C4QLY6_SCHMA Loading...

Adenylate cyclase-stimulating G alpha protein

AlphaFold DB , UniProt , Accession C4QLY6, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 126 aa.

						>C4QLY6_SCHMA|C4QLY6
MFASFLDKALEVGAPNYIPSEQDILRCRVLTSGIFETKFSVDKVNFHMFDVGGQREERRKWIQCFNDVTAIIFVAACSSYNMVLREDPSQNRVKESLELLASIWNNRFVCITSSDPVLFIGILTDP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	64.8	Low	86.6	Confident	89 Å²	89	89.7 Å²	89.7	44%	0.438	48%	0.479	S	S	.	.				0	-59.9	0	-169.5	-178.8	-78.8	0	0	114.6	S4 R26 R28	M1-S4 PolarHBondContact O-N 3.44Å; M1-S4 PolarHBondContact O-OG 2.91Å; M1-R26 VanDerWaalsContact CE-O 3.29Å; M1-R26 WeakPolarHBondContact CE-O 3.4Å; M1-R26 WeakPolarHBondContact CG-O 3.41Å; M1-R28 HydrophobicContact CE-CB 3.73Å; M1-R28 HydrophobicContact SD-CB 3.25Å; M1-R28 WeakPolarHBondContact SD-CB 3.11Å; M1-R28 HydrophobicContact SD-CG 4.32Å
2	F	73.8	Confident	87.2	Confident	159 Å²	159	86.7 Å²	86.7	70%	0.697	47%	0.466	S	S	*	.	H	α-helix	trans	-64.1	-42.6	-178.5	-177.6	-111.4	0	0	0	112.5	S4 F5 L6	F2-S4 VanDerWaalsContact C-N 3.31Å; F2-S4 PolarHBondContact O-N 3.12Å; F2-F5 PolarHBondContact O-N 3.06Å; F2-F5 VanDerWaalsContact O-N 3.16Å; F2-L6 HydrophobicContact CD1-CD1 3.76Å; F2-L6 HydrophobicContact CD1-CG 4.22Å; F2-L6 HydrophobicContact CE1-CD1 3.33Å; F2-L6 HydrophobicContact CE1-CD2 4.25Å; F2-L6 HydrophobicContact CE1-CG 3.88Å; F2-L6 HydrophobicContact CE2-CD2 4.48Å; F2-L6 HydrophobicContact CZ-CD1 3.91Å; F2-L6 HydrophobicContact CZ-CD2 3.95Å; F2-L6 HydrophobicContact CZ-CG 4.04Å; F2-L6 PolarHBondContact O-N 3.07Å
3	A	80.1	Confident	87.8	Confident	61 Å²	61	84.8 Å²	84.8	50%	0.504	48%	0.48	S	S	.	.	H	α-helix	trans	-54.4	-44.2	178	0	0	0	0	0	112.9	F5 L6 D7	A3-F5 VanDerWaalsContact C-N 3.25Å; A3-F5 PolarHBondContact O-N 3.4Å; A3-L6 WeakPolarHBondContact O-CB 3.42Å; A3-L6 PolarHBondContact O-N 2.93Å; A3-D7 PolarHBondContact O-N 3.07Å
4	S	82.7	Confident	88.4	Confident	19 Å²	19	81.3 Å²	81.3	13%	0.133	47%	0.466	C	S	.	.	H	α-helix	trans	-64.3	-26.6	-177.9	55.6	0	0	0	0	114.5	M1 F2	M1-S4 PolarHBondContact O-N 3.44Å; M1-S4 PolarHBondContact O-OG 2.91Å; F2-S4 VanDerWaalsContact C-N 3.31Å; F2-S4 PolarHBondContact O-N 3.12Å
5	F	91	Very high	89	Confident	56 Å²	56	85.3 Å²	85.3	25%	0.246	50%	0.497	C	S	.	.	H	α-helix	trans	-82.3	-31.4	174.3	-74.5	-65.9	0	0	0	112	F2 A3 K8 A9 V12 D23 R26	F2-F5 PolarHBondContact O-N 3.06Å; F2-F5 VanDerWaalsContact O-N 3.16Å; A3-F5 VanDerWaalsContact C-N 3.25Å; A3-F5 PolarHBondContact O-N 3.4Å; F5-K8 CarbonylContact O-C 3.58Å; F5-K8 PolarHBondContact O-N 3.5Å; F5-A9 PolarHBondContact O-N 3.41Å; F5-A9 VanDerWaalsContact O-N 3.11Å; F5-V12 HydrophobicContact CD1-CG2 4.31Å; F5-D23 HydrophobicContact CE1-CB 4.13Å; F5-D23 WeakPolarHBondContact CZ-O 3.45Å; F5-R26 HydrophobicContact CE2-CB 4.03Å; F5-R26 HydrophobicContact CZ-CB 3.95Å
6	L	91.9	Very high	89.4	Confident	99 Å²	99	88.1 Å²	88.1	52%	0.518	51%	0.509	S	S	.	.	H	α-helix	trans	-65.5	-40.1	173.6	-70.2	-176.8	0	0	0	111.7	F2 A3 K8 A9	F2-L6 HydrophobicContact CD1-CD1 3.76Å; F2-L6 HydrophobicContact CD1-CG 4.22Å; F2-L6 HydrophobicContact CE1-CD1 3.33Å; F2-L6 HydrophobicContact CE1-CD2 4.25Å; F2-L6 HydrophobicContact CE1-CG 3.88Å; F2-L6 HydrophobicContact CE2-CD2 4.48Å; F2-L6 HydrophobicContact CZ-CD1 3.91Å; F2-L6 HydrophobicContact CZ-CD2 3.95Å; F2-L6 HydrophobicContact CZ-CG 4.04Å; F2-L6 PolarHBondContact O-N 3.07Å; A3-L6 WeakPolarHBondContact O-CB 3.42Å; A3-L6 PolarHBondContact O-N 2.93Å; L6-K8 PolarHBondContact O-N 3.33Å; L6-A9 VanDerWaalsContact O-CB 3.25Å; L6-A9 WeakPolarHBondContact O-CB 3.34Å; L6-A9 PolarHBondContact O-N 3.32Å
7	D	92.3	Very high	89.8	Confident	139 Å²	139	86.1 Å²	86.1	74%	0.743	49%	0.491	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.5	-25.3	175.5	-62.7	-26.6	0	0	0	112.1	A3	A3-D7 PolarHBondContact O-N 3.07Å
8	K	92.4	Very high	90.2	Very high	43 Å²	43	89.3 Å²	89.3	19%	0.187	51%	0.505	C	S	.	.	T	Hydrogen-bonded Turn	trans	-103.8	15.8	177.7	-63.3	-173.7	68.1	-172.8	0	113.6	F5 L6 L10 E11 V12 D23	F5-K8 CarbonylContact O-C 3.58Å; F5-K8 PolarHBondContact O-N 3.5Å; L6-K8 PolarHBondContact O-N 3.33Å; K8-L10 VanDerWaalsContact C-N 3.29Å; K8-L10 PolarHBondContact O-N 3.46Å; K8-L10 VanDerWaalsContact O-N 3.14Å; K8-E11 WeakPolarHBondContact CE-OE1 3.48Å; K8-E11 WeakPolarHBondContact CE-OE2 3.38Å; K8-E11 IonicContact NZ-OE1 3.55Å; K8-E11 PolarHBondContact NZ-OE1 3.37Å; K8-E11 IonicContact NZ-OE2 2.95Å; K8-E11 WeakPolarHBondContact O-CB 3.39Å; K8-E11 PolarHBondContact O-N 2.93Å; K8-V12 HydrophobicContact CB-CG2 4Å; K8-V12 WeakPolarHBondContact O-CG2 3.36Å; K8-V12 PolarHBondContact O-N 3.43Å; K8-D23 VanDerWaalsContact NZ-CG 3.29Å; K8-D23 IonicContact NZ-OD1 3.67Å; K8-D23 PolarHBondContact NZ-OD1 2.94Å; K8-D23 IonicContact NZ-OD2 2.86Å; K8-D23 PolarHBondContact NZ-OD2 3.3Å
9	A	94	Very high	90.5	Very high	57 Å²	57	88 Å²	88	47%	0.471	50%	0.501	S	S	.	.	H	α-helix	trans	-56.2	-38.3	-168.6	0	0	0	0	0	114.2	F5 L6 G13	F5-A9 PolarHBondContact O-N 3.41Å; F5-A9 VanDerWaalsContact O-N 3.11Å; L6-A9 VanDerWaalsContact O-CB 3.25Å; L6-A9 WeakPolarHBondContact O-CB 3.34Å; L6-A9 PolarHBondContact O-N 3.32Å; A9-G13 PolarHBondContact O-N 2.91Å
10	L	94.9	Very high	90.7	Very high	166 Å²	166	86.1 Å²	86.1	87%	0.869	49%	0.493	S	S	*	.	H	α-helix	trans	-68.6	-38.2	177.6	-66	177.4	0	0	0	112.7	K8 A14	K8-L10 VanDerWaalsContact C-N 3.29Å; K8-L10 PolarHBondContact O-N 3.46Å; K8-L10 VanDerWaalsContact O-N 3.14Å; L10-A14 PolarHBondContact O-N 2.82Å
11	E	94.6	Very high	90.9	Very high	99 Å²	99	89.9 Å²	89.9	46%	0.463	51%	0.507	S	S	.	.	H	α-helix	trans	-69	-49.6	177.8	-175.8	-169.8	140.1	0	0	110.4	K8 G13 A14 Y17	K8-E11 WeakPolarHBondContact CE-OE1 3.48Å; K8-E11 WeakPolarHBondContact CE-OE2 3.38Å; K8-E11 IonicContact NZ-OE1 3.55Å; K8-E11 PolarHBondContact NZ-OE1 3.37Å; K8-E11 IonicContact NZ-OE2 2.95Å; K8-E11 WeakPolarHBondContact O-CB 3.39Å; K8-E11 PolarHBondContact O-N 2.93Å; E11-G13 PolarHBondContact O-N 2.88Å; E11-A14 WeakPolarHBondContact O-CB 3.46Å; E11-A14 PolarHBondContact O-N 2.95Å; E11-A14 VanDerWaalsContact O-N 3.16Å; E11-Y17 HydrophobicContact CG-CD2 4.09Å; E11-Y17 HydrophobicContact CG-CE2 4.1Å; E11-Y17 WeakPolarHBondContact O-CB 3.36Å; E11-Y17 VanDerWaalsContact O-CD2 3.29Å; E11-Y17 WeakPolarHBondContact O-CD2 3.39Å
12	V	94	Very high	92.2	Very high	53 Å²	53	90.2 Å²	90.2	32%	0.321	51%	0.507	S	S	.	.	H	α-helix	trans	-63.7	-29.9	179.8	178.3	0	0	0	0	111.6	F5 K8 Y17	F5-V12 HydrophobicContact CD1-CG2 4.31Å; K8-V12 HydrophobicContact CB-CG2 4Å; K8-V12 WeakPolarHBondContact O-CG2 3.36Å; K8-V12 PolarHBondContact O-N 3.43Å; V12-Y17 HydrophobicContact CB-CD1 4.5Å; V12-Y17 HydrophobicContact CB-CE1 4.22Å; V12-Y17 HydrophobicContact CG1-CD1 4.27Å; V12-Y17 HydrophobicContact CG1-CE1 3.93Å; V12-Y17 HydrophobicContact CG2-CE1 4.17Å; V12-Y17 HydrophobicContact CG2-CE2 4.23Å
13	G	94.8	Very high	93.1	Very high	63 Å²	63	83 Å²	83	65%	0.649	48%	0.476	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.2	-5.4	178.2	0	0	0	0	0	115.5	A9 E11	A9-G13 PolarHBondContact O-N 2.91Å; E11-G13 PolarHBondContact O-N 2.88Å
14	A	96.6	Very high	93.8	Very high	35 Å²	35	85.3 Å²	85.3	29%	0.289	48%	0.479	S	S	.	.	S	Bend	trans	-67.8	140.9	179.9	0	0	0	0	0	111.3	L10 E11 N16 Y17	L10-A14 PolarHBondContact O-N 2.82Å; E11-A14 WeakPolarHBondContact O-CB 3.46Å; E11-A14 PolarHBondContact O-N 2.95Å; E11-A14 VanDerWaalsContact O-N 3.16Å; A14-N16 PolarHBondContact O-N 3.34Å; A14-Y17 VanDerWaalsContact O-CB 3.29Å; A14-Y17 WeakPolarHBondContact O-CB 3.46Å; A14-Y17 PolarHBondContact O-N 2.89Å
15	P	96.7	Very high	94.1	Very high	142 Å²	142	91 Å²	91	92%	0.922	51%	0.507	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.6	-18.7	-174.8	25.4	-35	0	0	0	114.1
16	N	96.5	Very high	94.1	Very high	130 Å²	130	92.2 Å²	92.2	70%	0.695	51%	0.51	S	S	*	.	T	Hydrogen-bonded Turn	trans	-114.5	20.4	179.4	64.9	-38.8	0	0	0	112.6	A14 I18	A14-N16 PolarHBondContact O-N 3.34Å; N16-I18 PolarHBondContact O-N 3.25Å
