0	109.3	V5 L7 L25 E33 L35	V5-M23 HydrophobicContact CB-CB 4.28Å; V5-M23 PolarHBondContact N-O 3.47Å; V5-M23 PolarHBondContact O-N 2.84Å; L7-M23 HydrophobicContact CD1-CB 3.8Å; L7-M23 HydrophobicContact CD1-SD 4.06Å; L7-M23 HydrophobicContact CG-CB 4.4Å; M23-L25 HydrophobicContact CE-CD2 4.09Å; M23-L25 HydrophobicContact CG-CD2 4.49Å; M23-E33 HydrophobicContact CE-CB 3.33Å; M23-E33 HydrophobicContact CE-CG 4.06Å; M23-E33 WeakPolarHBondContact CE-OE2 3.48Å; M23-L35 HydrophobicContact CB-CD1 3.62Å; M23-L35 HydrophobicContact CG-CD1 3.93Å; M23-L35 HydrophobicContact SD-CD1 4.35Å
24	V	47	Very low	49.1	Very low	44 Å²	44	90.8 Å²	90.8	27%	0.267	45%	0.452	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.8	106.3	174.5	174.3	0	0	0	0	107	V2 L22 D26 S36	V2-V24 HydrophobicContact CG1-CB 4.49Å; V2-V24 HydrophobicContact CG1-CG1 3.75Å; L22-V24 HydrophobicContact CD2-CG2 3.65Å; V24-D26 PolarHBondContact O-N 3.36Å; V24-S36 WeakPolarHBondContact CG2-OG 3.07Å
25	L	47	Very low	49.7	Very low	37 Å²	37	82.9 Å²	82.9	19%	0.194	41%	0.409	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.1	100.3	169.9	-65.9	174.7	0	0	0	108.2	D3 V5 M23 Q27 E33	D3-L25 HydrophobicContact CB-CB 4.23Å; D3-L25 HydrophobicContact CB-CD1 3.97Å; D3-L25 PolarHBondContact O-N 2.93Å; V5-L25 HydrophobicContact CG2-CD1 3.91Å; V5-L25 HydrophobicContact CG2-CG 4.45Å; M23-L25 HydrophobicContact CE-CD2 4.09Å; M23-L25 HydrophobicContact CG-CD2 4.49Å; L25-Q27 PolarHBondContact O-N 3.29Å; L25-Q27 VanDerWaalsContact O-N 3.14Å; L25-E33 HydrophobicContact CD2-CB 3.64Å; L25-E33 HydrophobicContact CD2-CG 3.51Å
26	D	49.1	Very low	50.4	Low	75 Å²	75	83 Å²	83	40%	0.401	41%	0.411	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.1	96.6	171.3	-173.7	-6.3	0	0	0	109.2	V24 E28 A29	V24-D26 PolarHBondContact O-N 3.36Å; D26-E28 PolarHBondContact O-N 3.2Å; D26-E28 WeakPolarHBondContact OD1-CB 3.33Å; D26-E28 PolarHBondContact OD1-N 3.32Å; D26-A29 HydrophobicContact CB-CB 3.9Å; D26-A29 WeakPolarHBondContact O-CB 3.33Å; D26-A29 PolarHBondContact O-N 3.14Å; D26-A29 VanDerWaalsContact O-N 3.14Å; D26-A29 PolarHBondContact OD1-N 3.26Å
27	Q	48.4	Very low	50.6	Low	101 Å²	101	77.5 Å²	77.5	47%	0.472	39%	0.39	S	S	.	.	T	Hydrogen-bonded Turn	trans	-62.4	-25.2	177	-69.2	-175.5	-8.9	0	0	112.7	M1 D3 L25 A29	M1-Q27 VanDerWaalsContact O-CD 3.27Å; M1-Q27 WeakPolarHBondContact O-CG 3.49Å; M1-Q27 PolarHBondContact O-OE1 3.28Å; D3-Q27 PolarHBondContact OD2-NE2 3.34Å; L25-Q27 PolarHBondContact O-N 3.29Å; L25-Q27 VanDerWaalsContact O-N 3.14Å; Q27-A29 VanDerWaalsContact C-N 3.29Å
28	E	51.9	Low	50.9	Low	179 Å²	179	76.4 Å²	76.4	84%	0.836	38%	0.383	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73.6	-26.8	177.2	-62.5	-165.5	160.4	0	0	111.6	D26 R30	D26-E28 PolarHBondContact O-N 3.2Å; D26-E28 WeakPolarHBondContact OD1-CB 3.33Å; D26-E28 PolarHBondContact OD1-N 3.32Å; E28-R30 PolarHBondContact O-N 3.4Å
