C4QM46_SCHMA Loading...

Nucleolar protein 10

AlphaFold DB , UniProt , Accession C4QM46, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 64 aa.

						>C4QM46_SCHMA|C4QM46
MLLRYYLDSNGDRVYTLKSFDPENKPTFSAHPARFTPEDRYSRHRITLKSRFGILPSQYPPIVY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	74.2	Confident	92.9	Very high	174 Å²	174	90.4 Å²	90.4	86%	0.857	49%	0.49	S	S	*	.				0	120.1	0	-93.9	-55.1	179.9	0	0	108.5	H31	M1-H31 WeakPolarHBondContact CB-CD2 3.33Å; M1-H31 HydrophobicContact CG-CB 4.18Å; M1-H31 WeakPolarHBondContact CG-CD2 3.3Å; M1-H31 PolarHBondContact SD-CE1 3.36Å; M1-H31 PolarHBondContact SD-NE2 3.2Å
2	L	90.1	Very high	93.2	Very high	144 Å²	144	91.3 Å²	91.3	75%	0.754	49%	0.494	S	S	*	.			trans	-92.8	-20	-170.9	-65.4	171.2	0	0	0	113.1	R4 L17	L2-R4 WeakPolarHBondContact O-CG 3.33Å; L2-R4 PolarHBondContact O-N 2.65Å; L2-L17 HydrophobicContact CB-CD2 4.18Å; L2-L17 WeakPolarHBondContact O-CD2 3.35Å
3	L	95.8	Very high	93.4	Very high	68 Å²	68	94.6 Å²	94.6	36%	0.356	50%	0.495	S	S	.	.			trans	-73.6	125.6	-177.7	-168.4	67.2	0	0	0	110.4	Y15 A30 H31	L3-Y15 HydrophobicContact CD1-CD1 4.19Å; L3-Y15 HydrophobicContact CD2-CD1 3.97Å; L3-Y15 HydrophobicContact CD2-CE1 4.23Å; L3-Y15 HydrophobicContact CG-CD1 3.98Å; L3-A30 HydrophobicContact CB-CB 3.99Å; L3-A30 HydrophobicContact CD2-CB 3.79Å; L3-A30 HydrophobicContact CG-CB 3.68Å; L3-A30 WeakPolarHBondContact O-CB 3.49Å; L3-A30 PolarHBondContact O-N 3.3Å; L3-H31 WeakPolarHBondContact CB-NE2 3.4Å
4	R	96.8	Very high	93.6	Very high	74 Å²	74	91.4 Å²	91.4	28%	0.279	48%	0.481	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.7	164.3	180	-52.2	-177.7	71.8	91	-2.3	109.7	L2 Y15 T16 K18 T27 F28	L2-R4 WeakPolarHBondContact O-CG 3.33Å; L2-R4 PolarHBondContact O-N 2.65Å; R4-Y15 WeakPolarHBondContact O-CA 3.4Å; R4-T16 CarbonylContact C-O 3.44Å; R4-T16 WeakPolarHBondContact CA-O 3.48Å; R4-T16 HydrophobicContact CB-CG2 4.31Å; R4-T16 WeakPolarHBondContact CB-O 3.5Å; R4-T16 PolarHBondContact N-O 2.98Å; R4-T16 PolarHBondContact O-N 3.1Å; R4-K18 WeakPolarHBondContact CD-O 3.41Å; R4-T27 WeakPolarHBondContact CD-OG1 3.33Å; R4-T27 PolarHBondContact NE-OG1 3.42Å; R4-T27 PolarHBondContact NH2-O 2.88Å; R4-F28 CarbonylContact C-O 3.5Å; R4-F28 WeakPolarHBondContact CA-O 3.33Å; R4-F28 WeakPolarHBondContact CB-O 3.46Å
5	Y	97	Very high	93.8	Very high	39 Å²	39	94 Å²	94	15%	0.153	48%	0.483	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.7	159.2	173.6	78	-80.2	0	0	0	111.6	L7 R13 V14 T27 F28 S29 A30	Y5-L7 HydrophobicContact CD2-CD2 4.28Å; Y5-L7 HydrophobicContact CE2-CD2 3.89Å; Y5-L7 HydrophobicContact CE2-CG 4.3Å; Y5-R13 HydrophobicContact CD2-CB 3.93Å; Y5-R13 HydrophobicContact CD2-CG 3.63Å; Y5-R13 HydrophobicContact CE2-CG 3.91Å; Y5-R13 HydrophobicContact CG-CB 4.38Å; Y5-R13 HydrophobicContact CG-CG 4.35Å; Y5-V14 VanDerWaalsContact CA-O 3.23Å; Y5-V14 WeakPolarHBondContact CA-O 3.4Å; Y5-T27 WeakPolarHBondContact O-CB 3.43Å; Y5-F28 HydrophobicContact CD1-CB 4.06Å; Y5-F28 HydrophobicContact CE1-CB 3.61Å; Y5-F28 PolarHBondContact N-O 2.87Å; Y5-F28 PolarHBondContact O-N 3.44Å; Y5-S29 WeakPolarHBondContact CE1-O 3.26Å; Y5-A30 HydrophobicContact CD1-CB 4.25Å