17	Y	96.3	Very high	94	Very high	53 Å²	53	91 Å²	91	21%	0.208	51%	0.508	C	S	.	.			trans	-61.3	129.6	178.1	173.4	-113.8	0	0	0	111.6	E11 V12 A14 P19 D23	E11-Y17 HydrophobicContact CG-CD2 4.09Å; E11-Y17 HydrophobicContact CG-CE2 4.1Å; E11-Y17 WeakPolarHBondContact O-CB 3.36Å; E11-Y17 VanDerWaalsContact O-CD2 3.29Å; E11-Y17 WeakPolarHBondContact O-CD2 3.39Å; V12-Y17 HydrophobicContact CB-CD1 4.5Å; V12-Y17 HydrophobicContact CB-CE1 4.22Å; V12-Y17 HydrophobicContact CG1-CD1 4.27Å; V12-Y17 HydrophobicContact CG1-CE1 3.93Å; V12-Y17 HydrophobicContact CG2-CE1 4.17Å; V12-Y17 HydrophobicContact CG2-CE2 4.23Å; A14-Y17 VanDerWaalsContact O-CB 3.29Å; A14-Y17 WeakPolarHBondContact O-CB 3.46Å; A14-Y17 PolarHBondContact O-N 2.89Å; Y17-P19 HydrophobicContact CD1-CG 4.36Å; Y17-P19 HydrophobicContact CE1-CB 4.2Å; Y17-P19 HydrophobicContact CE1-CG 3.74Å; Y17-D23 WeakPolarHBondContact OH-CB 3.24Å; Y17-D23 PolarHBondContact OH-OD2 3.36Å
18	I	96.3	Very high	93.8	Very high	144 Å²	144	92.1 Å²	92.1	74%	0.738	50%	0.502	S	S	*	.			trans	-117.5	116.6	171.7	-59.1	178.1	0	0	0	106.7	N16 S20	N16-I18 PolarHBondContact O-N 3.25Å; I18-S20 PolarHBondContact O-N 2.83Å
19	P	95.4	Very high	93.7	Very high	65 Å²	65	95.7 Å²	95.7	42%	0.422	53%	0.528	S	S	.	.			trans	-56.8	131.5	178.4	-22.7	31.4	0	0	0	111.8	Y17 D23 I24	Y17-P19 HydrophobicContact CD1-CG 4.36Å; Y17-P19 HydrophobicContact CE1-CB 4.2Å; Y17-P19 HydrophobicContact CE1-CG 3.74Å; P19-D23 HydrophobicContact CB-CB 4.01Å; P19-I24 HydrophobicContact CB-CG1 4.12Å
20	S	95.1	Very high	93.4	Very high	50 Å²	50	97 Å²	97	35%	0.35	53%	0.526	S	S	.	.			trans	-69.3	164	168.7	69.4	0	0	0	0	110.7	I18 Q22 D23 I24	I18-S20 PolarHBondContact O-N 2.83Å; S20-Q22 PolarHBondContact O-N 2.97Å; S20-Q22 PolarHBondContact OG-N 3.4Å; S20-D23 VanDerWaalsContact CB-OD2 3.31Å; S20-D23 WeakPolarHBondContact CB-OD2 3.19Å; S20-D23 PolarHBondContact N-OD2 2.95Å; S20-D23 WeakPolarHBondContact O-CB 3.36Å; S20-D23 PolarHBondContact O-N 3.21Å; S20-D23 PolarHBondContact OG-N 2.95Å; S20-D23 PolarHBondContact OG-OD2 3.15Å; S20-I24 WeakPolarHBondContact O-CG1 3.42Å; S20-I24 PolarHBondContact O-N 3.49Å
21	E	95.2	Very high	93.1	Very high	166 Å²	166	90.9 Å²	90.9	78%	0.776	50%	0.496	S	S	*	.	H	α-helix	trans	-54.2	-36.5	171.9	-64.6	-177.5	160.3	0	0	111.5	D23 I24 L25	E21-D23 PolarHBondContact O-N 3.48Å; E21-I24 PolarHBondContact O-N 3.5Å; E21-L25 VanDerWaalsContact O-CG 3.3Å; E21-L25 WeakPolarHBondContact O-CG 3.43Å; E21-L25 PolarHBondContact O-N 2.86Å
22	Q	92.2	Very high	93	Very high	96 Å²	96	90 Å²	90	45%	0.449	50%	0.5	S	S	.	.	H	α-helix	trans	-67.2	-35.7	176.8	-170.8	59.9	58.2	0	0	112.7	S20 R26	S20-Q22 PolarHBondContact O-N 2.97Å; S20-Q22 PolarHBondContact OG-N 3.4Å; Q22-R26 WeakPolarHBondContact O-CB 3.23Å; Q22-R26 VanDerWaalsContact O-CG 3.27Å; Q22-R26 WeakPolarHBondContact O-CG 3.37Å; Q22-R26 PolarHBondContact O-N 3.48Å
23	D	93.4	Very high	92.8	Very high	6 Å²	6	88.1 Å²	88.1	3%	0.032	49%	0.492	C	S	.	.	H	α-helix	trans	-68.5	-39.8	174.9	-60.2	-51.2	0	0	0	110.3	F5 K8 Y17 P19 S20 E21 R26 C27	F5-D23 HydrophobicContact CE1-CB 4.13Å; F5-D23 WeakPolarHBondContact CZ-O 3.45Å; K8-D23 VanDerWaalsContact NZ-CG 3.29Å; K8-D23 IonicContact NZ-OD1 3.67Å; K8-D23 PolarHBondContact NZ-OD1 2.94Å; K8-D23 IonicContact NZ-OD2 2.86Å; K8-D23 PolarHBondContact NZ-OD2 3.3Å; Y17-D23 WeakPolarHBondContact OH-CB 3.24Å; Y17-D23 PolarHBondContact OH-OD2 3.36Å; P19-D23 HydrophobicContact CB-CB 4.01Å; S20-D23 VanDerWaalsContact CB-OD2 3.31Å; S20-D23 WeakPolarHBondContact CB-OD2 3.19Å; S20-D23 PolarHBondContact N-OD2 2.95Å; S20-D23 WeakPolarHBondContact O-CB 3.36Å; S20-D23 PolarHBondContact O-N 3.21Å; S20-D23 PolarHBondContact OG-N 2.95Å; S20-D23 PolarHBondContact OG-OD2 3.15Å; E21-D23 PolarHBondContact O-N 3.48Å; D23-R26 PolarHBondContact O-N 2.93Å; D23-C27 PolarHBondContact O-N 3.35Å
24	I	92.8	Very high	92.7	Very high	111 Å²	111	87.3 Å²	87.3	57%	0.569	47%	0.472	S	S	*	.	H	α-helix	trans	-62.1	-48.8	174.9	-63.5	169.2	0	0	0	110.4	P19 S20 E21 R26 C27	P19-I24 HydrophobicContact CB-CG1 4.12Å; S20-I24 WeakPolarHBondContact O-CG1 3.42Å; S20-I24 PolarHBondContact O-N 3.49Å; E21-I24 PolarHBondContact O-N 3.5Å; I24-R26 PolarHBondContact O-N 3.39Å; I24-C27 VanDerWaalsContact O-CB 3.26Å; I24-C27 WeakPolarHBondContact O-CB 3.4Å; I24-C27 PolarHBondContact O-N 2.95Å
25	L	91	Very high	92.6	Very high	139 Å²	139	91 Å²	91	73%	0.728	48%	0.482	S	S	*	.	H	α-helix	trans	-63.2	-29.3	178.4	-70.8	173.2	0	0	0	113.1	E21	E21-L25 VanDerWaalsContact O-CG 3.3Å; E21-L25 WeakPolarHBondContact O-CG 3.43Å; E21-L25 PolarHBondContact O-N 2.86Å
26	R	89.3	Confident	92.4	Very high	81 Å²	81	89.6 Å²	89.6	31%	0.306	46%	0.463	S	S	.	.	H	α-helix	trans	-85	-11.5	175.4	-73.3	175.5	176.7	177.1	-0.2	113	M1 F5 Q22 D23 I24 R28	M1-R26 VanDerWaalsContact CE-O 3.29Å; M1-R26 WeakPolarHBondContact CE-O 3.4Å; M1-R26 WeakPolarHBondContact CG-O 3.41Å; F5-R26 HydrophobicContact CE2-CB 4.03Å; F5-R26 HydrophobicContact CZ-CB 3.95Å; Q22-R26 WeakPolarHBondContact O-CB 3.23Å; Q22-R26 VanDerWaalsContact O-CG 3.27Å; Q22-R26 WeakPolarHBondContact O-CG 3.37Å; Q22-R26 PolarHBondContact O-N 3.48Å; D23-R26 PolarHBondContact O-N 2.93Å; I24-R26 PolarHBondContact O-N 3.39Å; R26-R28 PolarHBondContact O-N 3.3Å
27	C	90.6	Very high	92.4	Very high	72 Å²	72	87.1 Å²	87.1	49%	0.486	45%	0.452	S	S	.	.			trans	-69.7	129.4	175.9	-171.2	0	0	0	0	109.6	D23 I24	D23-C27 PolarHBondContact O-N 3.35Å; I24-C27 VanDerWaalsContact O-CB 3.26Å; I24-C27 WeakPolarHBondContact O-CB 3.4Å; I24-C27 PolarHBondContact O-N 2.95Å
28	R	88.5	Confident	92.4	Very high	164 Å²	164	91.8 Å²	91.8	62%	0.619	47%	0.474	S	S	*	.			trans	-100.9	102.8	171.8	178.6	173.1	-171.9	175.8	4.7	110.3	M1 R26	M1-R28 HydrophobicContact CE-CB 3.73Å; M1-R28 HydrophobicContact SD-CB 3.25Å; M1-R28 WeakPolarHBondContact SD-CB 3.11Å; M1-R28 HydrophobicContact SD-CG 4.32Å; R26-R28 PolarHBondContact O-N 3.3Å
29	V	88.7	Confident	92.4	Very high	118 Å²	118	88.9 Å²	88.9	72%	0.715	46%	0.456	S	S	*	.			trans	-100.8	127.8	163.6	-175.9	0	0	0	0	107.1	T31	V29-T31 PolarHBondContact O-N 3.12Å
30	L	88.7	Confident	92.5	Very high	83 Å²	83	89.5 Å²	89.5	44%	0.435	46%	0.462	S	S	.	.			trans	-72.8	115.7	175.7	-67.9	175.4	0	0	0	108.8	S32	L30-S32 PolarHBondContact O-N 2.67Å
31	T	89.4	Confident	92.6	Very high	39 Å²	39	90.5 Å²	90.5	24%	0.239	47%	0.466	C	S	.	.			trans	-62.4	123.5	172.1	-53.6	0	0	0	0	109.7	V29 F35 D50	V29-T31 PolarHBondContact O-N 3.12Å; T31-F35 HydrophobicContact CG2-CD2 3.39Å; T31-F35 HydrophobicContact CG2-CE2 3.48Å; T31-F35 VanDerWaalsContact CG2-CE2 3.48Å; T31-D50 VanDerWaalsContact CG2-OD2 3.31Å; T31-D50 WeakPolarHBondContact CG2-OD2 3.39Å; T31-D50 PolarHBondContact OG1-OD2 3.13Å
32	S	90.7	Very high	92.6	Very high	79 Å²	79	89.9 Å²	89.9	55%	0.552	47%	0.468	S	S	*	.			trans	-122.4	117	171.5	162.2	0	0	0	0	108.3	L30 F35	L30-S32 PolarHBondContact O-N 2.67Å; S32-F35 VanDerWaalsContact O-CE2 3.29Å; S32-F35 WeakPolarHBondContact O-CE2 3.46Å
33	G	91.1	Very high	92.7	Very high	14 Å²	14	94.9 Å²	94.9	14%	0.144	49%	0.488	C	S	.	.	S	Bend	trans	101.4	-158.3	-173.1	0	0	0	0	0	113.4	G52 E57	G33-G52 PolarHBondContact O-N 2.69Å; G33-E57 PolarHBondContact N-OE2 3.04Å
34	I	92	Very high	92.8	Very high	47 Å²	47	98.5 Å²	98.5	24%	0.241	51%	0.51	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.9	127.3	179.2	-61.7	159.3	0	0	0	106.3	F49 D50 V51 K60 Q63 C64	I34-F49 HydrophobicContact CG2-CD1 4.06Å; I34-D50 WeakPolarHBondContact CA-O 3.33Å; I34-V51 HydrophobicContact CG1-CG1 4.16Å; I34-V51 HydrophobicContact CG2-CG1 4.37Å; I34-K60 HydrophobicContact CD1-CB 4.14Å; I34-K60 HydrophobicContact CG1-CB 4.35Å; I34-Q63 HydrophobicContact CD1-CB 3.86Å; I34-C64 WeakPolarHBondContact CD1-SG 3.38Å; I34-C64 WeakPolarHBondContact CG2-SG 3.41Å
35	F	93.8	Very high	93	Very high	112 Å²	112	99.3 Å²	99.3	49%	0.491	52%	0.516	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.4	136.4	177.3	-66.1	-94.2	0	0	0	109.7	T31 S32 F49 D50	T31-F35 HydrophobicContact CG2-CD2 3.39Å; T31-F35 HydrophobicContact CG2-CE2 3.48Å; T31-F35 VanDerWaalsContact CG2-CE2 3.48Å; S32-F35 VanDerWaalsContact O-CE2 3.29Å; S32-F35 WeakPolarHBondContact O-CE2 3.46Å; F35-F49 CarbonylContact O-C 3.52Å; F35-F49 WeakPolarHBondContact O-CA 3.49Å; F35-D50 HydrophobicContact CB-CB 4.36Å; F35-D50 PolarHBondContact N-O 2.85Å; F35-D50 PolarHBondContact O-N 2.94Å