29	A	51.2	Low	50.9	Low	32 Å²	32	78.9 Å²	78.9	26%	0.264	39%	0.388	S	S	.	.	S	Bend	trans	-75.1	39.9	177.8	0	0	0	0	0	113.4	D26 Q27 G31 R32	D26-A29 HydrophobicContact CB-CB 3.9Å; D26-A29 WeakPolarHBondContact O-CB 3.33Å; D26-A29 PolarHBondContact O-N 3.14Å; D26-A29 VanDerWaalsContact O-N 3.14Å; D26-A29 PolarHBondContact OD1-N 3.26Å; Q27-A29 VanDerWaalsContact C-N 3.29Å; A29-G31 PolarHBondContact O-N 3.35Å; A29-R32 HydrophobicContact CB-CB 4.19Å; A29-R32 VanDerWaalsContact O-CB 3.28Å; A29-R32 WeakPolarHBondContact O-CB 2.77Å; A29-R32 PolarHBondContact O-N 2.86Å
30	R	54.7	Low	50.9	Low	246 Å²	246	80.3 Å²	80.3	93%	0.928	39%	0.392	S	S	*	.	T	Hydrogen-bonded Turn	trans	46.3	39.2	169	-61.4	-175.1	175.8	-176.6	-1.3	114.8	E28	E28-R30 PolarHBondContact O-N 3.4Å
31	G	51.3	Low	50.7	Low	71 Å²	71	82 Å²	82	73%	0.732	40%	0.398	S	S	*	.	T	Hydrogen-bonded Turn	trans	77.6	18.9	-178.4	0	0	0	0	0	114.8	A29	A29-G31 PolarHBondContact O-N 3.35Å
32	R	50.7	Low	50.4	Low	199 Å²	199	83.3 Å²	83.3	75%	0.751	41%	0.407	S	S	*	.			trans	-88.1	109.8	168.2	-69.4	-173.1	178	-175	-1.1	109.2	A29	A29-R32 HydrophobicContact CB-CB 4.19Å; A29-R32 VanDerWaalsContact O-CB 3.28Å; A29-R32 WeakPolarHBondContact O-CB 2.77Å; A29-R32 PolarHBondContact O-N 2.86Å
33	E	53	Low	50.5	Low	129 Å²	129	84 Å²	84	60%	0.603	41%	0.411	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-74.2	131.7	171.8	-44.8	-173.9	142.6	0	0	109.2	M23 L25	M23-E33 HydrophobicContact CE-CB 3.33Å; M23-E33 HydrophobicContact CE-CG 4.06Å; M23-E33 WeakPolarHBondContact CE-OE2 3.48Å; L25-E33 HydrophobicContact CD2-CB 3.64Å; L25-E33 HydrophobicContact CD2-CG 3.51Å
34	R	51.3	Low	50.3	Low	158 Å²	158	95.5 Å²	95.5	60%	0.596	45%	0.454	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-124.6	108.3	177.1	-165.1	174.9	-176.3	168.4	1.2	109.8	S36 S53	R34-S36 PolarHBondContact O-N 3.41Å; R34-S53 PolarHBondContact NE-OG 2.8Å; R34-S53 PolarHBondContact NH2-OG 3.26Å
35	L	53	Low	50.1	Low	10 Å²	10	100.7 Å²	100.7	5%	0.052	48%	0.475	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.7	113.6	169.5	-169.1	62.8	0	0	0	108.3	L7 M23 L38 S53 I56 V59 V70	L7-L35 HydrophobicContact CD1-CD1 3.86Å; M23-L35 HydrophobicContact CB-CD1 3.62Å; M23-L35 HydrophobicContact CG-CD1 3.93Å; M23-L35 HydrophobicContact SD-CD1 4.35Å; L35-L38 HydrophobicContact CD2-CD1 3.46Å; L35-L38 VanDerWaalsContact CD2-CD1 3.46Å; L35-L38 HydrophobicContact CD2-CD2 4.01Å; L35-L38 HydrophobicContact CD2-CG 3.63Å; L35-L38 HydrophobicContact CG-CD1 4.46Å; L35-L38 HydrophobicContact CG-CG 4.25Å; L35-S53 WeakPolarHBondContact O-CB 3.46Å; L35-I56 HydrophobicContact CB-CD1 3.91Å; L35-I56 HydrophobicContact CD2-CD1 3.43Å; L35-I56 VanDerWaalsContact CD2-CD1 3.43Å; L35-I56 HydrophobicContact CD2-CG1 4.45Å; L35-I56 HydrophobicContact CG-CD1 4Å; L35-V59 HydrophobicContact CD2-CG2 4.21Å; L35-V70 HydrophobicContact CD2-CG2 4.46Å
36	S	53.7	Low	50.2	Low	60 Å²	60	104 Å²	104	42%	0.42	50%	0.5	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.8	-32	-175.9	46.8	0	0	0	0	112.7	L22 V24 R34	L22-S36 PolarHBondContact O-OG 2.69Å; V24-S36 WeakPolarHBondContact CG2-OG 3.07Å; R34-S36 PolarHBondContact O-N 3.41Å
37	S	51.3	Low	50.1	Low	39 Å²	39	101.4 Å²	101.4	27%	0.273	49%	0.491	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-156.9	141	-176.4	-52.5	0	0	0	0	112	L22	L22-S37 PolarHBondContact N-O 2.77Å