6	Y	97	Very high	93.9	Very high	52 Å²	52	89.9 Å²	89.9	20%	0.204	46%	0.464	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.9	167.4	161.7	61.3	-82	0	0	0	108.8	V14 T16 D21 P22 T27	Y6-V14 HydrophobicContact CD1-CB 4.21Å; Y6-V14 HydrophobicContact CD2-CB 4.36Å; Y6-V14 HydrophobicContact CE1-CB 3.7Å; Y6-V14 HydrophobicContact CE1-CG1 3.66Å; Y6-V14 HydrophobicContact CE2-CB 3.88Å; Y6-V14 HydrophobicContact CE2-CG1 4.34Å; Y6-V14 HydrophobicContact CE2-CG2 4.12Å; Y6-V14 PolarHBondContact N-O 3.29Å; Y6-V14 VanDerWaalsContact N-O 3.11Å; Y6-V14 PolarHBondContact O-N 2.9Å; Y6-V14 WeakPolarHBondContact OH-CG1 3.47Å; Y6-T16 HydrophobicContact CD1-CG2 4.18Å; Y6-T16 HydrophobicContact CE1-CG2 4.42Å; Y6-D21 HydrophobicContact CD1-CB 3.98Å; Y6-D21 HydrophobicContact CD2-CB 4.12Å; Y6-D21 HydrophobicContact CG-CB 3.75Å; Y6-P22 HydrophobicContact CE2-CG 4.5Å; Y6-T27 HydrophobicContact CD1-CG2 4.31Å
7	L	95.8	Very high	94	Very high	95 Å²	95	92.3 Å²	92.3	50%	0.497	48%	0.477	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.3	130.7	175.8	-62.2	176.4	0	0	0	108.6	Y5 D12 R13	Y5-L7 HydrophobicContact CD2-CD2 4.28Å; Y5-L7 HydrophobicContact CE2-CD2 3.89Å; Y5-L7 HydrophobicContact CE2-CG 4.3Å; L7-D12 WeakPolarHBondContact CA-O 3.34Å; L7-R13 HydrophobicContact CD2-CG 4.08Å
8	D	93.2	Very high	94.1	Very high	52 Å²	52	95.7 Å²	95.7	28%	0.278	49%	0.487	S	S	.	.			trans	-77.6	-176.1	171	73.7	2.5	0	0	0	111.8	N10 G11 D12 V14	D8-N10 PolarHBondContact O-N 3.15Å; D8-N10 WeakPolarHBondContact OD1-CA 3.46Å; D8-N10 WeakPolarHBondContact OD1-CB 3.49Å; D8-N10 PolarHBondContact OD1-N 2.86Å; D8-G11 PolarHBondContact O-N 3.23Å; D8-G11 VanDerWaalsContact O-N 3.1Å; D8-G11 PolarHBondContact OD1-N 3.44Å; D8-D12 PolarHBondContact N-O 2.71Å; D8-D12 PolarHBondContact OD1-N 2.92Å; D8-V14 HydrophobicContact CB-CG2 4.05Å
9	S	94.2	Very high	94.1	Very high	122 Å²	122	94.2 Å²	94.2	85%	0.853	49%	0.487	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62	-22.7	177.2	51.1	0	0	0	0	114.1
10	N	94.6	Very high	94.2	Very high	129 Å²	129	95.4 Å²	95.4	69%	0.69	49%	0.488	S	S	*	.	T	Hydrogen-bonded Turn	trans	-90.1	-9.5	179.2	-59.4	-24	0	0	0	112	D8	D8-N10 PolarHBondContact O-N 3.15Å; D8-N10 WeakPolarHBondContact OD1-CA 3.46Å; D8-N10 WeakPolarHBondContact OD1-CB 3.49Å; D8-N10 PolarHBondContact OD1-N 2.86Å
11	G	93.7	Very high	94.1	Very high	45 Å²	45	91.9 Å²	91.9	46%	0.464	47%	0.471	S	S	.	.	S	Bend	trans	85.2	10.5	-174.1	0	0	0	0	0	113.7	D8	D8-G11 PolarHBondContact O-N 3.23Å; D8-G11 VanDerWaalsContact O-N 3.1Å; D8-G11 PolarHBondContact OD1-N 3.44Å
12	D	95.8	Very high	95.1	Very high	101 Å²	101	88.6 Å²	88.6	54%	0.54	46%	0.462	S	S	.	.			trans	-81.3	148.9	176.1	-69.8	-43	0	0	0	111.1	L7 D8 V14	L7-D12 WeakPolarHBondContact CA-O 3.34Å; D8-D12 PolarHBondContact N-O 2.71Å; D8-D12 PolarHBondContact OD1-N 2.92Å; D12-V14 PolarHBondContact O-N 3.45Å
13	R	95.7	Very high	95.2	Very high	135 Å²	135	88.1 Å²	88.1	51%	0.509	46%	0.456	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.1	115.7	-179.5	-62.3	-174.5	-177.4	-176.8	-0.3	110.3	Y5 L7 Y15	Y5-R13 HydrophobicContact CD2-CB 3.93Å; Y5-R13 HydrophobicContact CD2-CG 3.63Å; Y5-R13 HydrophobicContact CE2-CG 3.91Å; Y5-R13 HydrophobicContact CG-CB 4.38Å; Y5-R13 HydrophobicContact CG-CG 4.35Å; L7-R13 HydrophobicContact CD2-CG 4.08Å; R13-Y15 HydrophobicContact CB-CE2 4.33Å
14	V	96.4	Very high	95.2	Very high	50 Å²	50	91.1 Å²	91.1	30%	0.303	47%	0.472	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.1	116	168.9	-175.5	0	0	0	0	109.3	Y5 Y6 D8 D12	Y5-V14 VanDerWaalsContact CA-O 3.23Å; Y5-V14 WeakPolarHBondContact CA-O 3.4Å; Y6-V14 HydrophobicContact CD1-CB 4.21Å; Y6-V14 HydrophobicContact CD2-CB 4.36Å; Y6-V14 HydrophobicContact CE1-CB 3.7Å; Y6-V14 HydrophobicContact CE1-CG1 3.66Å; Y6-V14 HydrophobicContact CE2-CB 3.88Å; Y6-V14 HydrophobicContact CE2-CG1 4.34Å; Y6-V14 HydrophobicContact CE2-CG2 4.12Å; Y6-V14 PolarHBondContact N-O 3.29Å; Y6-V14 VanDerWaalsContact N-O 3.11Å; Y6-V14 PolarHBondContact O-N 2.9Å; Y6-V14 WeakPolarHBondContact OH-CG1 3.47Å; D8-V14 HydrophobicContact CB-CG2 4.05Å; D12-V14 PolarHBondContact O-N 3.45Å