36	E	94	Very high	93.2	Very high	113 Å²	113	97.1 Å²	97.1	53%	0.528	50%	0.501	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.8	140.4	-177.7	-60.6	-176	-150.3	0	0	110.2	H47 M48 F49	E36-H47 IonicContact OE2-CD2 2.85Å; E36-H47 IonicContact OE2-CE1 3.65Å; E36-H47 PolarHBondContact OE2-CE1 3.43Å; E36-H47 VanDerWaalsContact OE2-CE1 3.25Å; E36-H47 IonicContact OE2-NE2 2.9Å; E36-H47 PolarHBondContact OE2-NE2 2.89Å; E36-M48 CarbonylContact C-O 3.52Å; E36-M48 WeakPolarHBondContact CA-O 3.25Å; E36-F49 VanDerWaalsContact CD-CE1 3.49Å; E36-F49 HydrophobicContact CG-CD1 3.6Å; E36-F49 HydrophobicContact CG-CE1 3.6Å
37	T	95.2	Very high	93.4	Very high	77 Å²	77	97.2 Å²	97.2	47%	0.472	50%	0.504	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.3	130.1	171	-58.9	0	0	0	0	109.3	F39 M48	T37-F39 HydrophobicContact CG2-CD1 4.28Å; T37-M48 PolarHBondContact N-O 2.79Å; T37-M48 PolarHBondContact O-N 3.29Å
38	K	96.8	Very high	93.6	Very high	151 Å²	151	98 Å²	98	66%	0.657	50%	0.502	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-113.3	129.2	177.8	-66.5	176.6	-177.5	176.1	0	109.1	F46 H47	K38-F46 WeakPolarHBondContact CA-O 2.99Å; K38-H47 WeakPolarHBondContact CE-CE1 3.48Å; K38-H47 WeakPolarHBondContact CE-ND1 3.24Å; K38-H47 VanDerWaalsContact CE-NE2 3.32Å; K38-H47 WeakPolarHBondContact CE-NE2 3.49Å; K38-H47 HydrophobicContact CG-CB 4.3Å
39	F	97.4	Very high	93.8	Very high	83 Å²	83	93.8 Å²	93.8	36%	0.364	49%	0.488	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.9	163	179.4	62.4	-86.2	0	0	0	110.5	T37 V41 F46 M48	T37-F39 HydrophobicContact CG2-CD1 4.28Å; F39-V41 HydrophobicContact CD2-CG2 3.83Å; F39-V41 HydrophobicContact CE2-CG2 3.87Å; F39-F46 HydrophobicContact CD1-CB 4.11Å; F39-F46 HydrophobicContact CD2-CB 4.02Å; F39-F46 HydrophobicContact CD2-CD2 4.16Å; F39-F46 HydrophobicContact CD2-CG 4.36Å; F39-F46 HydrophobicContact CE1-CB 3.74Å; F39-F46 HydrophobicContact CE2-CB 3.63Å; F39-F46 AromaticContact CE2-CD2 3.75Å; F39-F46 HydrophobicContact CE2-CD2 3.75Å; F39-F46 AromaticContact CE2-CG 3.72Å; F39-F46 HydrophobicContact CE2-CG 3.72Å; F39-F46 HydrophobicContact CG-CB 4.25Å; F39-F46 HydrophobicContact CZ-CB 3.48Å; F39-F46 VanDerWaalsContact CZ-CB 3.48Å; F39-F46 HydrophobicContact CZ-CD1 4.44Å; F39-F46 HydrophobicContact CZ-CD2 4.37Å; F39-F46 AromaticContact CZ-CG 3.86Å; F39-F46 HydrophobicContact CZ-CG 3.86Å; F39-F46 PolarHBondContact N-O 3.05Å; F39-F46 PolarHBondContact O-N 2.81Å; F39-M48 HydrophobicContact CE1-CB 4.11Å
40	S	97.4	Very high	94	Very high	79 Å²	79	91.9 Å²	91.9	55%	0.552	47%	0.474	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-124.8	134.1	178.5	-52.9	0	0	0	0	109.9	V44 N45	S40-V44 CarbonylContact C-O 3.56Å; S40-V44 VanDerWaalsContact CA-O 3.24Å; S40-V44 WeakPolarHBondContact CA-O 3.35Å; S40-N45 PolarHBondContact OG-OD1 2.84Å
41	V	96.2	Very high	94.2	Very high	70 Å²	70	89.9 Å²	89.9	42%	0.424	47%	0.465	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.4	123.7	173.2	-174.8	0	0	0	0	107.1	F39 K43 V44 F46	F39-V41 HydrophobicContact CD2-CG2 3.83Å; F39-V41 HydrophobicContact CE2-CG2 3.87Å; V41-K43 PolarHBondContact O-N 3.36Å; V41-K43 VanDerWaalsContact O-N 3.13Å; V41-V44 PolarHBondContact N-O 2.84Å; V41-V44 WeakPolarHBondContact O-CA 3.3Å; V41-V44 WeakPolarHBondContact O-CB 3.38Å; V41-V44 PolarHBondContact O-N 3.16Å; V41-F46 HydrophobicContact CB-CD2 4.5Å; V41-F46 HydrophobicContact CB-CE2 4Å; V41-F46 HydrophobicContact CG2-CD2 4.32Å; V41-F46 HydrophobicContact CG2-CE2 4.2Å
42	D	96.2	Very high	94.3	Very high	153 Å²	153	88 Å²	88	82%	0.818	45%	0.454	S	S	*	.	T	Hydrogen-bonded Turn	trans	49.4	41.9	179.4	-59.2	-38.8	0	0	0	114.5	V44	D42-V44 PolarHBondContact O-N 3.19Å
43	K	94.1	Very high	94.2	Very high	201 Å²	201	86.4 Å²	86.4	87%	0.874	45%	0.45	S	S	*	.	T	Hydrogen-bonded Turn	trans	67.5	5.3	-176.3	-49.8	175.8	-178.5	175	0	115.3	V41	V41-K43 PolarHBondContact O-N 3.36Å; V41-K43 VanDerWaalsContact O-N 3.13Å
44	V	95.7	Very high	94.1	Very high	83 Å²	83	89.2 Å²	89.2	50%	0.503	46%	0.459	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89	125	169.2	-176.1	0	0	0	0	108.6	S40 V41 D42 F46	S40-V44 CarbonylContact C-O 3.56Å; S40-V44 VanDerWaalsContact CA-O 3.24Å; S40-V44 WeakPolarHBondContact CA-O 3.35Å; V41-V44 PolarHBondContact N-O 2.84Å; V41-V44 WeakPolarHBondContact O-CA 3.3Å; V41-V44 WeakPolarHBondContact O-CB 3.38Å; V41-V44 PolarHBondContact O-N 3.16Å; D42-V44 PolarHBondContact O-N 3.19Å; V44-F46 HydrophobicContact CB-CE2 3.84Å; V44-F46 HydrophobicContact CB-CZ 4.32Å; V44-F46 HydrophobicContact CG1-CD2 4.35Å; V44-F46 HydrophobicContact CG1-CE2 3.66Å; V44-F46 HydrophobicContact CG1-CZ 3.79Å; V44-F46 WeakPolarHBondContact O-CD2 3.39Å
45	N	95.6	Very high	94.1	Very high	127 Å²	127	91 Å²	91	68%	0.679	46%	0.463	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-89.3	130.4	179.3	-64.3	-35	0	0	0	110.4	S40	S40-N45 PolarHBondContact OG-OD1 2.84Å
46	F	95.4	Very high	93.9	Very high	94 Å²	94	93.4 Å²	93.4	41%	0.412	48%	0.476	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.5	135.3	176.3	-65.9	-93.1	0	0	0	109.6	K38 F39 V41 V44	K38-F46 WeakPolarHBondContact CA-O 2.99Å; F39-F46 HydrophobicContact CD1-CB 4.11Å; F39-F46 HydrophobicContact CD2-CB 4.02Å; F39-F46 HydrophobicContact CD2-CD2 4.16Å; F39-F46 HydrophobicContact CD2-CG 4.36Å; F39-F46 HydrophobicContact CE1-CB 3.74Å; F39-F46 HydrophobicContact CE2-CB 3.63Å; F39-F46 AromaticContact CE2-CD2 3.75Å; F39-F46 HydrophobicContact CE2-CD2 3.75Å; F39-F46 AromaticContact CE2-CG 3.72Å; F39-F46 HydrophobicContact CE2-CG 3.72Å; F39-F46 HydrophobicContact CG-CB 4.25Å; F39-F46 HydrophobicContact CZ-CB 3.48Å; F39-F46 VanDerWaalsContact CZ-CB 3.48Å; F39-F46 HydrophobicContact CZ-CD1 4.44Å; F39-F46 HydrophobicContact CZ-CD2 4.37Å; F39-F46 AromaticContact CZ-CG 3.86Å; F39-F46 HydrophobicContact CZ-CG 3.86Å; F39-F46 PolarHBondContact N-O 3.05Å; F39-F46 PolarHBondContact O-N 2.81Å; V41-F46 HydrophobicContact CB-CD2 4.5Å; V41-F46 HydrophobicContact CB-CE2 4Å; V41-F46 HydrophobicContact CG2-CD2 4.32Å; V41-F46 HydrophobicContact CG2-CE2 4.2Å; V44-F46 HydrophobicContact CB-CE2 3.84Å; V44-F46 HydrophobicContact CB-CZ 4.32Å; V44-F46 HydrophobicContact CG1-CD2 4.35Å; V44-F46 HydrophobicContact CG1-CE2 3.66Å; V44-F46 HydrophobicContact CG1-CZ 3.79Å; V44-F46 WeakPolarHBondContact O-CD2 3.39Å
47	H	94.2	Very high	93.8	Very high	83 Å²	83	89 Å²	89	38%	0.384	46%	0.455	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.5	101.3	170.9	-171.6	-180	0	0	0	107.1	E36 K38 F49	E36-H47 IonicContact OE2-CD2 2.85Å; E36-H47 IonicContact OE2-CE1 3.65Å; E36-H47 PolarHBondContact OE2-CE1 3.43Å; E36-H47 VanDerWaalsContact OE2-CE1 3.25Å; E36-H47 IonicContact OE2-NE2 2.9Å; E36-H47 PolarHBondContact OE2-NE2 2.89Å; K38-H47 WeakPolarHBondContact CE-CE1 3.48Å; K38-H47 WeakPolarHBondContact CE-ND1 3.24Å; K38-H47 VanDerWaalsContact CE-NE2 3.32Å; K38-H47 WeakPolarHBondContact CE-NE2 3.49Å; K38-H47 HydrophobicContact CG-CB 4.3Å; H47-F49 AromaticContact CD2-CE2 3.82Å; H47-F49 AromaticContact CD2-CZ 3.8Å; H47-F49 AromaticContact CE1-CE2 3.97Å; H47-F49 AromaticContact CE1-CZ 3.33Å; H47-F49 WeakPolarHBondContact CE1-CZ 3.34Å; H47-F49 AromaticContact CG-CE2 3.95Å; H47-F49 AromaticContact ND1-CZ 3.86Å; H47-F49 AromaticContact NE2-CE1 3.72Å; H47-F49 AromaticContact NE2-CE2 3.84Å; H47-F49 AromaticContact NE2-CZ 3.32Å; H47-F49 VanDerWaalsContact NE2-CZ 3.32Å; H47-F49 WeakPolarHBondContact NE2-CZ 3.36Å
48	M	93.6	Very high	93.6	Very high	89 Å²	89	88.2 Å²	88.2	44%	0.438	44%	0.443	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100	139.4	-175.2	-172.4	172.8	73.2	0	0	110.1	E36 T37 F39	E36-M48 CarbonylContact C-O 3.52Å; E36-M48 WeakPolarHBondContact CA-O 3.25Å; T37-M48 PolarHBondContact N-O 2.79Å; T37-M48 PolarHBondContact O-N 3.29Å; F39-M48 HydrophobicContact CE1-CB 4.11Å