38	L	51.9	Low	50.1	Low	7 Å²	7	100.3 Å²	100.3	4%	0.037	49%	0.486	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.6	131.1	171.1	-78.8	159.9	0	0	0	108.5	F9 V19 L35 W51 I56 V70	F9-L38 HydrophobicContact CE2-CD2 4.02Å; F9-L38 HydrophobicContact CZ-CD2 4.32Å; V19-L38 HydrophobicContact CG1-CD2 4.14Å; L35-L38 HydrophobicContact CD2-CD1 3.46Å; L35-L38 VanDerWaalsContact CD2-CD1 3.46Å; L35-L38 HydrophobicContact CD2-CD2 4.01Å; L35-L38 HydrophobicContact CD2-CG 3.63Å; L35-L38 HydrophobicContact CG-CD1 4.46Å; L35-L38 HydrophobicContact CG-CG 4.25Å; L38-W51 HydrophobicContact CD1-CE3 3.45Å; L38-W51 VanDerWaalsContact CD1-CE3 3.45Å; L38-W51 HydrophobicContact CD1-CZ3 3.7Å; L38-I56 HydrophobicContact CD1-CD1 4.4Å; L38-V70 HydrophobicContact CD1-CG1 4.44Å; L38-V70 HydrophobicContact CD1-CG2 4.28Å; L38-V70 HydrophobicContact CD2-CG2 4.42Å
39	W	49.6	Very low	49.8	Very low	128 Å²	128	96.3 Å²	96.3	49%	0.485	47%	0.468	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.2	152.8	173.2	-51.9	81.6	0	0	0	108.3	V19 C20 H48	V19-W39 CarbonylContact C-O 3.38Å; V19-W39 WeakPolarHBondContact CA-O 3.33Å; V19-W39 VanDerWaalsContact CG1-O 3.29Å; V19-W39 WeakPolarHBondContact CG1-O 3.39Å; C20-W39 CarbonylContact C-O 3.48Å; C20-W39 PolarHBondContact N-O 2.97Å; C20-W39 CarbonylContact O-C 3.49Å; C20-W39 VanDerWaalsContact O-CA 3.29Å; C20-W39 WeakPolarHBondContact O-CA 3.45Å; C20-W39 WeakPolarHBondContact O-CB 3.35Å; C20-W39 PolarHBondContact O-N 2.89Å; W39-H48 AromaticContact CD2-CD2 3.34Å; W39-H48 AromaticContact CD2-NE2 3.77Å; W39-H48 AromaticContact CE2-CD2 3.75Å; W39-H48 AromaticContact CE2-NE2 3.64Å; W39-H48 HydrophobicContact CE3-CB 3.87Å; W39-H48 AromaticContact CE3-CD2 3.05Å; W39-H48 AromaticContact CE3-CG 3.58Å; W39-H48 AromaticContact CE3-NE2 3.76Å; W39-H48 AromaticContact CH2-CD2 3.6Å; W39-H48 AromaticContact CH2-CE1 3.71Å; W39-H48 AromaticContact CH2-CG 3.96Å; W39-H48 AromaticContact CH2-NE2 3.45Å; W39-H48 WeakPolarHBondContact CH2-NE2 3.32Å; W39-H48 AromaticContact CZ2-CD2 3.88Å; W39-H48 AromaticContact CZ2-NE2 3.49Å; W39-H48 WeakPolarHBondContact CZ2-NE2 3.27Å; W39-H48 HydrophobicContact CZ3-CB 3.8Å; W39-H48 AromaticContact CZ3-CD2 3.19Å; W39-H48 WeakPolarHBondContact CZ3-CD2 3.47Å; W39-H48 AromaticContact CZ3-CE1 3.94Å; W39-H48 AromaticContact CZ3-CG 3.38Å; W39-H48 AromaticContact CZ3-ND1 3.88Å; W39-H48 AromaticContact CZ3-NE2 3.6Å
40	F	51.7	Low	49.6	Very low	49 Å²	49	101.6 Å²	101.6	22%	0.215	49%	0.489	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.6	151.2	167.8	59.6	-85.4	0	0	0	111.6	V17 I18 V19 G47 M49	V17-F40 HydrophobicContact CG1-CB 4.12Å; V17-F40 HydrophobicContact CG1-CD2 4.21Å; V17-F40 HydrophobicContact CG1-CG 4.5Å; I18-F40 CarbonylContact O-C 3.55Å; I18-F40 WeakPolarHBondContact O-CA 3.21Å; V19-F40 HydrophobicContact CB-CB 4.18Å; V19-F40 HydrophobicContact CG1-CB 4.25Å; V19-F40 HydrophobicContact CG2-CB 3.89Å; F40-G47 WeakPolarHBondContact CD1-O 3.43Å; F40-G47 WeakPolarHBondContact CE1-O 3.5Å; F40-G47 PolarHBondContact N-O 3Å; F40-G47 VanDerWaalsContact N-O 3.16Å; F40-G47 PolarHBondContact O-N 3.12Å; F40-M49 HydrophobicContact CD1-CB 4.48Å; F40-M49 HydrophobicContact CE1-CB 3.46Å; F40-M49 VanDerWaalsContact CE1-CB 3.46Å; F40-M49 HydrophobicContact CZ-CB 4.13Å; F40-M49 HydrophobicContact CZ-CE 4.28Å