15	Y	96.7	Very high	95	Very high	130 Å²	130	93.2 Å²	93.2	51%	0.51	48%	0.484	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-81	143.1	-177.2	-67.1	-76	0	0	0	112.3	L3 R4 R13 A30	L3-Y15 HydrophobicContact CD1-CD1 4.19Å; L3-Y15 HydrophobicContact CD2-CD1 3.97Å; L3-Y15 HydrophobicContact CD2-CE1 4.23Å; L3-Y15 HydrophobicContact CG-CD1 3.98Å; R4-Y15 WeakPolarHBondContact O-CA 3.4Å; R13-Y15 HydrophobicContact CB-CE2 4.33Å; Y15-A30 HydrophobicContact CD1-CB 4.2Å; Y15-A30 HydrophobicContact CE1-CB 3.91Å
16	T	95.6	Very high	95	Very high	29 Å²	29	95.5 Å²	95.5	18%	0.178	50%	0.503	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-156	163	-179.1	-175.9	0	0	0	0	110.8	R4 Y6 K18 T27	R4-T16 CarbonylContact C-O 3.44Å; R4-T16 WeakPolarHBondContact CA-O 3.48Å; R4-T16 HydrophobicContact CB-CG2 4.31Å; R4-T16 WeakPolarHBondContact CB-O 3.5Å; R4-T16 PolarHBondContact N-O 2.98Å; R4-T16 PolarHBondContact O-N 3.1Å; Y6-T16 HydrophobicContact CD1-CG2 4.18Å; Y6-T16 HydrophobicContact CE1-CG2 4.42Å; T16-K18 WeakPolarHBondContact OG1-CB 3.23Å; T16-K18 PolarHBondContact OG1-N 2.89Å; T16-T27 HydrophobicContact CG2-CG2 3.89Å
17	L	95.6	Very high	94.9	Very high	130 Å²	130	93.3 Å²	93.3	68%	0.681	50%	0.495	S	S	*	.	S	Bend	trans	-100.3	-7	167.9	-61.1	178.5	0	0	0	112	L2	L2-L17 HydrophobicContact CB-CD2 4.18Å; L2-L17 WeakPolarHBondContact O-CD2 3.35Å
18	K	95.2	Very high	94.9	Very high	153 Å²	153	94.4 Å²	94.4	67%	0.665	50%	0.496	S	S	*	.			trans	-77	144.3	-178.6	-60.3	-176.4	-178.7	179.7	0	111.2	R4 T16 F20 T27	R4-K18 WeakPolarHBondContact CD-O 3.41Å; T16-K18 WeakPolarHBondContact OG1-CB 3.23Å; T16-K18 PolarHBondContact OG1-N 2.89Å; K18-F20 VanDerWaalsContact C-N 3.27Å; K18-F20 PolarHBondContact O-N 3.23Å; K18-T27 PolarHBondContact O-OG1 2.93Å
19	S	94.7	Very high	95.1	Very high	68 Å²	68	94.9 Å²	94.9	48%	0.476	50%	0.503	S	S	.	.	S	Bend	trans	-72.3	-19.3	176.2	-57.1	0	0	0	0	113.9	T27	S19-T27 VanDerWaalsContact C-OG1 3.28Å; S19-T27 PolarHBondContact O-N 3.1Å; S19-T27 PolarHBondContact O-OG1 2.85Å; S19-T27 VanDerWaalsContact O-OG1 3.1Å
20	F	96	Very high	95.2	Very high	118 Å²	118	90 Å²	90	52%	0.518	47%	0.47	S	S	.	.	B	Isolated β-bridge	trans	-126.5	146.3	-178.8	-61.2	-83.8	0	0	0	110.5	K18 K25	K18-F20 VanDerWaalsContact C-N 3.27Å; K18-F20 PolarHBondContact O-N 3.23Å; F20-K25 WeakPolarHBondContact CA-O 3.09Å
21	D	93.1	Very high	95.2	Very high	22 Å²	22	86.8 Å²	86.8	12%	0.118	45%	0.451	C	S	.	.			trans	-81.1	178.3	173.7	80.2	-3.9	0	0	0	111.1	Y6 E23 N24 K25 T27	Y6-D21 HydrophobicContact CD1-CB 3.98Å; Y6-D21 HydrophobicContact CD2-CB 4.12Å; Y6-D21 HydrophobicContact CG-CB 3.75Å; D21-E23 PolarHBondContact O-N 2.8Å; D21-E23 VanDerWaalsContact OD1-CA 3.3Å; D21-E23 WeakPolarHBondContact OD1-CA 3.43Å; D21-E23 PolarHBondContact OD1-N 3Å; D21-N24 PolarHBondContact O-N 2.82Å; D21-N24 VanDerWaalsContact O-N 3.15Å; D21-N24 PolarHBondContact OD1-N 2.68Å; D21-K25 PolarHBondContact N-O 3.06Å; D21-K25 PolarHBondContact OD1-N 2.76Å; D21-K25 WeakPolarHBondContact OD2-CB 3.4Å; D21-T27 HydrophobicContact CB-CG2 4.17Å
22	P	93.6	Very high	95.3	Very high	104 Å²	104	90.4 Å²	90.4	68%	0.675	47%	0.466	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.2	-21.3	176.9	-23.7	35.4	0	0	0	114.8	Y6	Y6-P22 HydrophobicContact CE2-CG 4.5Å
23	E	93.9	Very high	95.2	Very high	135 Å²	135	90.3 Å²	90.3	63%	0.631	48%	0.479	S	S	*	.	T	Hydrogen-bonded Turn	trans	-96.9	11.8	178.5	-61.3	-176	173.2	0	0	112.5	D21 K25	D21-E23 PolarHBondContact O-N 2.8Å; D21-E23 VanDerWaalsContact OD1-CA 3.3Å; D21-E23 WeakPolarHBondContact OD1-CA 3.43Å; D21-E23 PolarHBondContact OD1-N 3Å; E23-K25 HydrophobicContact CB-CG 4.49Å; E23-K25 PolarHBondContact O-N 2.74Å; E23-K25 WeakPolarHBondContact OE2-CE 3.33Å; E23-K25 IonicContact OE2-NZ 2.65Å; E23-K25 PolarHBondContact OE2-NZ 2.89Å