49	F	92.6	Very high	93.3	Very high	75 Å²	75	91.6 Å²	91.6	33%	0.329	45%	0.452	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116	120.5	176.1	-60.5	-98.7	0	0	0	108.7	I34 F35 E36 H47	I34-F49 HydrophobicContact CG2-CD1 4.06Å; F35-F49 CarbonylContact O-C 3.52Å; F35-F49 WeakPolarHBondContact O-CA 3.49Å; E36-F49 VanDerWaalsContact CD-CE1 3.49Å; E36-F49 HydrophobicContact CG-CD1 3.6Å; E36-F49 HydrophobicContact CG-CE1 3.6Å; H47-F49 AromaticContact CD2-CE2 3.82Å; H47-F49 AromaticContact CD2-CZ 3.8Å; H47-F49 AromaticContact CE1-CE2 3.97Å; H47-F49 AromaticContact CE1-CZ 3.33Å; H47-F49 WeakPolarHBondContact CE1-CZ 3.34Å; H47-F49 AromaticContact CG-CE2 3.95Å; H47-F49 AromaticContact ND1-CZ 3.86Å; H47-F49 AromaticContact NE2-CE1 3.72Å; H47-F49 AromaticContact NE2-CE2 3.84Å; H47-F49 AromaticContact NE2-CZ 3.32Å; H47-F49 VanDerWaalsContact NE2-CZ 3.32Å; H47-F49 WeakPolarHBondContact NE2-CZ 3.36Å
50	D	93.4	Very high	92.9	Very high	77 Å²	77	90.7 Å²	90.7	41%	0.412	45%	0.448	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.4	126.3	167.9	179.2	38.5	0	0	0	109.1	T31 I34 F35	T31-D50 VanDerWaalsContact CG2-OD2 3.31Å; T31-D50 WeakPolarHBondContact CG2-OD2 3.39Å; T31-D50 PolarHBondContact OG1-OD2 3.13Å; I34-D50 WeakPolarHBondContact CA-O 3.33Å; F35-D50 HydrophobicContact CB-CB 4.36Å; F35-D50 PolarHBondContact N-O 2.85Å; F35-D50 PolarHBondContact O-N 2.94Å
51	V	92.5	Very high	92.6	Very high	41 Å²	41	88.2 Å²	88.2	25%	0.248	43%	0.427	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.9	136.5	-175.1	-61.2	0	0	0	0	110	I34 G53 W61 C64	I34-V51 HydrophobicContact CG1-CG1 4.16Å; I34-V51 HydrophobicContact CG2-CG1 4.37Å; V51-G53 PolarHBondContact O-N 3.06Å; V51-W61 HydrophobicContact CG2-CD2 4.47Å; V51-W61 HydrophobicContact CG2-CG 4.39Å; V51-W61 HydrophobicContact CG2-CZ2 4.38Å; V51-C64 HydrophobicContact CG1-CB 4.34Å
52	G	92.1	Very high	91.9	Very high	1 Å²	1	90.9 Å²	90.9	1%	0.01	44%	0.437	C	S	.	.			trans	-56.9	127.2	177.4	0	0	0	0	0	112.3	G33 E57 W61	G33-G52 PolarHBondContact O-N 2.69Å; G52-E57 VanDerWaalsContact O-CB 3.31Å; G52-E57 WeakPolarHBondContact O-CB 3.34Å; G52-W61 PolarHBondContact O-NE1 3.38Å
53	G	89.2	Confident	91.3	Very high	45 Å²	45	90.3 Å²	90.3	46%	0.464	43%	0.43	S	S	.	.			trans	-84.5	-12.4	-178.7	0	0	0	0	0	115.8	V51 R58	V51-G53 PolarHBondContact O-N 3.06Å; G53-R58 PolarHBondContact O-NE 2.95Å
54	Q	89.8	Confident	90.8	Very high	72 Å²	72	81.4 Å²	81.4	34%	0.336	39%	0.392	S	S	.	.	S	Bend	trans	-64.9	148.6	-180	-67.5	177.5	69.7	0	0	110.9	E56 E57 R58	Q54-E56 PolarHBondContact O-N 3.48Å; Q54-E56 VanDerWaalsContact O-N 3.12Å; Q54-E57 HydrophobicContact CB-CG 4.26Å; Q54-E57 WeakPolarHBondContact O-CB 3.28Å; Q54-E57 PolarHBondContact O-N 2.76Å; Q54-R58 WeakPolarHBondContact O-CG 3.33Å; Q54-R58 PolarHBondContact O-N 2.82Å
55	R	91.4	Very high	89.9	Confident	86 Å²	86	80.8 Å²	80.8	33%	0.325	38%	0.383	S	S	.	.	T	Hydrogen-bonded Turn	trans	-52.2	-39.3	-175.8	-75.1	-177.4	172.9	174.6	-1.8	113.6	E57 R58 D87 E95	R55-E57 VanDerWaalsContact C-N 3.3Å; R55-E57 PolarHBondContact O-N 3Å; R55-R58 PolarHBondContact O-N 2.96Å; R55-D87 IonicContact CZ-OD2 2.7Å; R55-D87 IonicContact NH1-OD2 3.96Å; R55-D87 PolarHBondContact NH1-OD2 3.5Å; R55-D87 IonicContact NH2-OD2 3.25Å; R55-E95 IonicContact CZ-OE1 2.71Å; R55-E95 IonicContact CZ-OE2 2.82Å; R55-E95 IonicContact NE-OE1 2.71Å; R55-E95 PolarHBondContact NE-OE1 2.74Å; R55-E95 IonicContact NE-OE2 2.76Å; R55-E95 IonicContact NH2-OE1 3.23Å; R55-E95 IonicContact NH2-OE2 3.72Å; R55-E95 PolarHBondContact NH2-OE2 3.31Å
56	E	89.9	Confident	89	Confident	162 Å²	162	80.6 Å²	80.6	76%	0.757	38%	0.382	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.8	-29.6	179	-64.3	178.6	176.9	0	0	113.4	Q54	Q54-E56 PolarHBondContact O-N 3.48Å; Q54-E56 VanDerWaalsContact O-N 3.12Å
57	E	92.1	Very high	88.1	Confident	21 Å²	21	83.2 Å²	83.2	10%	0.098	40%	0.4	C	S	.	.	T	Hydrogen-bonded Turn	trans	-82.9	-23.3	-176.6	-66	-62.6	123.6	0	0	112.7	G33 G52 Q54 R55 R59 K60	G33-E57 PolarHBondContact N-OE2 3.04Å; G52-E57 VanDerWaalsContact O-CB 3.31Å; G52-E57 WeakPolarHBondContact O-CB 3.34Å; Q54-E57 HydrophobicContact CB-CG 4.26Å; Q54-E57 WeakPolarHBondContact O-CB 3.28Å; Q54-E57 PolarHBondContact O-N 2.76Å; R55-E57 VanDerWaalsContact C-N 3.3Å; R55-E57 PolarHBondContact O-N 3Å; E57-R59 PolarHBondContact O-N 2.99Å; E57-K60 WeakPolarHBondContact O-CB 3.38Å; E57-K60 PolarHBondContact O-N 3.18Å; E57-K60 IonicContact OE1-NZ 2.87Å; E57-K60 PolarHBondContact OE1-NZ 2.94Å; E57-K60 WeakPolarHBondContact OE2-CD 3.33Å; E57-K60 WeakPolarHBondContact OE2-CE 3.32Å; E57-K60 IonicContact OE2-NZ 2.93Å; E57-K60 PolarHBondContact OE2-NZ 2.71Å
58	R	91.2	Very high	87.7	Confident	60 Å²	60	80.9 Å²	80.9	23%	0.226	39%	0.392	C	S	.	.	G	3₁₀ helix	trans	-59.8	-24.4	-175.3	-65.7	176.8	-165.5	168.9	5.1	114.2	G53 Q54 R55 K60 W61 E95	G53-R58 PolarHBondContact O-NE 2.95Å; Q54-R58 WeakPolarHBondContact O-CG 3.33Å; Q54-R58 PolarHBondContact O-N 2.82Å; R55-R58 PolarHBondContact O-N 2.96Å; R58-K60 PolarHBondContact O-N 3.27Å; R58-W61 HydrophobicContact CB-CD2 4.32Å; R58-W61 HydrophobicContact CG-CD2 4.33Å; R58-W61 HydrophobicContact CG-CH2 4.38Å; R58-W61 HydrophobicContact CG-CZ2 3.97Å; R58-W61 WeakPolarHBondContact O-CB 3.32Å; R58-W61 PolarHBondContact O-N 3.13Å; R58-E95 IonicContact CZ-OE1 3.53Å; R58-E95 VanDerWaalsContact CZ-OE1 3.23Å; R58-E95 IonicContact NH1-OE1 3.67Å; R58-E95 PolarHBondContact NH1-OE1 2.7Å; R58-E95 IonicContact NH2-OE1 3.65Å; R58-E95 PolarHBondContact NH2-OE1 2.9Å
59	R	89.3	Confident	87.4	Confident	221 Å²	221	82.6 Å²	82.6	83%	0.834	41%	0.408	S	S	*	.	G	3₁₀ helix	trans	-62.2	-25.7	175	-64.9	-178.7	-179	-179.9	1.4	112.6	E57	E57-R59 PolarHBondContact O-N 2.99Å
60	K	90	Very high	87.2	Confident	64 Å²	64	81 Å²	81	28%	0.278	41%	0.408	S	S	.	.	G	3₁₀ helix	trans	-79.4	-19.9	-179.3	-57.2	174.8	-171.1	165.2	0	112.2	I34 E57 R58 I62 Q63	I34-K60 HydrophobicContact CD1-CB 4.14Å; I34-K60 HydrophobicContact CG1-CB 4.35Å; E57-K60 WeakPolarHBondContact O-CB 3.38Å; E57-K60 PolarHBondContact O-N 3.18Å; E57-K60 IonicContact OE1-NZ 2.87Å; E57-K60 PolarHBondContact OE1-NZ 2.94Å; E57-K60 WeakPolarHBondContact OE2-CD 3.33Å; E57-K60 WeakPolarHBondContact OE2-CE 3.32Å; E57-K60 IonicContact OE2-NZ 2.93Å; E57-K60 PolarHBondContact OE2-NZ 2.71Å; R58-K60 PolarHBondContact O-N 3.27Å; K60-I62 PolarHBondContact O-N 2.59Å; K60-I62 VanDerWaalsContact O-N 3.13Å; K60-Q63 VanDerWaalsContact O-CB 3.28Å; K60-Q63 WeakPolarHBondContact O-CB 3.28Å; K60-Q63 WeakPolarHBondContact O-CG 3.45Å; K60-Q63 PolarHBondContact O-N 3.36Å
61	W	89.4	Confident	87	Confident	28 Å²	28	78.3 Å²	78.3	11%	0.106	39%	0.393	C	S	.	.	G	3₁₀ helix	trans	-58.6	-31.5	-173.9	-67.5	7.9	0	0	0	113.9	V51 G52 R58 Q63 C64 F65 L99 I103	V51-W61 HydrophobicContact CG2-CD2 4.47Å; V51-W61 HydrophobicContact CG2-CG 4.39Å; V51-W61 HydrophobicContact CG2-CZ2 4.38Å; G52-W61 PolarHBondContact O-NE1 3.38Å; R58-W61 HydrophobicContact CB-CD2 4.32Å; R58-W61 HydrophobicContact CG-CD2 4.33Å; R58-W61 HydrophobicContact CG-CH2 4.38Å; R58-W61 HydrophobicContact CG-CZ2 3.97Å; R58-W61 WeakPolarHBondContact O-CB 3.32Å; R58-W61 PolarHBondContact O-N 3.13Å; W61-Q63 PolarHBondContact O-N 3.13Å; W61-Q63 VanDerWaalsContact O-N 3.13Å; W61-C64 PolarHBondContact O-N 3.35Å; W61-F65 HydrophobicContact CB-CD2 4.34Å; W61-F65 HydrophobicContact CB-CE2 3.61Å; W61-F65 HydrophobicContact CB-CZ 3.86Å; W61-F65 HydrophobicContact CD2-CZ 4.38Å; W61-F65 HydrophobicContact CE3-CE2 4.25Å; W61-F65 AromaticContact CE3-CZ 3.81Å; W61-F65 HydrophobicContact CE3-CZ 3.81Å; W61-F65 HydrophobicContact CG-CZ 4.49Å; W61-F65 WeakPolarHBondContact O-CD2 3.5Å; W61-F65 PolarHBondContact O-N 2.93Å; W61-L99 HydrophobicContact CH2-CD1 3.96Å; W61-L99 HydrophobicContact CH2-CD2 3.72Å; W61-L99 HydrophobicContact CH2-CG 4.07Å; W61-L99 HydrophobicContact CZ3-CD1 3.8Å; W61-L99 HydrophobicContact CZ3-CD2 4.38Å; W61-L99 HydrophobicContact CZ3-CG 4.24Å; W61-I103 HydrophobicContact CH2-CD1 4.21Å; W61-I103 HydrophobicContact CZ3-CD1 3.67Å; W61-I103 HydrophobicContact CZ3-CG1 3.91Å
62	I	83.1	Confident	86.9	Confident	126 Å²	126	81.8 Å²	81.8	65%	0.646	41%	0.409	S	S	*	.	G	3₁₀ helix	trans	-58.9	-25.4	177	-165.8	159.7	0	0	0	113	K60 C64	K60-I62 PolarHBondContact O-N 2.59Å; K60-I62 VanDerWaalsContact O-N 3.13Å; I62-C64 PolarHBondContact O-N 3.14Å