41	I	45.4	Very low	49.5	Very low	69 Å²	69	94.5 Å²	94.5	35%	0.354	46%	0.463	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.6	107.7	179.3	-54	177.8	0	0	0	104.9	I18	I18-I41 HydrophobicContact CB-CB 4.49Å; I18-I41 PolarHBondContact N-O 3.29Å; I18-I41 PolarHBondContact O-N 3.26Å
42	S	46.1	Very low	49.6	Very low	31 Å²	31	94.1 Å²	94.1	22%	0.217	45%	0.449	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.3	121.8	179.6	164.2	0	0	0	0	107.9	W44 Q45	S42-W44 VanDerWaalsContact C-N 3.28Å; S42-W44 PolarHBondContact O-N 2.78Å; S42-W44 VanDerWaalsContact O-N 3.12Å; S42-Q45 PolarHBondContact N-O 3.45Å; S42-Q45 WeakPolarHBondContact O-CA 3.5Å; S42-Q45 WeakPolarHBondContact O-CB 3.41Å; S42-Q45 PolarHBondContact O-N 3.48Å; S42-Q45 VanDerWaalsContact O-O 3.1Å
43	D	50.3	Low	49.9	Very low	87 Å²	87	86.3 Å²	86.3	47%	0.465	43%	0.425	S	S	.	.	T	Hydrogen-bonded Turn	trans	44.5	50.9	171.7	-64.1	-22.5	0	0	0	113.4	E16 Q45	E16-D43 PolarHBondContact N-OD1 2.88Å; E16-D43 PolarHBondContact O-N 3.3Å; D43-Q45 PolarHBondContact O-N 3.26Å; D43-Q45 VanDerWaalsContact O-N 3.09Å
44	W	47.7	Very low	50.3	Low	255 Å²	255	88 Å²	88	97%	0.966	43%	0.432	S	S	*	.	T	Hydrogen-bonded Turn	trans	65	3.2	-178	-52.7	86.1	0	0	0	116.3	S42	S42-W44 VanDerWaalsContact C-N 3.28Å; S42-W44 PolarHBondContact O-N 2.78Å; S42-W44 VanDerWaalsContact O-N 3.12Å
45	Q	43.6	Very low	50.7	Low	153 Å²	153	81.9 Å²	81.9	72%	0.715	42%	0.416	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-97.9	112.1	169.4	-60.2	-173.3	9.3	0	0	109.1	S42 D43 G47	S42-Q45 PolarHBondContact N-O 3.45Å; S42-Q45 WeakPolarHBondContact O-CA 3.5Å; S42-Q45 WeakPolarHBondContact O-CB 3.41Å; S42-Q45 PolarHBondContact O-N 3.48Å; S42-Q45 VanDerWaalsContact O-O 3.1Å; D43-Q45 PolarHBondContact O-N 3.26Å; D43-Q45 VanDerWaalsContact O-N 3.09Å; Q45-G47 PolarHBondContact O-N 3.22Å
46	C	49.3	Very low	51	Low	105 Å²	105	82.8 Å²	82.8	71%	0.709	42%	0.42	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-74.2	106.8	169.5	-60.9	0	0	0	0	108.3
47	G	45.9	Very low	51	Low	22 Å²	22	85.6 Å²	85.6	23%	0.227	43%	0.43	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.1	127.6	170.9	0	0	0	0	0	109.4	F40 Q45	F40-G47 WeakPolarHBondContact CD1-O 3.43Å; F40-G47 WeakPolarHBondContact CE1-O 3.5Å; F40-G47 PolarHBondContact N-O 3Å; F40-G47 VanDerWaalsContact N-O 3.16Å; F40-G47 PolarHBondContact O-N 3.12Å; Q45-G47 PolarHBondContact O-N 3.22Å