24	N	93.8	Very high	95.1	Very high	131 Å²	131	94.1 Å²	94.1	70%	0.701	49%	0.494	S	S	*	.	S	Bend	trans	60.3	20.4	-174.2	-75.2	-44.4	0	0	0	115.6	D21	D21-N24 PolarHBondContact O-N 2.82Å; D21-N24 VanDerWaalsContact O-N 3.15Å; D21-N24 PolarHBondContact OD1-N 2.68Å
25	K	94.1	Very high	95	Very high	118 Å²	118	99.5 Å²	99.5	51%	0.513	51%	0.513	S	S	.	.	P	Polyproline II helix	trans	-79.7	145.4	168.1	-58.6	167.5	177.4	158.4	0	109.9	F20 D21 E23 T27	F20-K25 WeakPolarHBondContact CA-O 3.09Å; D21-K25 PolarHBondContact N-O 3.06Å; D21-K25 PolarHBondContact OD1-N 2.76Å; D21-K25 WeakPolarHBondContact OD2-CB 3.4Å; E23-K25 HydrophobicContact CB-CG 4.49Å; E23-K25 PolarHBondContact O-N 2.74Å; E23-K25 WeakPolarHBondContact OE2-CE 3.33Å; E23-K25 IonicContact OE2-NZ 2.65Å; E23-K25 PolarHBondContact OE2-NZ 2.89Å; K25-T27 PolarHBondContact O-N 3.11Å
26	P	95.8	Very high	94.9	Very high	87 Å²	87	95.5 Å²	95.5	57%	0.565	50%	0.502	S	S	*	.	B	Isolated β-bridge	trans	-66.3	132.6	178	26.9	-33.7	0	0	0	110.8
27	T	96.3	Very high	94.8	Very high	5 Å²	5	100 Å²	100	3%	0.031	53%	0.532	C	S	.	.	P	Polyproline II helix	trans	-77.3	159.4	176.4	54.6	0	0	0	0	111.2	R4 Y5 Y6 T16 K18 S19 D21 K25	R4-T27 WeakPolarHBondContact CD-OG1 3.33Å; R4-T27 PolarHBondContact NE-OG1 3.42Å; R4-T27 PolarHBondContact NH2-O 2.88Å; Y5-T27 WeakPolarHBondContact O-CB 3.43Å; Y6-T27 HydrophobicContact CD1-CG2 4.31Å; T16-T27 HydrophobicContact CG2-CG2 3.89Å; K18-T27 PolarHBondContact O-OG1 2.93Å; S19-T27 VanDerWaalsContact C-OG1 3.28Å; S19-T27 PolarHBondContact O-N 3.1Å; S19-T27 PolarHBondContact O-OG1 2.85Å; S19-T27 VanDerWaalsContact O-OG1 3.1Å; D21-T27 HydrophobicContact CB-CG2 4.17Å; K25-T27 PolarHBondContact O-N 3.11Å
28	F	95.7	Very high	94.8	Very high	119 Å²	119	101 Å²	101	52%	0.522	53%	0.533	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.3	156	-179.6	-60.9	-75.8	0	0	0	112.2	R4 Y5 A30	R4-F28 CarbonylContact C-O 3.5Å; R4-F28 WeakPolarHBondContact CA-O 3.33Å; R4-F28 WeakPolarHBondContact CB-O 3.46Å; Y5-F28 HydrophobicContact CD1-CB 4.06Å; Y5-F28 HydrophobicContact CE1-CB 3.61Å; Y5-F28 PolarHBondContact N-O 2.87Å; Y5-F28 PolarHBondContact O-N 3.44Å; F28-A30 PolarHBondContact O-N 3.4Å
29	S	96	Very high	94.7	Very high	61 Å²	61	95.1 Å²	95.1	43%	0.427	51%	0.509	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.5	128.1	171.6	170.3	0	0	0	0	110.1	Y5 H31	Y5-S29 WeakPolarHBondContact CE1-O 3.26Å; S29-H31 PolarHBondContact O-N 3.26Å; S29-H31 PolarHBondContact OG-N 3Å; S29-H31 PolarHBondContact OG-O 3.31Å
30	A	96.4	Very high	94.7	Very high	19 Å²	19	100.6 Å²	100.6	16%	0.157	52%	0.519	C	S	.	.	S	Bend	trans	-69.7	-14.3	175.8	0	0	0	0	0	113.4	L3 Y5 Y15 F28	L3-A30 HydrophobicContact CB-CB 3.99Å; L3-A30 HydrophobicContact CD2-CB 3.79Å; L3-A30 HydrophobicContact CG-CB 3.68Å; L3-A30 WeakPolarHBondContact O-CB 3.49Å; L3-A30 PolarHBondContact O-N 3.3Å; Y5-A30 HydrophobicContact CD1-CB 4.25Å; Y15-A30 HydrophobicContact CD1-CB 4.2Å; Y15-A30 HydrophobicContact CE1-CB 3.91Å; F28-A30 PolarHBondContact O-N 3.4Å
31	H	95.1	Very high	94.7	Very high	63 Å²	63	102.4 Å²	102.4	29%	0.292	52%	0.524	S	S	.	.	S	Bend	trans	-99.9	140.9	-175.7	-54.2	-84.3	0	0	0	111.2	M1 L3 S29	M1-H31 WeakPolarHBondContact CB-CD2 3.33Å; M1-H31 HydrophobicContact CG-CB 4.18Å; M1-H31 WeakPolarHBondContact CG-CD2 3.3Å; M1-H31 PolarHBondContact SD-CE1 3.36Å; M1-H31 PolarHBondContact SD-NE2 3.2Å; L3-H31 WeakPolarHBondContact CB-NE2 3.4Å; S29-H31 PolarHBondContact O-N 3.26Å; S29-H31 PolarHBondContact OG-N 3Å; S29-H31 PolarHBondContact OG-O 3.31Å