63	Q	83.3	Confident	86.9	Confident	141 Å²	141	82.5 Å²	82.5	66%	0.659	41%	0.412	S	S	*	.	G	3₁₀ helix	trans	-70.9	-20.3	176.9	-56.8	176.1	10.2	0	0	112.2	I34 K60 W61	I34-Q63 HydrophobicContact CD1-CB 3.86Å; K60-Q63 VanDerWaalsContact O-CB 3.28Å; K60-Q63 WeakPolarHBondContact O-CB 3.28Å; K60-Q63 WeakPolarHBondContact O-CG 3.45Å; K60-Q63 PolarHBondContact O-N 3.36Å; W61-Q63 PolarHBondContact O-N 3.13Å; W61-Q63 VanDerWaalsContact O-N 3.13Å
64	C	83.3	Confident	87.1	Confident	14 Å²	14	84 Å²	84	10%	0.095	41%	0.412	C	S	.	.	T	Hydrogen-bonded Turn	trans	-104.2	-11	-177.1	-56.9	0	0	0	0	113.6	I34 V51 W61 I62 V68	I34-C64 WeakPolarHBondContact CD1-SG 3.38Å; I34-C64 WeakPolarHBondContact CG2-SG 3.41Å; V51-C64 HydrophobicContact CG1-CB 4.34Å; W61-C64 PolarHBondContact O-N 3.35Å; I62-C64 PolarHBondContact O-N 3.14Å; C64-V68 WeakPolarHBondContact O-CG1 3.46Å
65	F	77.2	Confident	87.2	Confident	70 Å²	70	81.2 Å²	81.2	31%	0.307	40%	0.402	S	S	.	.			trans	-84.2	-8.8	-171.6	-73.5	-39.5	0	0	0	115.2	W61 I71	W61-F65 HydrophobicContact CB-CD2 4.34Å; W61-F65 HydrophobicContact CB-CE2 3.61Å; W61-F65 HydrophobicContact CB-CZ 3.86Å; W61-F65 HydrophobicContact CD2-CZ 4.38Å; W61-F65 HydrophobicContact CE3-CE2 4.25Å; W61-F65 AromaticContact CE3-CZ 3.81Å; W61-F65 HydrophobicContact CE3-CZ 3.81Å; W61-F65 HydrophobicContact CG-CZ 4.49Å; W61-F65 WeakPolarHBondContact O-CD2 3.5Å; W61-F65 PolarHBondContact O-N 2.93Å; F65-I71 HydrophobicContact CD1-CD1 3.8Å; F65-I71 HydrophobicContact CE1-CD1 3.58Å
66	N	75.3	Confident	87.1	Confident	122 Å²	122	79.2 Å²	79.2	65%	0.652	40%	0.403	S	S	*	.	T	Hydrogen-bonded Turn	trans	-75.2	130.1	175.6	-68.2	-19.4	0	0	0	110.1	V68	N66-V68 VanDerWaalsContact C-N 3.31Å; N66-V68 PolarHBondContact O-N 3.14Å
67	D	77.4	Confident	87.1	Confident	149 Å²	149	74 Å²	74	80%	0.797	38%	0.384	S	S	*	.	T	Hydrogen-bonded Turn	trans	58.1	33.3	173.1	-56.4	-37.5	0	0	0	115.6
68	V	85.3	Confident	87.1	Confident	35 Å²	35	74.4 Å²	74.4	21%	0.212	39%	0.389	C	S	.	.			trans	-79	130.3	173.3	-65.3	0	0	0	0	112.1	C64 N66 I71 P116	C64-V68 WeakPolarHBondContact O-CG1 3.46Å; N66-V68 VanDerWaalsContact C-N 3.31Å; N66-V68 PolarHBondContact O-N 3.14Å; V68-I71 HydrophobicContact CG2-CD1 4.34Å; V68-I71 HydrophobicContact CG2-CG1 4.12Å; V68-P116 HydrophobicContact CG2-CB 4.46Å
69	T	88.3	Confident	87.1	Confident	125 Å²	125	71.9 Å²	71.9	77%	0.767	38%	0.381	S	S	*	.	S	Bend	trans	-71.6	-37.7	174.9	-49.8	0	0	0	0	112.4	P116 V117	T69-P116 WeakPolarHBondContact O-CA 3.47Å; T69-V117 PolarHBondContact O-N 3.43Å
70	A	88.6	Confident	87.3	Confident	40 Å²	40	69 Å²	69	33%	0.331	37%	0.371	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-152.1	156.8	-177.7	0	0	0	0	0	110.3	V117 F119	A70-V117 CarbonylContact C-O 3.55Å; A70-V117 VanDerWaalsContact CA-O 3.24Å; A70-V117 WeakPolarHBondContact CA-O 3.25Å; A70-V117 HydrophobicContact CB-CB 4.35Å; A70-V117 WeakPolarHBondContact CB-O 3.4Å; A70-F119 HydrophobicContact CB-CD2 4.31Å; A70-F119 HydrophobicContact CB-CE2 4.08Å
71	I	88.4	Confident	87.4	Confident	22 Å²	22	71.6 Å²	71.6	11%	0.113	39%	0.388	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.1	131	169.4	-65	-174.8	0	0	0	108.4	F65 V68 I103 V117 L118 F119	F65-I71 HydrophobicContact CD1-CD1 3.8Å; F65-I71 HydrophobicContact CE1-CD1 3.58Å; V68-I71 HydrophobicContact CG2-CD1 4.34Å; V68-I71 HydrophobicContact CG2-CG1 4.12Å; I71-I103 HydrophobicContact CD1-CG2 4.41Å; I71-V117 PolarHBondContact N-O 3.01Å; I71-L118 HydrophobicContact CG2-CD1 4.38Å; I71-L118 WeakPolarHBondContact O-CA 3.49Å; I71-F119 PolarHBondContact O-N 2.87Å
72	I	91.3	Very high	87.7	Confident	114 Å²	114	73.7 Å²	73.7	59%	0.585	40%	0.4	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-100.6	107.5	172.2	-57.2	172	0	0	0	106.8	V74 F119	I72-V74 HydrophobicContact CG2-CG2 4.1Å; I72-F119 HydrophobicContact CG1-CB 4.41Å
73	F	91.7	Very high	88.3	Confident	15 Å²	15	71 Å²	71	7%	0.066	39%	0.389	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.5	123.7	175.3	-174.5	-94.1	0	0	0	109.5	A75 S96 L99 L100 I103 L118 F119 I120 G121	F73-A75 HydrophobicContact CD1-CB 4.48Å; F73-A75 HydrophobicContact CE1-CB 4.11Å; F73-S96 WeakPolarHBondContact CE1-OG 3.27Å; F73-S96 VanDerWaalsContact CZ-O 3.3Å; F73-S96 WeakPolarHBondContact CZ-O 3.29Å; F73-L99 HydrophobicContact CE2-CB 4.5Å; F73-L99 HydrophobicContact CE2-CD2 4.13Å; F73-L99 HydrophobicContact CE2-CG 4.06Å; F73-L99 HydrophobicContact CZ-CB 4.44Å; F73-L99 HydrophobicContact CZ-CD2 4.44Å; F73-L99 HydrophobicContact CZ-CG 4.45Å; F73-L100 HydrophobicContact CB-CD1 4.15Å; F73-L100 HydrophobicContact CD1-CB 4.42Å; F73-L100 HydrophobicContact CD1-CD1 3.79Å; F73-L100 HydrophobicContact CD1-CD2 4.48Å; F73-L100 HydrophobicContact CD1-CG 4.46Å; F73-L100 HydrophobicContact CD2-CD1 4.1Å; F73-L100 HydrophobicContact CE1-CB 3.93Å; F73-L100 HydrophobicContact CE1-CD1 4.16Å; F73-L100 HydrophobicContact CE1-CD2 4.48Å; F73-L100 HydrophobicContact CE1-CG 4.43Å; F73-L100 HydrophobicContact CE2-CB 4.35Å; F73-L100 HydrophobicContact CE2-CD1 4.46Å; F73-L100 HydrophobicContact CG-CD1 3.74Å; F73-L100 HydrophobicContact CZ-CB 3.89Å; F73-L100 HydrophobicContact CZ-CD1 4.48Å; F73-I103 HydrophobicContact CD2-CD1 3.51Å; F73-I103 HydrophobicContact CE2-CD1 3.58Å; F73-L118 HydrophobicContact CB-CD1 3.8Å; F73-F119 PolarHBondContact N-O 3.3Å; F73-I120 CarbonylContact O-C 3.55Å; F73-I120 WeakPolarHBondContact O-CA 3.29Å; F73-G121 PolarHBondContact O-N 2.83Å
74	V	92.3	Very high	88.8	Confident	78 Å²	78	65.2 Å²	65.2	47%	0.473	36%	0.363	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.3	124.7	-176.9	-174.6	0	0	0	0	110.2	I72 G121 L123	I72-V74 HydrophobicContact CG2-CG2 4.1Å; V74-G121 CarbonylContact C-O 3.57Å; V74-G121 WeakPolarHBondContact CA-O 3.37Å; V74-L123 HydrophobicContact CG1-CD1 3.4Å; V74-L123 HydrophobicContact CG1-CD2 4.32Å; V74-L123 HydrophobicContact CG1-CG 3.46Å; V74-L123 VanDerWaalsContact CG1-CG 3.46Å
75	A	91.9	Very high	89.1	Confident	13 Å²	13	74.9 Å²	74.9	11%	0.107	40%	0.397	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121	127	-178.5	0	0	0	0	0	111.3	F73 C77 S96 G121 L123	F73-A75 HydrophobicContact CD1-CB 4.48Å; F73-A75 HydrophobicContact CE1-CB 4.11Å; A75-C77 PolarHBondContact O-N 3.12Å; A75-S96 WeakPolarHBondContact CB-OG 3.32Å; A75-G121 PolarHBondContact N-O 3.41Å; A75-L123 PolarHBondContact O-N 3.02Å
76	A	91	Very high	89.7	Confident	43 Å²	43	75.9 Å²	75.9	36%	0.355	40%	0.403	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.4	85	175.7	0	0	0	0	0	111.1	S78 S79 L123	A76-S78 VanDerWaalsContact C-N 3.28Å; A76-S78 PolarHBondContact O-N 3.07Å; A76-S79 WeakPolarHBondContact O-CB 3.21Å; A76-S79 PolarHBondContact O-N 2.86Å; A76-S79 VanDerWaalsContact O-N 3.14Å; A76-L123 CarbonylContact C-O 3.51Å; A76-L123 WeakPolarHBondContact CA-O 3.46Å; A76-L123 HydrophobicContact CB-CB 4.5Å
77	C	89.5	Confident	90.5	Very high	52 Å²	52	71.9 Å²	71.9	35%	0.351	38%	0.381	S	S	.	.	G	3₁₀ helix	trans	-66.6	-27.7	-176.3	-69.5	0	0	0	0	113.4	A75 S79 Y80 I122 L123	A75-C77 PolarHBondContact O-N 3.12Å; C77-S79 PolarHBondContact O-N 2.6Å; C77-S79 VanDerWaalsContact O-N 3.16Å; C77-Y80 PolarHBondContact O-N 2.76Å; C77-I122 HydrophobicContact CB-CG2 3.82Å; C77-I122 VanDerWaalsContact SG-CG2 3.57Å; C77-L123 PolarHBondContact N-O 3.04Å
78	S	91	Very high	91.3	Very high	31 Å²	31	69.5 Å²	69.5	22%	0.217	37%	0.374	C	S	.	.	G	3₁₀ helix	trans	-63.3	-17.6	174.6	55.5	0	0	0	0	113.3	A76 Y80 D125	A76-S78 VanDerWaalsContact C-N 3.28Å; A76-S78 PolarHBondContact O-N 3.07Å; S78-Y80 PolarHBondContact O-N 2.92Å; S78-D125 VanDerWaalsContact CB-OD2 3.28Å; S78-D125 WeakPolarHBondContact CB-OD2 3.29Å; S78-D125 VanDerWaalsContact OG-CG 3.27Å; S78-D125 PolarHBondContact OG-N 3.09Å; S78-D125 VanDerWaalsContact OG-N 3.14Å; S78-D125 PolarHBondContact OG-OD2 3.05Å
79	S	91.2	Very high	91.8	Very high	6 Å²	6	72.8 Å²	72.8	4%	0.042	40%	0.399	C	S	.	.	G	3₁₀ helix	trans	-83.7	18.1	179.1	-68.5	0	0	0	0	114.3	A76 C77 N81 M82	A76-S79 WeakPolarHBondContact O-CB 3.21Å; A76-S79 PolarHBondContact O-N 2.86Å; A76-S79 VanDerWaalsContact O-N 3.14Å; C77-S79 PolarHBondContact O-N 2.6Å; C77-S79 VanDerWaalsContact O-N 3.16Å; S79-N81 PolarHBondContact O-N 2.82Å; S79-M82 WeakPolarHBondContact O-CB 3.45Å; S79-M82 PolarHBondContact O-N 3.21Å; S79-M82 PolarHBondContact OG-SD 3.43Å