48	H	48.1	Very low	51.4	Low	77 Å²	77	86 Å²	86	36%	0.356	43%	0.433	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.9	112	167.3	-175	-128.4	0	0	0	108	W39 M50	W39-H48 AromaticContact CD2-CD2 3.34Å; W39-H48 AromaticContact CD2-NE2 3.77Å; W39-H48 AromaticContact CE2-CD2 3.75Å; W39-H48 AromaticContact CE2-NE2 3.64Å; W39-H48 HydrophobicContact CE3-CB 3.87Å; W39-H48 AromaticContact CE3-CD2 3.05Å; W39-H48 AromaticContact CE3-CG 3.58Å; W39-H48 AromaticContact CE3-NE2 3.76Å; W39-H48 AromaticContact CH2-CD2 3.6Å; W39-H48 AromaticContact CH2-CE1 3.71Å; W39-H48 AromaticContact CH2-CG 3.96Å; W39-H48 AromaticContact CH2-NE2 3.45Å; W39-H48 WeakPolarHBondContact CH2-NE2 3.32Å; W39-H48 AromaticContact CZ2-CD2 3.88Å; W39-H48 AromaticContact CZ2-NE2 3.49Å; W39-H48 WeakPolarHBondContact CZ2-NE2 3.27Å; W39-H48 HydrophobicContact CZ3-CB 3.8Å; W39-H48 AromaticContact CZ3-CD2 3.19Å; W39-H48 WeakPolarHBondContact CZ3-CD2 3.47Å; W39-H48 AromaticContact CZ3-CE1 3.94Å; W39-H48 AromaticContact CZ3-CG 3.38Å; W39-H48 AromaticContact CZ3-ND1 3.88Å; W39-H48 AromaticContact CZ3-NE2 3.6Å; H48-M50 WeakPolarHBondContact CE1-CG 3.11Å
49	M	46.7	Very low	51.7	Low	96 Å²	96	87.5 Å²	87.5	47%	0.473	44%	0.443	S	S	.	.			trans	-111.8	109.1	167.4	-165.2	176.8	-62.1	0	0	106.9	F40 W51	F40-M49 HydrophobicContact CD1-CB 4.48Å; F40-M49 HydrophobicContact CE1-CB 3.46Å; F40-M49 VanDerWaalsContact CE1-CB 3.46Å; F40-M49 HydrophobicContact CZ-CB 4.13Å; F40-M49 HydrophobicContact CZ-CE 4.28Å; M49-W51 PolarHBondContact O-N 2.74Å; M49-W51 HydrophobicContact SD-CZ2 4.12Å; M49-W51 PolarHBondContact SD-NE1 2.9Å
50	M	47.2	Very low	51.9	Low	143 Å²	143	86.6 Å²	86.6	70%	0.704	45%	0.445	S	S	*	.	P	Polyproline II helix	trans	-74.3	116.7	168.8	-72.4	-177.5	-79.7	0	0	107.9	H48	H48-M50 WeakPolarHBondContact CE1-CG 3.11Å
51	W	52.5	Low	52.1	Low	96 Å²	96	91.6 Å²	91.6	36%	0.364	46%	0.462	S	S	.	.	P	Polyproline II helix	trans	-93	140	161.4	-64.5	-28.6	0	0	0	109.1	L38 M49 S53 L72	L38-W51 HydrophobicContact CD1-CE3 3.45Å; L38-W51 VanDerWaalsContact CD1-CE3 3.45Å; L38-W51 HydrophobicContact CD1-CZ3 3.7Å; M49-W51 PolarHBondContact O-N 2.74Å; M49-W51 HydrophobicContact SD-CZ2 4.12Å; M49-W51 PolarHBondContact SD-NE1 2.9Å; W51-S53 PolarHBondContact O-N 2.78Å; W51-L72 HydrophobicContact CD2-CD1 3.84Å; W51-L72 HydrophobicContact CD2-CD2 4.12Å; W51-L72 HydrophobicContact CE3-CD1 3.72Å; W51-L72 HydrophobicContact CE3-CD2 3.54Å; W51-L72 HydrophobicContact CE3-CG 4.2Å; W51-L72 HydrophobicContact CH2-CD1 3.63Å; W51-L72 HydrophobicContact CZ2-CD1 3.72Å; W51-L72 HydrophobicContact CZ3-CD1 3.62Å; W51-L72 HydrophobicContact CZ3-CD2 3.89Å; W51-L72 HydrophobicContact CZ3-CG 4.16Å
52	S	53.2	Low	52.3	Low	63 Å²	63	93.2 Å²	93.2	44%	0.441	47%	0.468	S	S	.	.	P	Polyproline II helix	trans	-60.2	137.4	166.4	177.7	0	0	0	0	108.1	E54 A55	S52-E54 PolarHBondContact O-N 3.16Å; S52-E54 WeakPolarHBondContact OG-CB 3.42Å; S52-E54 PolarHBondContact OG-N 3.01Å; S52-A55 WeakPolarHBondContact O-CB 3.29Å; S52-A55 PolarHBondContact O-N 2.7Å
53	S	56.3	Low	53.1	Low	36 Å²	36	98.4 Å²	98.4	25%	0.252	49%	0.494	S	S	.	.	G	3₁₀ helix	trans	-55	-22.7	172.2	56.8	0	0	0	0	112.5	R34 L35 W51 A55 I56	R34-S53 PolarHBondContact NE-OG 2.8Å; R34-S53 PolarHBondContact NH2-OG 3.26Å; L35-S53 WeakPolarHBondContact O-CB 3.46Å; W51-S53 PolarHBondContact O-N 2.78Å; S53-A55 VanDerWaalsContact C-N 3.3Å; S53-I56 PolarHBondContact O-N 2.79Å