32	P	95.6	Very high	94.8	Very high	121 Å²	121	103.5 Å²	103.5	79%	0.786	53%	0.534	S	S	*	.	P	Polyproline II helix	trans	-66.3	159.1	178.6	29.4	-35.6	0	0	0	111.7
33	A	93	Very high	94.9	Very high	98 Å²	98	107.4 Å²	107.4	81%	0.81	54%	0.535	S	S	*	.	P	Polyproline II helix	trans	-60.5	141.8	169.6	0	0	0	0	0	110.3	F35	A33-F35 PolarHBondContact O-N 3.08Å
34	R	93.7	Very high	95	Very high	216 Å²	216	106.8 Å²	106.8	82%	0.815	53%	0.531	S	S	*	.	P	Polyproline II helix	trans	-61.4	127.6	-179.6	-175.3	176.3	69.2	97.7	0.7	110.4	T36	R34-T36 VanDerWaalsContact CZ-CG2 3.49Å
35	F	94.7	Very high	95.1	Very high	163 Å²	163	106.4 Å²	106.4	72%	0.715	52%	0.52	S	S	*	.	P	Polyproline II helix	trans	-80.8	140.4	171.5	178.6	-103.5	0	0	0	110.9	A33 P37	A33-F35 PolarHBondContact O-N 3.08Å; F35-P37 HydrophobicContact CE1-CG 4.33Å
36	T	94.4	Very high	95.2	Very high	45 Å²	45	105 Å²	105	28%	0.276	52%	0.518	S	S	.	.			trans	-135.7	133.1	170.8	50.3	0	0	0	0	109	R34 E38 D39	R34-T36 VanDerWaalsContact CZ-CG2 3.49Å; T36-E38 VanDerWaalsContact C-N 3.27Å; T36-E38 PolarHBondContact O-N 3.49Å; T36-D39 PolarHBondContact O-N 3.38Å
37	P	95.3	Very high	95.2	Very high	124 Å²	124	104.1 Å²	104.1	81%	0.805	51%	0.51	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.2	-36.4	-179.8	-26.9	34.6	0	0	0	114.3	F35 D39	F35-P37 HydrophobicContact CE1-CG 4.33Å; P37-D39 VanDerWaalsContact C-N 3.34Å; P37-D39 PolarHBondContact O-N 3.33Å
38	E	95.3	Very high	95.3	Very high	150 Å²	150	108.5 Å²	108.5	70%	0.701	53%	0.533	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68.8	-31.5	-177.4	-168.7	-174.2	163.8	0	0	113.3	T36 R40	T36-E38 VanDerWaalsContact C-N 3.27Å; T36-E38 PolarHBondContact O-N 3.49Å; E38-R40 HydrophobicContact CG-CG 4.02Å; E38-R40 PolarHBondContact O-N 3.13Å; E38-R40 VanDerWaalsContact O-N 3.12Å; E38-R40 WeakPolarHBondContact OE1-CD 3.18Å; E38-R40 WeakPolarHBondContact OE1-CG 3.47Å
39	D	93.3	Very high	95.3	Very high	30 Å²	30	106.9 Å²	106.9	16%	0.16	53%	0.526	C	S	.	.			trans	20.7	71.7	-176.4	-169.8	4.9	0	0	0	115.4	T36 P37 Y41 S42 R45	T36-D39 PolarHBondContact O-N 3.38Å; P37-D39 VanDerWaalsContact C-N 3.34Å; P37-D39 PolarHBondContact O-N 3.33Å; D39-Y41 PolarHBondContact O-N 3.16Å; D39-Y41 PolarHBondContact OD1-N 3.31Å; D39-S42 WeakPolarHBondContact O-CB 3.35Å; D39-S42 PolarHBondContact O-N 2.93Å; D39-S42 PolarHBondContact O-OG 3.21Å; D39-S42 PolarHBondContact OD1-N 3.22Å; D39-R45 IonicContact OD1-NH1 2.67Å; D39-R45 IonicContact OD2-CZ 3.64Å; D39-R45 IonicContact OD2-NH1 2.65Å; D39-R45 PolarHBondContact OD2-NH1 3.44Å; D39-R45 IonicContact OD2-NH2 3.09Å; D39-R45 PolarHBondContact OD2-NH2 3.01Å
40	R	94.7	Very high	95.3	Very high	183 Å²	183	106.6 Å²	106.6	69%	0.691	52%	0.524	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55.7	-21.4	-177.4	-65.2	-174.4	-71.6	-179	-3.5	114.1	E38	E38-R40 HydrophobicContact CG-CG 4.02Å; E38-R40 PolarHBondContact O-N 3.13Å; E38-R40 VanDerWaalsContact O-N 3.12Å; E38-R40 WeakPolarHBondContact OE1-CD 3.18Å; E38-R40 WeakPolarHBondContact OE1-CG 3.47Å
41	Y	95.4	Very high	95.3	Very high	156 Å²	156	114.9 Å²	114.9	61%	0.612	55%	0.551	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.4	10.5	-179	-58.8	-74.8	0	0	0	113.4	D39 R43 H44 R45	D39-Y41 PolarHBondContact O-N 3.16Å; D39-Y41 PolarHBondContact OD1-N 3.31Å; Y41-R43 VanDerWaalsContact C-N 3.33Å; Y41-R43 PolarHBondContact O-N 2.74Å; Y41-H44 AromaticContact CD1-ND1 3.99Å; Y41-H44 WeakPolarHBondContact O-CB 3.21Å; Y41-H44 PolarHBondContact O-N 3.15Å; Y41-H44 VanDerWaalsContact O-N 3.08Å; Y41-R45 PolarHBondContact O-N 3.38Å