80	Y	93	Very high	92.2	Very high	162 Å²	162	67.9 Å²	67.9	64%	0.635	37%	0.367	S	S	*	.	G	3₁₀ helix	trans	-61	-24.9	-176.8	71.3	-88.9	0	0	0	114	C77 S78 N91	C77-Y80 PolarHBondContact O-N 2.76Å; S78-Y80 PolarHBondContact O-N 2.92Å; Y80-N91 PolarHBondContact O-ND2 3.5Å
81	N	94	Very high	92.5	Very high	118 Å²	118	68.3 Å²	68.3	63%	0.631	36%	0.363	S	S	*	.	G	3₁₀ helix	trans	-102	13.5	176.3	66.8	-18.8	0	0	0	113	S79	S79-N81 PolarHBondContact O-N 2.82Å
82	M	94.7	Very high	92.8	Very high	72 Å²	72	70.2 Å²	70.2	36%	0.355	37%	0.369	S	S	.	.			trans	-112.7	155.2	-178.1	-57.5	-177.7	79.4	0	0	111.8	S79 N91 R92	S79-M82 WeakPolarHBondContact O-CB 3.45Å; S79-M82 PolarHBondContact O-N 3.21Å; S79-M82 PolarHBondContact OG-SD 3.43Å; M82-N91 PolarHBondContact O-ND2 3.3Å; M82-R92 HydrophobicContact CB-CG 4.13Å; M82-R92 PolarHBondContact O-N 2.85Å
83	V	95.7	Very high	93	Very high	70 Å²	70	66.6 Å²	66.6	42%	0.424	35%	0.353	S	S	.	.	B	Isolated β-bridge	trans	-106.2	160.6	173.3	-60.9	0	0	0	0	111.6	P88 Q90 R92	V83-P88 WeakPolarHBondContact CG1-O 3.31Å; V83-P88 HydrophobicContact CG2-CB 4.43Å; V83-Q90 CarbonylContact C-O 3.58Å; V83-Q90 WeakPolarHBondContact CA-O 3.28Å; V83-Q90 WeakPolarHBondContact CB-O 3.36Å; V83-R92 WeakPolarHBondContact O-CG 3.49Å; V83-R92 PolarHBondContact O-NE 3.5Å; V83-R92 PolarHBondContact O-NH2 3.07Å
84	L	92.8	Very high	93.2	Very high	19 Å²	19	71 Å²	71	10%	0.099	37%	0.372	C	S	.	.			trans	-62.6	154.1	174	-64.6	176.6	0	0	0	110.8	E86 D87 Q90 R92 E95	L84-E86 HydrophobicContact CB-CG 4.38Å; L84-D87 HydrophobicContact CB-CB 4.3Å; L84-D87 WeakPolarHBondContact CB-O 3.44Å; L84-D87 HydrophobicContact CD1-CB 4.39Å; L84-D87 CarbonylContact O-C 3.34Å; L84-Q90 HydrophobicContact CD1-CB 3.89Å; L84-Q90 HydrophobicContact CD1-CG 3.67Å; L84-Q90 HydrophobicContact CG-CB 4.3Å; L84-Q90 HydrophobicContact CG-CG 4.24Å; L84-Q90 PolarHBondContact N-O 2.97Å; L84-R92 HydrophobicContact CD2-CG 4.08Å; L84-E95 HydrophobicContact CD1-CB 4.02Å; L84-E95 HydrophobicContact CD1-CG 3.73Å; L84-E95 HydrophobicContact CD2-CB 4.2Å; L84-E95 HydrophobicContact CD2-CG 4.05Å; L84-E95 HydrophobicContact CG-CB 4.37Å; L84-E95 HydrophobicContact CG-CG 4.39Å
85	R	89.7	Confident	93.3	Very high	216 Å²	216	67.9 Å²	67.9	82%	0.815	35%	0.352	S	S	*	.	S	Bend	trans	-75.8	-39	178.2	-179.1	178.7	176.2	164.1	-0.7	110.5
86	E	90.5	Very high	93.4	Very high	92 Å²	92	68.2 Å²	68.2	43%	0.43	35%	0.353	S	S	.	.	S	Bend	trans	-79.1	-16.9	179.3	62.3	-92.6	-133.3	0	0	113.5	L84	L84-E86 HydrophobicContact CB-CG 4.38Å
87	D	92.9	Very high	93.5	Very high	38 Å²	38	71.3 Å²	71.3	20%	0.203	36%	0.363	C	S	.	.			trans	-150	92.6	-176.6	-176	-5.3	0	0	0	110.9	R55 L84 S89 Q90	R55-D87 IonicContact CZ-OD2 2.7Å; R55-D87 IonicContact NH1-OD2 3.96Å; R55-D87 PolarHBondContact NH1-OD2 3.5Å; R55-D87 IonicContact NH2-OD2 3.25Å; L84-D87 HydrophobicContact CB-CB 4.3Å; L84-D87 WeakPolarHBondContact CB-O 3.44Å; L84-D87 HydrophobicContact CD1-CB 4.39Å; L84-D87 CarbonylContact O-C 3.34Å; D87-S89 PolarHBondContact O-N 2.86Å; D87-S89 VanDerWaalsContact O-N 3.07Å; D87-S89 WeakPolarHBondContact OD1-CB 3.38Å; D87-S89 PolarHBondContact OD1-N 3.33Å; D87-S89 VanDerWaalsContact OD1-N 3.09Å; D87-S89 PolarHBondContact OD1-OG 2.92Å; D87-Q90 HydrophobicContact CB-CB 4.31Å; D87-Q90 PolarHBondContact O-N 3.2Å; D87-Q90 VanDerWaalsContact O-N 3.12Å
88	P	94.2	Very high	93.7	Very high	99 Å²	99	73.1 Å²	73.1	64%	0.643	37%	0.366	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64.5	-10.6	-179	-23.1	34.4	0	0	0	114.6	V83	V83-P88 WeakPolarHBondContact CG1-O 3.31Å; V83-P88 HydrophobicContact CG2-CB 4.43Å
89	S	95.7	Very high	93.8	Very high	104 Å²	104	72.7 Å²	72.7	73%	0.727	36%	0.362	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.5	-15.7	177.2	76.8	0	0	0	0	113	D87	D87-S89 PolarHBondContact O-N 2.86Å; D87-S89 VanDerWaalsContact O-N 3.07Å; D87-S89 WeakPolarHBondContact OD1-CB 3.38Å; D87-S89 PolarHBondContact OD1-N 3.33Å; D87-S89 VanDerWaalsContact OD1-N 3.09Å; D87-S89 PolarHBondContact OD1-OG 2.92Å
90	Q	95.7	Very high	93.8	Very high	22 Å²	22	73.9 Å²	73.9	10%	0.103	37%	0.368	C	S	.	.	S	Bend	trans	-106.6	125.8	-172.2	-177	72.5	-24.7	0	0	112	V83 L84 D87 E95 E98	V83-Q90 CarbonylContact C-O 3.58Å; V83-Q90 WeakPolarHBondContact CA-O 3.28Å; V83-Q90 WeakPolarHBondContact CB-O 3.36Å; L84-Q90 HydrophobicContact CD1-CB 3.89Å; L84-Q90 HydrophobicContact CD1-CG 3.67Å; L84-Q90 HydrophobicContact CG-CB 4.3Å; L84-Q90 HydrophobicContact CG-CG 4.24Å; L84-Q90 PolarHBondContact N-O 2.97Å; D87-Q90 HydrophobicContact CB-CB 4.31Å; D87-Q90 PolarHBondContact O-N 3.2Å; D87-Q90 VanDerWaalsContact O-N 3.12Å; Q90-E95 HydrophobicContact CG-CB 4.01Å; Q90-E95 PolarHBondContact NE2-OE2 3.25Å; Q90-E98 PolarHBondContact NE2-OE2 3.04Å
91	N	96.2	Very high	93.7	Very high	48 Å²	48	68.3 Å²	68.3	26%	0.257	36%	0.355	S	S	.	.	B	Isolated β-bridge	trans	-70	139	173.8	176.5	-90.7	0	0	0	111.6	Y80 M82 V93 K94 E95	Y80-N91 PolarHBondContact O-ND2 3.5Å; M82-N91 PolarHBondContact O-ND2 3.3Å; N91-V93 PolarHBondContact O-N 2.94Å; N91-V93 PolarHBondContact OD1-N 3.02Å; N91-K94 HydrophobicContact CB-CB 3.9Å; N91-K94 PolarHBondContact O-N 3.25Å; N91-K94 PolarHBondContact OD1-N 3.18Å; N91-E95 WeakPolarHBondContact O-CB 3.48Å; N91-E95 PolarHBondContact O-N 3.27Å
92	R	94.7	Very high	93.5	Very high	62 Å²	62	65.5 Å²	65.5	23%	0.234	35%	0.345	C	S	.	.	H	α-helix	trans	-65.2	-40.7	-176.2	-66.3	-163.1	177.4	172	2	114.2	M82 V83 L84 S96	M82-R92 HydrophobicContact CB-CG 4.13Å; M82-R92 PolarHBondContact O-N 2.85Å; V83-R92 WeakPolarHBondContact O-CG 3.49Å; V83-R92 PolarHBondContact O-NE 3.5Å; V83-R92 PolarHBondContact O-NH2 3.07Å; L84-R92 HydrophobicContact CD2-CG 4.08Å; R92-S96 WeakPolarHBondContact O-CB 3.45Å; R92-S96 PolarHBondContact O-N 3.28Å
93	V	94.3	Very high	93.1	Very high	39 Å²	39	62.7 Å²	62.7	24%	0.236	33%	0.331	C	S	.	.	H	α-helix	trans	-71.3	-40.8	179.3	173.3	0	0	0	0	110	N91 E95 S96 L97	N91-V93 PolarHBondContact O-N 2.94Å; N91-V93 PolarHBondContact OD1-N 3.02Å; V93-E95 PolarHBondContact O-N 2.8Å; V93-S96 WeakPolarHBondContact O-CB 3.44Å; V93-S96 PolarHBondContact O-N 2.71Å; V93-S96 VanDerWaalsContact O-N 3.15Å; V93-L97 HydrophobicContact CG1-CD1 4.29Å; V93-L97 WeakPolarHBondContact O-CG 3.3Å; V93-L97 PolarHBondContact O-N 3.32Å
94	K	95.4	Very high	92.5	Very high	108 Å²	108	65.4 Å²	65.4	47%	0.47	33%	0.334	S	S	.	.	H	α-helix	trans	-58.1	-48.4	173.8	-169.4	-175	-178	-158.9	0	111.9	N91 S96 L97 E98	N91-K94 HydrophobicContact CB-CB 3.9Å; N91-K94 PolarHBondContact O-N 3.25Å; N91-K94 PolarHBondContact OD1-N 3.18Å; K94-S96 VanDerWaalsContact C-N 3.29Å; K94-S96 PolarHBondContact O-N 3.46Å; K94-L97 PolarHBondContact O-N 3.24Å; K94-E98 WeakPolarHBondContact CE-OE1 3.47Å; K94-E98 IonicContact NZ-OE1 3.82Å; K94-E98 WeakPolarHBondContact O-CG 3.45Å; K94-E98 PolarHBondContact O-N 3.12Å
95	E	94.9	Very high	92	Very high	12 Å²	12	69.5 Å²	69.5	6%	0.056	36%	0.355	C	S	.	.	H	α-helix	trans	-56.2	-43.8	173.9	178.4	74.4	177.1	0	0	111.7	R55 R58 L84 Q90 N91 V93 L97 E98 L99	R55-E95 IonicContact CZ-OE1 2.71Å; R55-E95 IonicContact CZ-OE2 2.82Å; R55-E95 IonicContact NE-OE1 2.71Å; R55-E95 PolarHBondContact NE-OE1 2.74Å; R55-E95 IonicContact NE-OE2 2.76Å; R55-E95 IonicContact NH2-OE1 3.23Å; R55-E95 IonicContact NH2-OE2 3.72Å; R55-E95 PolarHBondContact NH2-OE2 3.31Å; R58-E95 IonicContact CZ-OE1 3.53Å; R58-E95 VanDerWaalsContact CZ-OE1 3.23Å; R58-E95 IonicContact NH1-OE1 3.67Å; R58-E95 PolarHBondContact NH1-OE1 2.7Å; R58-E95 IonicContact NH2-OE1 3.65Å; R58-E95 PolarHBondContact NH2-OE1 2.9Å; L84-E95 HydrophobicContact CD1-CB 4.02Å; L84-E95 HydrophobicContact CD1-CG 3.73Å; L84-E95 HydrophobicContact CD2-CB 4.2Å; L84-E95 HydrophobicContact CD2-CG 4.05Å; L84-E95 HydrophobicContact CG-CB 4.37Å; L84-E95 HydrophobicContact CG-CG 4.39Å; Q90-E95 HydrophobicContact CG-CB 4.01Å; Q90-E95 PolarHBondContact NE2-OE2 3.25Å; N91-E95 WeakPolarHBondContact O-CB 3.48Å; N91-E95 PolarHBondContact O-N 3.27Å; V93-E95 PolarHBondContact O-N 2.8Å; E95-L97 VanDerWaalsContact C-N 3.35Å; E95-L97 PolarHBondContact O-N 3.16Å; E95-E98 PolarHBondContact O-N 3.45Å; E95-L99 VanDerWaalsContact O-CB 3.25Å; E95-L99 WeakPolarHBondContact O-CB 3.29Å; E95-L99 PolarHBondContact O-N 3.19Å