54	E	61.6	Low	53.6	Low	163 Å²	163	101.3 Å²	101.3	76%	0.762	51%	0.509	S	S	*	.	G	3₁₀ helix	trans	-72	-22.5	177	-59.4	179.9	165.1	0	0	113.3	S52 I56	S52-E54 PolarHBondContact O-N 3.16Å; S52-E54 WeakPolarHBondContact OG-CB 3.42Å; S52-E54 PolarHBondContact OG-N 3.01Å; E54-I56 VanDerWaalsContact C-N 3.28Å
55	A	58.7	Low	53.7	Low	30 Å²	30	93.4 Å²	93.4	25%	0.248	49%	0.489	C	S	.	.	G	3₁₀ helix	trans	-81	-9.2	175.8	0	0	0	0	0	112.1	S52 S53 L72 A73	S52-A55 WeakPolarHBondContact O-CB 3.29Å; S52-A55 PolarHBondContact O-N 2.7Å; S53-A55 VanDerWaalsContact C-N 3.3Å; A55-L72 CarbonylContact O-C 3.55Å; A55-L72 WeakPolarHBondContact O-CA 3.19Å; A55-A73 PolarHBondContact O-N 2.71Å
56	I	59.4	Low	53.9	Low	29 Å²	29	87.4 Å²	87.4	15%	0.149	47%	0.468	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.1	111.9	-176.8	-64.2	156.6	0	0	0	109	L35 L38 S53 E54 V59 V70 L72	L35-I56 HydrophobicContact CB-CD1 3.91Å; L35-I56 HydrophobicContact CD2-CD1 3.43Å; L35-I56 VanDerWaalsContact CD2-CD1 3.43Å; L35-I56 HydrophobicContact CD2-CG1 4.45Å; L35-I56 HydrophobicContact CG-CD1 4Å; L38-I56 HydrophobicContact CD1-CD1 4.4Å; S53-I56 PolarHBondContact O-N 2.79Å; E54-I56 VanDerWaalsContact C-N 3.28Å; I56-V59 HydrophobicContact CG2-CG2 3.95Å; I56-V70 HydrophobicContact CB-CG1 4.34Å; I56-V70 HydrophobicContact CG1-CG1 3.9Å; I56-V70 HydrophobicContact CG2-CG1 3.63Å; I56-L72 HydrophobicContact CB-CD2 4.49Å; I56-L72 HydrophobicContact CG1-CD2 3.67Å
57	L	54.9	Low	53.9	Low	120 Å²	120	84.3 Å²	84.3	63%	0.628	45%	0.446	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-81.1	-40.4	178.8	-66.1	178.3	0	0	0	111.9	V71 A73	L57-V71 HydrophobicContact CB-CB 4.4Å; L57-V71 HydrophobicContact CB-CG1 4.2Å; L57-V71 HydrophobicContact CD1-CG1 4.28Å; L57-V71 PolarHBondContact N-O 2.8Å; L57-A73 HydrophobicContact CD1-CB 4.11Å; L57-A73 HydrophobicContact CD2-CB 3.91Å; L57-A73 HydrophobicContact CG-CB 3.88Å
58	S	59	Low	54.2	Low	46 Å²	46	83.4 Å²	83.4	32%	0.322	44%	0.436	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-157.6	156.9	175.5	76.4	0	0	0	0	112.4	V70 V71	S58-V70 WeakPolarHBondContact O-CA 3.41Å; S58-V71 PolarHBondContact N-O 3.12Å; S58-V71 PolarHBondContact O-N 3.09Å; S58-V71 WeakPolarHBondContact OG-CG2 3.49Å
59	V	58.8	Low	54.5	Low	40 Å²	40	83 Å²	83	24%	0.242	44%	0.441	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.6	128.7	167.1	-175.7	0	0	0	0	107.1	L7 L35 I56 C68 C69 V70	L7-V59 HydrophobicContact CD1-CG1 4.43Å; L35-V59 HydrophobicContact CD2-CG2 4.21Å; I56-V59 HydrophobicContact CG2-CG2 3.95Å; V59-C68 HydrophobicContact CG1-CB 4.48Å; V59-C69 CarbonylContact C-O 3.39Å; V59-C69 WeakPolarHBondContact CA-O 3.44Å; V59-V70 HydrophobicContact CG2-CG1 4.36Å; V59-V70 HydrophobicContact CG2-CG2 4.34Å
60	M	53.4	Low	55	Low	108 Å²	108	80.1 Å²	80.1	53%	0.532	43%	0.429	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.1	140.1	175.3	-63.8	-177.7	-69	0	0	108.7	C68 C69 V71	M60-C68 CarbonylContact O-C 3.24Å; M60-C68 VanDerWaalsContact O-C 3.24Å; M60-C68 WeakPolarHBondContact O-CA 3.11Å; M60-C68 WeakPolarHBondContact O-CB 3.36Å; M60-C69 HydrophobicContact CE-CB 4.42Å; M60-C69 PolarHBondContact N-O 3.36Å; M60-C69 PolarHBondContact O-N 2.89Å; M60-V71 HydrophobicContact CE-CG2 4.24Å