42	S	94.6	Very high	95.4	Very high	46 Å²	46	118.5 Å²	118.5	32%	0.322	57%	0.566	S	S	.	*	H	α-helix	trans	-51.9	-47.3	177.1	54.3	0	0	0	0	112.7	D39 H44 R45 I46	D39-S42 WeakPolarHBondContact O-CB 3.35Å; D39-S42 PolarHBondContact O-N 2.93Å; D39-S42 PolarHBondContact O-OG 3.21Å; D39-S42 PolarHBondContact OD1-N 3.22Å; S42-H44 PolarHBondContact O-N 3.33Å; S42-R45 PolarHBondContact O-N 2.87Å; S42-I46 WeakPolarHBondContact O-CG1 3.32Å; S42-I46 PolarHBondContact O-N 3.48Å
43	R	95.7	Very high	95.3	Very high	186 Å²	186	113.9 Å²	113.9	70%	0.702	54%	0.54	S	S	*	.	H	α-helix	trans	-54.2	-49.1	175.2	176.2	-179.2	160	87	0.4	111.9	Y41 R45 I46 T47	Y41-R43 VanDerWaalsContact C-N 3.33Å; Y41-R43 PolarHBondContact O-N 2.74Å; R43-R45 VanDerWaalsContact C-N 3.35Å; R43-R45 PolarHBondContact O-N 3.25Å; R43-I46 PolarHBondContact O-N 2.99Å; R43-T47 PolarHBondContact O-N 2.96Å; R43-T47 PolarHBondContact O-OG1 3.03Å
44	H	97.3	Very high	95.3	Very high	121 Å²	121	113.6 Å²	113.6	56%	0.56	52%	0.524	S	S	*	.	H	α-helix	trans	-62.5	-43.4	-178.4	-63.4	86	0	0	0	111.4	Y41 S42 I46 T47 L48	Y41-H44 AromaticContact CD1-ND1 3.99Å; Y41-H44 WeakPolarHBondContact O-CB 3.21Å; Y41-H44 PolarHBondContact O-N 3.15Å; Y41-H44 VanDerWaalsContact O-N 3.08Å; S42-H44 PolarHBondContact O-N 3.33Å; H44-I46 PolarHBondContact O-N 3.41Å; H44-T47 PolarHBondContact O-N 3.45Å; H44-L48 WeakPolarHBondContact O-CB 3.47Å; H44-L48 PolarHBondContact O-N 3.32Å
45	R	95.6	Very high	95.3	Very high	123 Å²	123	104.7 Å²	104.7	46%	0.464	49%	0.493	S	S	.	.	H	α-helix	trans	-61	-44.4	176	-174.1	174.6	64.4	-122.2	-2.4	111.4	D39 Y41 S42 R43 L48 K49	D39-R45 IonicContact OD1-NH1 2.67Å; D39-R45 IonicContact OD2-CZ 3.64Å; D39-R45 IonicContact OD2-NH1 2.65Å; D39-R45 PolarHBondContact OD2-NH1 3.44Å; D39-R45 IonicContact OD2-NH2 3.09Å; D39-R45 PolarHBondContact OD2-NH2 3.01Å; Y41-R45 PolarHBondContact O-N 3.38Å; S42-R45 PolarHBondContact O-N 2.87Å; R43-R45 VanDerWaalsContact C-N 3.35Å; R43-R45 PolarHBondContact O-N 3.25Å; R45-L48 PolarHBondContact O-N 3.16Å; R45-K49 WeakPolarHBondContact O-CB 3.33Å; R45-K49 VanDerWaalsContact O-CG 3.29Å; R45-K49 WeakPolarHBondContact O-CG 3.48Å; R45-K49 PolarHBondContact O-N 2.94Å
46	I	95.2	Very high	95.1	Very high	90 Å²	90	101.8 Å²	101.8	46%	0.462	49%	0.49	S	S	.	.	H	α-helix	trans	-66.2	-44.1	179.3	-66.7	167.3	0	0	0	111.1	S42 R43 H44 L48 K49 S50 L55	S42-I46 WeakPolarHBondContact O-CG1 3.32Å; S42-I46 PolarHBondContact O-N 3.48Å; R43-I46 PolarHBondContact O-N 2.99Å; H44-I46 PolarHBondContact O-N 3.41Å; I46-L48 VanDerWaalsContact C-N 3.34Å; I46-L48 PolarHBondContact O-N 2.9Å; I46-K49 PolarHBondContact O-N 3.48Å; I46-S50 WeakPolarHBondContact O-CB 3.49Å; I46-S50 PolarHBondContact O-N 3.24Å; I46-L55 HydrophobicContact CG2-CD1 4.36Å
47	T	96.8	Very high	94.9	Very high	67 Å²	67	104.8 Å²	104.8	41%	0.411	51%	0.513	S	S	.	.	H	α-helix	trans	-60.8	-42.9	177.3	-57.8	0	0	0	0	111.8	R43 H44 S50 R51	R43-T47 PolarHBondContact O-N 2.96Å; R43-T47 PolarHBondContact O-OG1 3.03Å; H44-T47 PolarHBondContact O-N 3.45Å; T47-S50 PolarHBondContact O-N 3.26Å; T47-R51 PolarHBondContact O-N 3.43Å; T47-R51 VanDerWaalsContact O-N 3.08Å
48	L	97	Very high	94.7	Very high	97 Å²	97	103 Å²	103	51%	0.508	49%	0.494	S	S	.	.	H	α-helix	trans	-61.6	-47.7	175.5	-166.6	95.1	0	0	0	110.9	H44 R45 I46 S50 R51 F52	H44-L48 WeakPolarHBondContact O-CB 3.47Å; H44-L48 PolarHBondContact O-N 3.32Å; R45-L48 PolarHBondContact O-N 3.16Å; I46-L48 VanDerWaalsContact C-N 3.34Å; I46-L48 PolarHBondContact O-N 2.9Å; L48-S50 VanDerWaalsContact C-N 3.3Å; L48-S50 PolarHBondContact O-N 3.25Å; L48-R51 WeakPolarHBondContact O-CB 3.38Å; L48-R51 PolarHBondContact O-N 3.2Å; L48-F52 HydrophobicContact CD1-CE2 4.08Å; L48-F52 HydrophobicContact CD2-CE2 4.49Å; L48-F52 HydrophobicContact CG-CD2 4.13Å; L48-F52 HydrophobicContact CG-CE2 3.94Å; L48-F52 VanDerWaalsContact O-CD2 3.26Å; L48-F52 WeakPolarHBondContact O-CD2 3.34Å; L48-F52 PolarHBondContact O-N 3.39Å