96	S	94.2	Very high	91.4	Very high	19 Å²	19	64 Å²	64	13%	0.133	34%	0.342	C	S	.	.	H	α-helix	trans	-63.1	-40.7	179.6	-173.2	0	0	0	0	111.9	F73 A75 R92 V93 K94 L99 L100	F73-S96 WeakPolarHBondContact CE1-OG 3.27Å; F73-S96 VanDerWaalsContact CZ-O 3.3Å; F73-S96 WeakPolarHBondContact CZ-O 3.29Å; A75-S96 WeakPolarHBondContact CB-OG 3.32Å; R92-S96 WeakPolarHBondContact O-CB 3.45Å; R92-S96 PolarHBondContact O-N 3.28Å; V93-S96 WeakPolarHBondContact O-CB 3.44Å; V93-S96 PolarHBondContact O-N 2.71Å; V93-S96 VanDerWaalsContact O-N 3.15Å; K94-S96 VanDerWaalsContact C-N 3.29Å; K94-S96 PolarHBondContact O-N 3.46Å; S96-L99 PolarHBondContact O-N 2.79Å; S96-L100 WeakPolarHBondContact O-CB 3.25Å; S96-L100 PolarHBondContact O-N 3.04Å
97	L	93.1	Very high	90.1	Very high	108 Å²	108	61.6 Å²	61.6	57%	0.565	33%	0.329	S	S	*	.	H	α-helix	trans	-67.3	-43.4	175.6	-68.6	172.2	0	0	0	112.4	V93 K94 E95 L99 L100 A101	V93-L97 HydrophobicContact CG1-CD1 4.29Å; V93-L97 WeakPolarHBondContact O-CG 3.3Å; V93-L97 PolarHBondContact O-N 3.32Å; K94-L97 PolarHBondContact O-N 3.24Å; E95-L97 VanDerWaalsContact C-N 3.35Å; E95-L97 PolarHBondContact O-N 3.16Å; L97-L99 VanDerWaalsContact C-N 3.33Å; L97-L99 PolarHBondContact O-N 3.47Å; L97-L100 PolarHBondContact O-N 3.3Å; L97-A101 WeakPolarHBondContact O-CB 3.08Å; L97-A101 PolarHBondContact O-N 2.99Å
98	E	94	Very high	88.2	Confident	90 Å²	90	66.3 Å²	66.3	42%	0.421	35%	0.348	S	S	.	.	H	α-helix	trans	-61.8	-42.4	175.5	-72.6	171.9	-176.2	0	0	111.1	Q90 K94 E95 A101 S102	Q90-E98 PolarHBondContact NE2-OE2 3.04Å; K94-E98 WeakPolarHBondContact CE-OE1 3.47Å; K94-E98 IonicContact NZ-OE1 3.82Å; K94-E98 WeakPolarHBondContact O-CG 3.45Å; K94-E98 PolarHBondContact O-N 3.12Å; E95-E98 PolarHBondContact O-N 3.45Å; E98-A101 PolarHBondContact O-N 3.3Å; E98-S102 PolarHBondContact O-N 3Å
99	L	93	Very high	86	Confident	22 Å²	22	67.1 Å²	67.1	12%	0.115	35%	0.351	C	S	.	.	H	α-helix	trans	-64.4	-45.3	176.1	-175.3	59.4	0	0	0	111.5	W61 F73 E95 S96 L97 A101 S102 I103	W61-L99 HydrophobicContact CH2-CD1 3.96Å; W61-L99 HydrophobicContact CH2-CD2 3.72Å; W61-L99 HydrophobicContact CH2-CG 4.07Å; W61-L99 HydrophobicContact CZ3-CD1 3.8Å; W61-L99 HydrophobicContact CZ3-CD2 4.38Å; W61-L99 HydrophobicContact CZ3-CG 4.24Å; F73-L99 HydrophobicContact CE2-CB 4.5Å; F73-L99 HydrophobicContact CE2-CD2 4.13Å; F73-L99 HydrophobicContact CE2-CG 4.06Å; F73-L99 HydrophobicContact CZ-CB 4.44Å; F73-L99 HydrophobicContact CZ-CD2 4.44Å; F73-L99 HydrophobicContact CZ-CG 4.45Å; E95-L99 VanDerWaalsContact O-CB 3.25Å; E95-L99 WeakPolarHBondContact O-CB 3.29Å; E95-L99 PolarHBondContact O-N 3.19Å; S96-L99 PolarHBondContact O-N 2.79Å; L97-L99 VanDerWaalsContact C-N 3.33Å; L97-L99 PolarHBondContact O-N 3.47Å; L99-A101 VanDerWaalsContact C-N 3.33Å; L99-A101 PolarHBondContact O-N 3.32Å; L99-S102 PolarHBondContact O-N 2.85Å; L99-S102 VanDerWaalsContact O-N 3.12Å; L99-S102 PolarHBondContact O-OG 2.87Å; L99-I103 HydrophobicContact CG-CD1 4.3Å; L99-I103 WeakPolarHBondContact O-CG1 3.31Å; L99-I103 PolarHBondContact O-N 3.02Å
100	L	91.5	Very high	83.8	Confident	32 Å²	32	65.4 Å²	65.4	17%	0.168	34%	0.338	C	S	.	.	H	α-helix	trans	-58.3	-46.2	176	-178	59.8	0	0	0	111.4	F73 S96 L97 S102 I103 W104 L118 I120	F73-L100 HydrophobicContact CB-CD1 4.15Å; F73-L100 HydrophobicContact CD1-CB 4.42Å; F73-L100 HydrophobicContact CD1-CD1 3.79Å; F73-L100 HydrophobicContact CD1-CD2 4.48Å; F73-L100 HydrophobicContact CD1-CG 4.46Å; F73-L100 HydrophobicContact CD2-CD1 4.1Å; F73-L100 HydrophobicContact CE1-CB 3.93Å; F73-L100 HydrophobicContact CE1-CD1 4.16Å; F73-L100 HydrophobicContact CE1-CD2 4.48Å; F73-L100 HydrophobicContact CE1-CG 4.43Å; F73-L100 HydrophobicContact CE2-CB 4.35Å; F73-L100 HydrophobicContact CE2-CD1 4.46Å; F73-L100 HydrophobicContact CG-CD1 3.74Å; F73-L100 HydrophobicContact CZ-CB 3.89Å; F73-L100 HydrophobicContact CZ-CD1 4.48Å; S96-L100 WeakPolarHBondContact O-CB 3.25Å; S96-L100 PolarHBondContact O-N 3.04Å; L97-L100 PolarHBondContact O-N 3.3Å; L100-S102 VanDerWaalsContact C-N 3.31Å; L100-S102 PolarHBondContact O-N 2.93Å; L100-I103 PolarHBondContact O-N 2.59Å; L100-W104 WeakPolarHBondContact O-CB 3.38Å; L100-W104 PolarHBondContact O-N 2.91Å; L100-L118 HydrophobicContact CD1-CD1 4.39Å; L100-L118 HydrophobicContact CD1-CD2 3.91Å; L100-I120 HydrophobicContact CD2-CD1 4.09Å
101	A	90.8	Very high	81.3	Confident	44 Å²	44	72.7 Å²	72.7	36%	0.364	38%	0.376	S	S	.	.	H	α-helix	trans	-60.8	-39.9	175.5	0	0	0	0	0	111.7	L97 E98 L99 W104 N105	L97-A101 WeakPolarHBondContact O-CB 3.08Å; L97-A101 PolarHBondContact O-N 2.99Å; E98-A101 PolarHBondContact O-N 3.3Å; L99-A101 VanDerWaalsContact C-N 3.33Å; L99-A101 PolarHBondContact O-N 3.32Å; A101-W104 PolarHBondContact O-N 3.05Å; A101-N105 WeakPolarHBondContact O-CB 3.45Å; A101-N105 PolarHBondContact O-N 3.19Å; A101-N105 PolarHBondContact O-ND2 2.97Å
102	S	89.1	Confident	79.2	Confident	60 Å²	60	72.9 Å²	72.9	42%	0.42	38%	0.379	S	S	.	.	H	α-helix	trans	-65	-41.2	177	79.2	0	0	0	0	112.8	E98 L99 L100 N106	E98-S102 PolarHBondContact O-N 3Å; L99-S102 PolarHBondContact O-N 2.85Å; L99-S102 VanDerWaalsContact O-N 3.12Å; L99-S102 PolarHBondContact O-OG 2.87Å; L100-S102 VanDerWaalsContact C-N 3.31Å; L100-S102 PolarHBondContact O-N 2.93Å; S102-N106 VanDerWaalsContact O-CB 3.23Å; S102-N106 WeakPolarHBondContact O-CB 3.46Å; S102-N106 PolarHBondContact O-N 2.89Å
103	I	86.5	Confident	77.4	Confident	13 Å²	13	76.5 Å²	76.5	7%	0.067	41%	0.414	C	S	.	.	H	α-helix	trans	-64.5	-46.4	175.7	-64.6	164.9	0	0	0	109.6	W61 I71 F73 L99 L100 N105 N106 R107	W61-I103 HydrophobicContact CH2-CD1 4.21Å; W61-I103 HydrophobicContact CZ3-CD1 3.67Å; W61-I103 HydrophobicContact CZ3-CG1 3.91Å; I71-I103 HydrophobicContact CD1-CG2 4.41Å; F73-I103 HydrophobicContact CD2-CD1 3.51Å; F73-I103 HydrophobicContact CE2-CD1 3.58Å; L99-I103 HydrophobicContact CG-CD1 4.3Å; L99-I103 WeakPolarHBondContact O-CG1 3.31Å; L99-I103 PolarHBondContact O-N 3.02Å; L100-I103 PolarHBondContact O-N 2.59Å; I103-N105 PolarHBondContact O-N 3.5Å; I103-N106 PolarHBondContact O-N 3.29Å; I103-R107 WeakPolarHBondContact O-CG 3.26Å; I103-R107 PolarHBondContact O-N 2.98Å; I103-R107 VanDerWaalsContact O-N 3.07Å
104	W	83.7	Confident	75.8	Confident	127 Å²	127	78.4 Å²	78.4	48%	0.481	43%	0.429	S	S	.	.	H	α-helix	trans	-58.5	-49.7	179.2	-173.9	-103	0	0	0	111.3	L100 A101 R107 F108 L118	L100-W104 WeakPolarHBondContact O-CB 3.38Å; L100-W104 PolarHBondContact O-N 2.91Å; A101-W104 PolarHBondContact O-N 3.05Å; W104-R107 PolarHBondContact O-N 3.36Å; W104-F108 AromaticContact CD1-CE2 3.73Å; W104-F108 AromaticContact CD2-CE2 3.96Å; W104-F108 HydrophobicContact CD2-CE2 3.96Å; W104-F108 AromaticContact CE2-CE2 3.49Å; W104-F108 VanDerWaalsContact CE2-CE2 3.49Å; W104-F108 AromaticContact CE2-CZ 3.8Å; W104-F108 HydrophobicContact CG-CE2 4.11Å; W104-F108 HydrophobicContact CH2-CZ 4.38Å; W104-F108 AromaticContact CZ2-CE2 3.92Å; W104-F108 HydrophobicContact CZ2-CE2 3.92Å; W104-F108 AromaticContact CZ2-CZ 3.71Å; W104-F108 HydrophobicContact CZ2-CZ 3.71Å; W104-F108 AromaticContact NE1-CE2 3.36Å; W104-F108 AromaticContact NE1-CZ 3.96Å; W104-F108 WeakPolarHBondContact O-CD2 2.93Å; W104-F108 WeakPolarHBondContact O-CE2 3.08Å; W104-L118 HydrophobicContact CE3-CD2 3.85Å; W104-L118 HydrophobicContact CZ3-CB 4.47Å; W104-L118 HydrophobicContact CZ3-CD2 4.07Å
105	N	81.8	Confident	74.5	Confident	104 Å²	104	80.1 Å²	80.1	56%	0.556	44%	0.443	S	S	*	.	H	α-helix	trans	-70.8	-34.6	-178.1	-68.6	-32.1	0	0	0	113.4	A101 I103 R107	A101-N105 WeakPolarHBondContact O-CB 3.45Å; A101-N105 PolarHBondContact O-N 3.19Å; A101-N105 PolarHBondContact O-ND2 2.97Å; I103-N105 PolarHBondContact O-N 3.5Å; N105-R107 VanDerWaalsContact C-N 3.29Å
106	N	77.5	Confident	73.3	Confident	101 Å²	101	80.7 Å²	80.7	54%	0.54	45%	0.448	S	S	.	.	H	α-helix	trans	-67.4	-33.7	175.6	-162.5	-56.5	0	0	0	111.1	S102 I103 F108 V109 C110	S102-N106 VanDerWaalsContact O-CB 3.23Å; S102-N106 WeakPolarHBondContact O-CB 3.46Å; S102-N106 PolarHBondContact O-N 2.89Å; I103-N106 PolarHBondContact O-N 3.29Å; N106-F108 VanDerWaalsContact C-N 3.32Å; N106-F108 PolarHBondContact O-N 3.07Å; N106-V109 WeakPolarHBondContact O-CA 3.31Å; N106-V109 WeakPolarHBondContact O-CB 3.44Å; N106-V109 PolarHBondContact O-N 3.18Å; N106-C110 PolarHBondContact O-N 3.21Å