61	R	55.5	Low	55.3	Low	155 Å²	155	76.1 Å²	76.1	59%	0.585	41%	0.412	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-109.4	135	171.9	179.5	172.7	172.8	175.4	-0.3	109.4
62	H	50.4	Low	55.4	Low	102 Å²	102	74.5 Å²	74.5	47%	0.472	41%	0.411	S	S	.	.			trans	-91.2	111.5	171.7	-160.9	-73.1	0	0	0	108.5	D64 T65 G66 V67	H62-D64 VanDerWaalsContact C-N 3.26Å; H62-D64 IonicContact CE1-OD2 3.52Å; H62-D64 PolarHBondContact O-N 3.15Å; H62-T65 WeakPolarHBondContact CB-OG1 3.32Å; H62-T65 PolarHBondContact O-N 2.7Å; H62-G66 WeakPolarHBondContact O-CA 3.29Å; H62-G66 PolarHBondContact O-N 3.2Å; H62-V67 WeakPolarHBondContact CB-O 3.19Å; H62-V67 PolarHBondContact N-O 3.18Å
63	D	63.1	Low	55.5	Low	141 Å²	141	73.6 Å²	73.6	75%	0.754	41%	0.406	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.8	-39	-172.2	-69.9	-31.5	0	0	0	112.5	T65	D63-T65 PolarHBondContact O-N 2.99Å
64	D	59.8	Low	55.5	Low	147 Å²	147	84.8 Å²	84.8	79%	0.786	46%	0.455	S	S	*	.	T	Hydrogen-bonded Turn	trans	-72.8	-25.2	-175	-58.6	-38.6	0	0	0	114.2	H62	H62-D64 VanDerWaalsContact C-N 3.26Å; H62-D64 IonicContact CE1-OD2 3.52Å; H62-D64 PolarHBondContact O-N 3.15Å
65	T	49.6	Very low	55.2	Low	90 Å²	90	80.9 Å²	80.9	55%	0.552	44%	0.44	S	S	*	.	T	Hydrogen-bonded Turn	trans	-116.5	-15	-172.7	61	0	0	0	0	112.8	H62 D63 V67	H62-T65 WeakPolarHBondContact CB-OG1 3.32Å; H62-T65 PolarHBondContact O-N 2.7Å; D63-T65 PolarHBondContact O-N 2.99Å; T65-V67 PolarHBondContact O-N 2.96Å; T65-V67 VanDerWaalsContact O-N 3.14Å; T65-V67 WeakPolarHBondContact OG1-CB 3.46Å; T65-V67 WeakPolarHBondContact OG1-CG2 3.45Å; T65-V67 PolarHBondContact OG1-N 3.43Å
66	G	47.9	Very low	55	Low	26 Å²	26	83.6 Å²	83.6	27%	0.268	45%	0.45	S	S	.	.			trans	69.9	-4.1	-169.5	0	0	0	0	0	113.6	H62 C68	H62-G66 WeakPolarHBondContact O-CA 3.29Å; H62-G66 PolarHBondContact O-N 3.2Å; G66-C68 PolarHBondContact O-N 3.44Å
67	V	50.5	Low	54.8	Low	40 Å²	40	86.6 Å²	86.6	24%	0.242	47%	0.466	C	S	.	.			trans	-68.2	128.9	178.9	175.1	0	0	0	0	108.1	F9 H62 T65	F9-V67 HydrophobicContact CB-CG1 4.48Å; H62-V67 WeakPolarHBondContact CB-O 3.19Å; H62-V67 PolarHBondContact N-O 3.18Å; T65-V67 PolarHBondContact O-N 2.96Å; T65-V67 VanDerWaalsContact O-N 3.14Å; T65-V67 WeakPolarHBondContact OG1-CB 3.46Å; T65-V67 WeakPolarHBondContact OG1-CG2 3.45Å; T65-V67 PolarHBondContact OG1-N 3.43Å
68	C	52.5	Low	54.8	Low	3 Å²	3	84.6 Å²	84.6	2%	0.02	46%	0.457	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.2	171	171.7	-65	0	0	0	0	109.4	L7 F9 V59 M60 G66	L7-C68 HydrophobicContact CB-CB 4.4Å; L7-C68 HydrophobicContact CD2-CB 3.9Å; L7-C68 WeakPolarHBondContact CD2-SG 3.15Å; F9-C68 HydrophobicContact CD1-CB 3.64Å; F9-C68 WeakPolarHBondContact CD1-O 3.36Å; F9-C68 HydrophobicContact CD2-CB 4.47Å; F9-C68 VanDerWaalsContact CE1-CA 3.41Å; F9-C68 HydrophobicContact CE1-CB 3.03Å; F9-C68 WeakPolarHBondContact CE1-O 3.36Å; F9-C68 HydrophobicContact CE2-CB 4.08Å; F9-C68 HydrophobicContact CG-CB 4.25Å; F9-C68 HydrophobicContact CZ-CB 3.28Å; V59-C68 HydrophobicContact CG1-CB 4.48Å; M60-C68 CarbonylContact O-C 3.24Å; M60-C68 VanDerWaalsContact O-C 3.24Å; M60-C68 WeakPolarHBondContact O-CA 3.11Å; M60-C68 WeakPolarHBondContact O-CB 3.36Å; G66-C68 PolarHBondContact O-N 3.44Å