49	K	96.6	Very high	94.4	Very high	85 Å²	85	102.5 Å²	102.5	37%	0.37	49%	0.487	S	S	.	.	H	α-helix	trans	-58.6	-42	177.4	-74.6	-171.1	171.2	-164.6	0	112.4	R45 I46 R51 F52 G53 I54 L55	R45-K49 WeakPolarHBondContact O-CB 3.33Å; R45-K49 VanDerWaalsContact O-CG 3.29Å; R45-K49 WeakPolarHBondContact O-CG 3.48Å; R45-K49 PolarHBondContact O-N 2.94Å; I46-K49 PolarHBondContact O-N 3.48Å; K49-R51 PolarHBondContact O-N 3.04Å; K49-F52 PolarHBondContact O-N 3.08Å; K49-G53 PolarHBondContact O-N 2.94Å; K49-I54 VanDerWaalsContact CA-CG1 3.49Å; K49-I54 HydrophobicContact CB-CD1 4.02Å; K49-I54 HydrophobicContact CB-CG1 3.72Å; K49-I54 HydrophobicContact CD-CD1 4.46Å; K49-I54 HydrophobicContact CG-CD1 3.64Å; K49-I54 HydrophobicContact CG-CG1 3.89Å; K49-I54 WeakPolarHBondContact O-CG1 3.29Å; K49-I54 PolarHBondContact O-N 2.98Å; K49-I54 VanDerWaalsContact O-N 3.13Å; K49-L55 HydrophobicContact CB-CD2 3.6Å; K49-L55 HydrophobicContact CB-CG 3.84Å; K49-L55 HydrophobicContact CD-CD2 4.05Å; K49-L55 HydrophobicContact CG-CD2 4.48Å
50	S	95.8	Very high	94.2	Very high	55 Å²	55	106.1 Å²	106.1	39%	0.385	51%	0.512	S	S	.	.	H	α-helix	trans	-61.2	-43.8	177.2	-173.3	0	0	0	0	111.9	I46 T47 L48 F52 G53 Q58	I46-S50 WeakPolarHBondContact O-CB 3.49Å; I46-S50 PolarHBondContact O-N 3.24Å; T47-S50 PolarHBondContact O-N 3.26Å; L48-S50 VanDerWaalsContact C-N 3.3Å; L48-S50 PolarHBondContact O-N 3.25Å; S50-F52 VanDerWaalsContact C-N 3.27Å; S50-F52 PolarHBondContact O-N 3.33Å; S50-G53 PolarHBondContact O-N 3.29Å; S50-G53 VanDerWaalsContact O-N 3.16Å; S50-Q58 PolarHBondContact O-NE2 3.12Å
51	R	96.5	Very high	93.9	Very high	193 Å²	193	102.8 Å²	102.8	73%	0.728	51%	0.514	S	S	*	.	H	α-helix	trans	-60.2	-35.3	179.8	-174	-178.3	-68.2	175	-2.5	113	T47 L48 K49	T47-R51 PolarHBondContact O-N 3.43Å; T47-R51 VanDerWaalsContact O-N 3.08Å; L48-R51 WeakPolarHBondContact O-CB 3.38Å; L48-R51 PolarHBondContact O-N 3.2Å; K49-R51 PolarHBondContact O-N 3.04Å
52	F	96.5	Very high	93.4	Very high	140 Å²	140	101.5 Å²	101.5	61%	0.614	52%	0.516	S	S	*	.	T	Hydrogen-bonded Turn	trans	-93.4	6.1	-179.7	-68.4	-71.1	0	0	0	114.1	L48 K49 S50 I54	L48-F52 HydrophobicContact CD1-CE2 4.08Å; L48-F52 HydrophobicContact CD2-CE2 4.49Å; L48-F52 HydrophobicContact CG-CD2 4.13Å; L48-F52 HydrophobicContact CG-CE2 3.94Å; L48-F52 VanDerWaalsContact O-CD2 3.26Å; L48-F52 WeakPolarHBondContact O-CD2 3.34Å; L48-F52 PolarHBondContact O-N 3.39Å; K49-F52 PolarHBondContact O-N 3.08Å; S50-F52 VanDerWaalsContact C-N 3.27Å; S50-F52 PolarHBondContact O-N 3.33Å; F52-I54 VanDerWaalsContact C-N 3.26Å; F52-I54 HydrophobicContact CB-CG1 4.35Å; F52-I54 HydrophobicContact CB-CG2 4.33Å; F52-I54 PolarHBondContact O-N 3.49Å
53	G	94	Very high	93.2	Very high	23 Å²	23	105.7 Å²	105.7	24%	0.237	54%	0.54	C	S	.	.	T	Hydrogen-bonded Turn	trans	69	22.7	178.1	0	0	0	0	0	113.9	K49 S50 Y59	K49-G53 PolarHBondContact O-N 2.94Å; S50-G53 PolarHBondContact O-N 3.29Å; S50-G53 VanDerWaalsContact O-N 3.16Å; G53-Y59 WeakPolarHBondContact O-CE2 3.39Å; G53-Y59 VanDerWaalsContact O-CZ 3.26Å; G53-Y59 PolarHBondContact O-OH 3.46Å