107	R	62.4	Low	72.4	Confident	42 Å²	42	83.5 Å²	83.5	16%	0.158	46%	0.464	C	S	.	.	H	α-helix	trans	-66	-26.7	179	-78.3	-150.6	-90.3	-172.7	-1	115.1	I103 W104 N105 V109 C110	I103-R107 WeakPolarHBondContact O-CG 3.26Å; I103-R107 PolarHBondContact O-N 2.98Å; I103-R107 VanDerWaalsContact O-N 3.07Å; W104-R107 PolarHBondContact O-N 3.36Å; N105-R107 VanDerWaalsContact C-N 3.29Å; R107-V109 PolarHBondContact O-N 3.11Å; R107-C110 PolarHBondContact O-N 2.94Å
108	F	53.1	Low	71.8	Confident	137 Å²	137	80.4 Å²	80.4	60%	0.601	45%	0.448	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73.9	-8	170.9	-66.8	-77.5	0	0	0	113.6	W104 N106	W104-F108 AromaticContact CD1-CE2 3.73Å; W104-F108 AromaticContact CD2-CE2 3.96Å; W104-F108 HydrophobicContact CD2-CE2 3.96Å; W104-F108 AromaticContact CE2-CE2 3.49Å; W104-F108 VanDerWaalsContact CE2-CE2 3.49Å; W104-F108 AromaticContact CE2-CZ 3.8Å; W104-F108 HydrophobicContact CG-CE2 4.11Å; W104-F108 HydrophobicContact CH2-CZ 4.38Å; W104-F108 AromaticContact CZ2-CE2 3.92Å; W104-F108 HydrophobicContact CZ2-CE2 3.92Å; W104-F108 AromaticContact CZ2-CZ 3.71Å; W104-F108 HydrophobicContact CZ2-CZ 3.71Å; W104-F108 AromaticContact NE1-CE2 3.36Å; W104-F108 AromaticContact NE1-CZ 3.96Å; W104-F108 WeakPolarHBondContact O-CD2 2.93Å; W104-F108 WeakPolarHBondContact O-CE2 3.08Å; N106-F108 VanDerWaalsContact C-N 3.32Å; N106-F108 PolarHBondContact O-N 3.07Å
109	V	48.2	Very low	71.1	Confident	116 Å²	116	81.6 Å²	81.6	70%	0.703	45%	0.452	S	S	*	.	T	Hydrogen-bonded Turn	trans	-97.3	-16.7	176.4	-174.4	0	0	0	0	111.6	N106 R107	N106-V109 WeakPolarHBondContact O-CA 3.31Å; N106-V109 WeakPolarHBondContact O-CB 3.44Å; N106-V109 PolarHBondContact O-N 3.18Å; R107-V109 PolarHBondContact O-N 3.11Å
110	C	48.9	Very low	70.6	Confident	68 Å²	68	85.2 Å²	85.2	46%	0.459	47%	0.47	S	S	.	.	S	Bend	trans	-94.4	103.4	171.9	-88.8	0	0	0	0	110.8	N106 R107 T112	N106-C110 PolarHBondContact O-N 3.21Å; R107-C110 PolarHBondContact O-N 2.94Å; C110-T112 VanDerWaalsContact C-N 3.28Å; C110-T112 PolarHBondContact O-N 3Å
111	I	44	Very low	70	Confident	175 Å²	175	84.9 Å²	84.9	90%	0.897	48%	0.475	S	S	*	.			trans	-67.9	83.6	172.7	-56.4	165.3	0	0	0	108.4
112	T	53	Low	69.5	Low	52 Å²	52	88 Å²	88	32%	0.319	48%	0.484	S	S	.	.			trans	-98.7	143.5	160.9	55.8	0	0	0	0	108.9	C110 S114	C110-T112 VanDerWaalsContact C-N 3.28Å; C110-T112 PolarHBondContact O-N 3Å; T112-S114 PolarHBondContact O-N 3.14Å; T112-S114 VanDerWaalsContact O-N 3.12Å; T112-S114 PolarHBondContact OG1-O 3.16Å; T112-S114 VanDerWaalsContact OG1-O 3.06Å
113	S	56.1	Low	69	Low	137 Å²	137	90 Å²	90	96%	0.958	49%	0.489	S	S	*	.	S	Bend	trans	-65.7	-11.9	-175.1	42.4	0	0	0	0	114.6
114	S	61.3	Low	68.3	Low	79 Å²	79	94 Å²	94	55%	0.552	52%	0.515	S	S	*	.	S	Bend	trans	-131.1	134.7	171	52.9	0	0	0	0	110.1	T112 P116	T112-S114 PolarHBondContact O-N 3.14Å; T112-S114 VanDerWaalsContact O-N 3.12Å; T112-S114 PolarHBondContact OG1-O 3.16Å; T112-S114 VanDerWaalsContact OG1-O 3.06Å; S114-P116 WeakPolarHBondContact O-CD 3.43Å
115	D	67.1	Low	67.3	Low	144 Å²	144	92.3 Å²	92.3	77%	0.77	52%	0.515	S	S	*	.	P	Polyproline II helix	trans	-69.4	120.4	174	-68.6	-35.8	0	0	0	109.6
116	P	69	Low	65.7	Low	24 Å²	24	95 Å²	95	16%	0.156	54%	0.539	C	S	.	.	P	Polyproline II helix	trans	-71.2	136	-179.8	28.6	-36.3	0	0	0	111.4	V68 T69 S114	V68-P116 HydrophobicContact CG2-CB 4.46Å; T69-P116 WeakPolarHBondContact O-CA 3.47Å; S114-P116 WeakPolarHBondContact O-CD 3.43Å
117	V	76	Confident	65.2	Low	78 Å²	78	94.8 Å²	94.8	47%	0.473	54%	0.538	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-72	131.6	178.5	-176.1	0	0	0	0	110.1	T69 A70 I71 F119	T69-V117 PolarHBondContact O-N 3.43Å; A70-V117 CarbonylContact C-O 3.55Å; A70-V117 VanDerWaalsContact CA-O 3.24Å; A70-V117 WeakPolarHBondContact CA-O 3.25Å; A70-V117 HydrophobicContact CB-CB 4.35Å; A70-V117 WeakPolarHBondContact CB-O 3.4Å; I71-V117 PolarHBondContact N-O 3.01Å; V117-F119 HydrophobicContact CB-CE2 3.94Å; V117-F119 HydrophobicContact CB-CZ 4.36Å; V117-F119 HydrophobicContact CG1-CD2 4.07Å; V117-F119 HydrophobicContact CG1-CE1 4.18Å; V117-F119 HydrophobicContact CG1-CE2 3.46Å; V117-F119 VanDerWaalsContact CG1-CE2 3.46Å; V117-F119 HydrophobicContact CG1-CZ 3.52Å
118	L	80.1	Confident	65.3	Low	44 Å²	44	97.5 Å²	97.5	23%	0.23	56%	0.558	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-99.5	120.6	174.6	174.5	62.3	0	0	0	110.1	I71 F73 L100 W104 I120	I71-L118 HydrophobicContact CG2-CD1 4.38Å; I71-L118 WeakPolarHBondContact O-CA 3.49Å; F73-L118 HydrophobicContact CB-CD1 3.8Å; L100-L118 HydrophobicContact CD1-CD1 4.39Å; L100-L118 HydrophobicContact CD1-CD2 3.91Å; W104-L118 HydrophobicContact CE3-CD2 3.85Å; W104-L118 HydrophobicContact CZ3-CB 4.47Å; W104-L118 HydrophobicContact CZ3-CD2 4.07Å; L118-I120 HydrophobicContact CG-CG1 4.47Å
119	F	80.6	Confident	66	Low	115 Å²	115	95.3 Å²	95.3	50%	0.504	56%	0.556	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-105.9	133.7	169.9	-63.5	-83.7	0	0	0	109.7	A70 I71 I72 F73 V117	A70-F119 HydrophobicContact CB-CD2 4.31Å; A70-F119 HydrophobicContact CB-CE2 4.08Å; I71-F119 PolarHBondContact O-N 2.87Å; I72-F119 HydrophobicContact CG1-CB 4.41Å; F73-F119 PolarHBondContact N-O 3.3Å; V117-F119 HydrophobicContact CB-CE2 3.94Å; V117-F119 HydrophobicContact CB-CZ 4.36Å; V117-F119 HydrophobicContact CG1-CD2 4.07Å; V117-F119 HydrophobicContact CG1-CE1 4.18Å; V117-F119 HydrophobicContact CG1-CE2 3.46Å; V117-F119 VanDerWaalsContact CG1-CE2 3.46Å; V117-F119 HydrophobicContact CG1-CZ 3.52Å
120	I	81	Confident	67	Low	97 Å²	97	94.1 Å²	94.1	50%	0.497	55%	0.547	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104	109.2	175.9	-58.3	175.8	0	0	0	108.5	F73 L100 L118 I122	F73-I120 CarbonylContact O-C 3.55Å; F73-I120 WeakPolarHBondContact O-CA 3.29Å; L100-I120 HydrophobicContact CD2-CD1 4.09Å; L118-I120 HydrophobicContact CG-CG1 4.47Å; I120-I122 HydrophobicContact CG2-CG1 4.4Å
121	G	80.4	Confident	68.2	Low	25 Å²	25	95.8 Å²	95.8	26%	0.258	55%	0.553	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-85.7	122.2	169.7	0	0	0	0	0	110.1	F73 V74 A75	F73-G121 PolarHBondContact O-N 2.83Å; V74-G121 CarbonylContact C-O 3.57Å; V74-G121 WeakPolarHBondContact CA-O 3.37Å; A75-G121 PolarHBondContact N-O 3.41Å
122	I	80.4	Confident	69.8	Low	109 Å²	109	90.5 Å²	90.5	56%	0.559	53%	0.53	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-96.8	117	174.4	-64.4	172.3	0	0	0	108.2	C77 I120 T124	C77-I122 HydrophobicContact CB-CG2 3.82Å; C77-I122 VanDerWaalsContact SG-CG2 3.57Å; I120-I122 HydrophobicContact CG2-CG1 4.4Å; I122-T124 HydrophobicContact CG2-CG2 4.15Å
123	L	78.7	Confident	71	Confident	102 Å²	102	93.2 Å²	93.2	53%	0.534	55%	0.545	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.1	111	167.1	-66.2	176.9	0	0	0	108.5	V74 A75 A76 C77	V74-L123 HydrophobicContact CG1-CD1 3.4Å; V74-L123 HydrophobicContact CG1-CD2 4.32Å; V74-L123 HydrophobicContact CG1-CG 3.46Å; V74-L123 VanDerWaalsContact CG1-CG 3.46Å; A75-L123 PolarHBondContact O-N 3.02Å; A76-L123 CarbonylContact C-O 3.51Å; A76-L123 WeakPolarHBondContact CA-O 3.46Å; A76-L123 HydrophobicContact CB-CB 4.5Å; C77-L123 PolarHBondContact N-O 3.04Å
124	T	72.1	Confident	72.1	Confident	99 Å²	99	89.8 Å²	89.8	61%	0.607	51%	0.513	S	S	*	.			trans	-92.2	133	158.7	54.3	0	0	0	0	107.3	I122	I122-T124 HydrophobicContact CG2-CG2 4.15Å
125	D	61.4	Low	73	Confident	91 Å²	91	90.8 Å²	90.8	49%	0.487	51%	0.51	S	S	.	.			trans	-53.5	134.2	165	-75.8	-62	0	0	0	108.8	S78	S78-D125 VanDerWaalsContact CB-OD2 3.28Å; S78-D125 WeakPolarHBondContact CB-OD2 3.29Å; S78-D125 VanDerWaalsContact OG-CG 3.27Å; S78-D125 PolarHBondContact OG-N 3.09Å; S78-D125 VanDerWaalsContact OG-N 3.14Å; S78-D125 PolarHBondContact OG-OD2 3.05Å
126	P	49.5	Very low	73.6	Confident	161 Å²	161	85.9 Å²	85.9	100%	1.045	49%	0.486	S	S	*	.			trans	-66.2	0	166.2	28.9	-32.7	0	0	0	111.1

Retrieved 126 of 126 residues in 39.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).