69	C	54.4	Low	54.5	Low	68 Å²	68	87.1 Å²	87.1	46%	0.459	47%	0.465	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.3	131.8	170.5	-73.1	0	0	0	0	106.9	F9 V59 M60	F9-C69 VanDerWaalsContact CE1-N 3.29Å; V59-C69 CarbonylContact C-O 3.39Å; V59-C69 WeakPolarHBondContact CA-O 3.44Å; M60-C69 HydrophobicContact CE-CB 4.42Å; M60-C69 PolarHBondContact N-O 3.36Å; M60-C69 PolarHBondContact O-N 2.89Å
70	V	57.2	Low	54.2	Low	36 Å²	36	90.2 Å²	90.2	22%	0.218	48%	0.48	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.2	123.2	177.6	-171.7	0	0	0	0	108.3	F9 L35 L38 I56 S58 V59 L72	F9-V70 HydrophobicContact CE1-CG2 3.53Å; F9-V70 HydrophobicContact CZ-CG2 3.57Å; L35-V70 HydrophobicContact CD2-CG2 4.46Å; L38-V70 HydrophobicContact CD1-CG1 4.44Å; L38-V70 HydrophobicContact CD1-CG2 4.28Å; L38-V70 HydrophobicContact CD2-CG2 4.42Å; I56-V70 HydrophobicContact CB-CG1 4.34Å; I56-V70 HydrophobicContact CG1-CG1 3.9Å; I56-V70 HydrophobicContact CG2-CG1 3.63Å; S58-V70 WeakPolarHBondContact O-CA 3.41Å; V59-V70 HydrophobicContact CG2-CG1 4.36Å; V59-V70 HydrophobicContact CG2-CG2 4.34Å; V70-L72 HydrophobicContact CG1-CD2 3.89Å
71	V	53.5	Low	54.3	Low	60 Å²	60	88.9 Å²	88.9	36%	0.364	48%	0.477	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.2	126.6	173.3	-176.5	0	0	0	0	108.1	L57 S58 M60	L57-V71 HydrophobicContact CB-CB 4.4Å; L57-V71 HydrophobicContact CB-CG1 4.2Å; L57-V71 HydrophobicContact CD1-CG1 4.28Å; L57-V71 PolarHBondContact N-O 2.8Å; S58-V71 PolarHBondContact N-O 3.12Å; S58-V71 PolarHBondContact O-N 3.09Å; S58-V71 WeakPolarHBondContact OG-CG2 3.49Å; M60-V71 HydrophobicContact CE-CG2 4.24Å
72	L	54.5	Low	54.2	Low	62 Å²	62	83.8 Å²	83.8	33%	0.325	47%	0.468	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104	151	179.4	-56.8	177.4	0	0	0	111.9	W51 A55 I56 V70	W51-L72 HydrophobicContact CD2-CD1 3.84Å; W51-L72 HydrophobicContact CD2-CD2 4.12Å; W51-L72 HydrophobicContact CE3-CD1 3.72Å; W51-L72 HydrophobicContact CE3-CD2 3.54Å; W51-L72 HydrophobicContact CE3-CG 4.2Å; W51-L72 HydrophobicContact CH2-CD1 3.63Å; W51-L72 HydrophobicContact CZ2-CD1 3.72Å; W51-L72 HydrophobicContact CZ3-CD1 3.62Å; W51-L72 HydrophobicContact CZ3-CD2 3.89Å; W51-L72 HydrophobicContact CZ3-CG 4.16Å; A55-L72 CarbonylContact O-C 3.55Å; A55-L72 WeakPolarHBondContact O-CA 3.19Å; I56-L72 HydrophobicContact CB-CD2 4.49Å; I56-L72 HydrophobicContact CG1-CD2 3.67Å; V70-L72 HydrophobicContact CG1-CD2 3.89Å
73	A	55.3	Low	54.5	Low	43 Å²	43	82.3 Å²	82.3	36%	0.355	47%	0.468	S	S	.	.			trans	-77.8	127.2	165.5	0	0	0	0	0	108.6	A55 L57	A55-A73 PolarHBondContact O-N 2.71Å; L57-A73 HydrophobicContact CD1-CB 4.11Å; L57-A73 HydrophobicContact CD2-CB 3.91Å; L57-A73 HydrophobicContact CG-CB 3.88Å
74	E	55.7	Low	53.7	Low	272 Å²	272	77 Å²	77	100%	1.271	44%	0.442	S	S	*	.			trans	-64.8	0	173.6	-68.6	-174.9	159.8	0	0	112.7

Retrieved 74 of 74 residues in 25.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).