54	I	93.9	Very high	92.8	Very high	93 Å²	93	109.6 Å²	109.6	48%	0.477	56%	0.556	S	S	.	*			trans	-101.9	4.6	-174.4	59	168.6	0	0	0	113.4	K49 F52	K49-I54 VanDerWaalsContact CA-CG1 3.49Å; K49-I54 HydrophobicContact CB-CD1 4.02Å; K49-I54 HydrophobicContact CB-CG1 3.72Å; K49-I54 HydrophobicContact CD-CD1 4.46Å; K49-I54 HydrophobicContact CG-CD1 3.64Å; K49-I54 HydrophobicContact CG-CG1 3.89Å; K49-I54 WeakPolarHBondContact O-CG1 3.29Å; K49-I54 PolarHBondContact O-N 2.98Å; K49-I54 VanDerWaalsContact O-N 3.13Å; F52-I54 VanDerWaalsContact C-N 3.26Å; F52-I54 HydrophobicContact CB-CG1 4.35Å; F52-I54 HydrophobicContact CB-CG2 4.33Å; F52-I54 PolarHBondContact O-N 3.49Å
55	L	93	Very high	92.6	Very high	28 Å²	28	109 Å²	109	15%	0.147	56%	0.556	C	S	.	*			trans	-76.6	135.1	175.1	-70.6	172.9	0	0	0	110.3	I46 K49 S57 Q58 Y59	I46-L55 HydrophobicContact CG2-CD1 4.36Å; K49-L55 HydrophobicContact CB-CD2 3.6Å; K49-L55 HydrophobicContact CB-CG 3.84Å; K49-L55 HydrophobicContact CD-CD2 4.05Å; K49-L55 HydrophobicContact CG-CD2 4.48Å; L55-S57 PolarHBondContact O-N 2.65Å; L55-S57 VanDerWaalsContact O-N 3.12Å; L55-Q58 HydrophobicContact CB-CG 4.06Å; L55-Q58 WeakPolarHBondContact O-CB 3.2Å; L55-Q58 PolarHBondContact O-N 2.67Å; L55-Y59 WeakPolarHBondContact O-CD2 3.38Å
56	P	89.9	Confident	92.4	Very high	103 Å²	103	108.3 Å²	108.3	67%	0.669	56%	0.561	S	S	*	*	G	3₁₀ helix	trans	-54.8	-32.8	175.8	-26.9	34.5	0	0	0	113.6	Q58 Y59	P56-Q58 PolarHBondContact O-N 2.91Å; P56-Y59 PolarHBondContact O-N 3.12Å; P56-Y59 VanDerWaalsContact O-N 3.16Å
57	S	90.5	Very high	92.3	Very high	107 Å²	107	109.3 Å²	109.3	75%	0.748	57%	0.566	S	S	*	*	G	3₁₀ helix	trans	-69.5	-11.9	178	62	0	0	0	0	114.5	L55	L55-S57 PolarHBondContact O-N 2.65Å; L55-S57 VanDerWaalsContact O-N 3.12Å
58	Q	90.5	Very high	92	Very high	87 Å²	87	111.8 Å²	111.8	41%	0.407	58%	0.576	S	S	.	*	G	3₁₀ helix	trans	-87.2	-14.4	174.8	-66	172.6	-59.5	0	0	112	S50 L55 P56	S50-Q58 PolarHBondContact O-NE2 3.12Å; L55-Q58 HydrophobicContact CB-CG 4.06Å; L55-Q58 WeakPolarHBondContact O-CB 3.2Å; L55-Q58 PolarHBondContact O-N 2.67Å; P56-Q58 PolarHBondContact O-N 2.91Å
59	Y	90	Very high	91.7	Very high	139 Å²	139	112.7 Å²	112.7	55%	0.545	58%	0.58	S	S	.	*	S	Bend	trans	-95.1	157.2	176.3	-66.2	-83.1	0	0	0	110.4	G53 L55 P56	G53-Y59 WeakPolarHBondContact O-CE2 3.39Å; G53-Y59 VanDerWaalsContact O-CZ 3.26Å; G53-Y59 PolarHBondContact O-OH 3.46Å; L55-Y59 WeakPolarHBondContact O-CD2 3.38Å; P56-Y59 PolarHBondContact O-N 3.12Å; P56-Y59 VanDerWaalsContact O-N 3.16Å
60	P	89.5	Confident	91.4	Very high	106 Å²	106	114.5 Å²	114.5	69%	0.688	59%	0.594	S	S	*	*	P	Polyproline II helix	trans	-55.9	150.7	170.4	23.9	-33.6	0	0	0	110.8	I62	P60-I62 PolarHBondContact O-N 3.23Å
61	P	87.1	Confident	91	Very high	114 Å²	114	118.8 Å²	118.8	74%	0.74	61%	0.609	S	S	*	*	P	Polyproline II helix	trans	-56.6	138.5	178.8	23.9	-33	0	0	0	110.6	V63	P61-V63 PolarHBondContact O-N 3.25Å
62	I	86.4	Confident	90.6	Very high	128 Å²	128	113.1 Å²	113.1	66%	0.656	60%	0.6	S	S	*	*	P	Polyproline II helix	trans	-67	116.4	176.9	-54.1	159.1	0	0	0	107.2	P60 Y64	P60-I62 PolarHBondContact O-N 3.23Å; I62-Y64 HydrophobicContact CB-CE2 4.37Å; I62-Y64 HydrophobicContact CG2-CD2 4.47Å; I62-Y64 HydrophobicContact CG2-CE1 4.34Å; I62-Y64 HydrophobicContact CG2-CE2 4.04Å
63	V	89.2	Confident	90.1	Very high	135 Å²	135	110.8 Å²	110.8	82%	0.818	60%	0.598	S	S	*	*	P	Polyproline II helix	trans	-92	123.2	173.5	-174	0	0	0	0	107.4	P61	P61-V63 PolarHBondContact O-N 3.25Å
64	Y	87.5	Confident	89.8	Confident	267 Å²	267	118.8 Å²	118.8	100%	1.047	63%	0.631	S	S	*	*			trans	-94.3	0	177.4	-68.8	-84.1	0	0	0	111.5	I62	I62-Y64 HydrophobicContact CB-CE2 4.37Å; I62-Y64 HydrophobicContact CG2-CD2 4.47Å; I62-Y64 HydrophobicContact CG2-CE1 4.34Å; I62-Y64 HydrophobicContact CG2-CE2 4.04Å

Retrieved 64 of 64 residues in 13.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).