C4QPS0_SCHMA Loading...

MEG-2 (ESP15) family

AlphaFold DB , UniProt , Accession C4QPS0, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 44 aa.

						>C4QPS0_SCHMA|C4QPS0
MTAKGSVAMASFVLVYDPSVAVKNYRQQVLMATKIKEVCQKFRG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	41	Very low	55.1	Low	242 Å²	242	130.5 Å²	130.5	100%	1.192	82%	0.817	S	S	*	*				0	116.1	0	-59.7	170	95.8	0	0	105.4
2	T	48.5	Very low	55.7	Low	142 Å²	142	135.5 Å²	135.5	87%	0.871	82%	0.819	S	S	*	*			cis	-147.6	153.1	24.1	22.4	0	0	0	0	109
3	A	49.2	Very low	56.7	Low	97 Å²	97	134.4 Å²	134.4	80%	0.802	81%	0.812	S	S	*	*			trans	-63.6	137.4	-173.7	0	0	0	0	0	113.9
4	K	57.4	Low	57.5	Low	198 Å²	198	136.8 Å²	136.8	86%	0.861	82%	0.817	S	S	*	*			trans	-134.4	67.4	154.9	-72.2	-169.8	179.3	178.4	0	109	S6	K4-S6 VanDerWaalsContact C-N 3.34Å; K4-S6 PolarHBondContact O-N 3.09Å; K4-S6 VanDerWaalsContact O-N 3.1Å
5	G	49.5	Very low	58.4	Low	70 Å²	70	136.2 Å²	136.2	72%	0.722	81%	0.814	S	S	*	*			trans	-69.8	95.5	161.7	0	0	0	0	0	107.9	V7	G5-V7 PolarHBondContact O-N 3.1Å
6	S	56.7	Low	59.4	Low	117 Å²	117	138.5 Å²	138.5	82%	0.818	81%	0.806	S	S	*	*			trans	-70.6	97.1	173.3	-64.5	0	0	0	0	108.6	K4 A8	K4-S6 VanDerWaalsContact C-N 3.34Å; K4-S6 PolarHBondContact O-N 3.09Å; K4-S6 VanDerWaalsContact O-N 3.1Å; S6-A8 PolarHBondContact O-N 3.34Å; S6-A8 VanDerWaalsContact O-N 3.12Å
7	V	60.5	Low	60.4	Low	127 Å²	127	134.9 Å²	134.9	77%	0.77	78%	0.783	S	S	*	*			trans	-71.6	102.5	168.2	-174	0	0	0	0	106.5	G5 M9	G5-V7 PolarHBondContact O-N 3.1Å; V7-M9 PolarHBondContact O-N 3.17Å; V7-M9 VanDerWaalsContact O-N 3.09Å
8	A	61	Low	61.5	Low	92 Å²	92	131.3 Å²	131.3	76%	0.76	76%	0.764	S	S	*	*			trans	-64.3	110.1	172.4	0	0	0	0	0	108.4	S6 A10	S6-A8 PolarHBondContact O-N 3.34Å; S6-A8 VanDerWaalsContact O-N 3.12Å; A8-A10 PolarHBondContact O-N 3.28Å
9	M	60.8	Low	62.7	Low	168 Å²	168	127.8 Å²	127.8	83%	0.828	75%	0.748	S	S	*	*			trans	-68.4	96	171.5	-78.4	-74	-73.5	0	0	108.4	V7 S11	V7-M9 PolarHBondContact O-N 3.17Å; V7-M9 VanDerWaalsContact O-N 3.09Å; M9-S11 PolarHBondContact O-N 3.43Å
10	A	61.7	Low	63.7	Low	73 Å²	73	125.1 Å²	125.1	60%	0.603	73%	0.733	S	S	*	*			trans	-62.5	106	170.7	0	0	0	0	0	108.5	A8 F12	A8-A10 PolarHBondContact O-N 3.28Å; A10-F12 HydrophobicContact CB-CE2 4.19Å; A10-F12 WeakPolarHBondContact O-CD2 3.34Å; A10-F12 PolarHBondContact O-N 3.38Å
11	S	59.6	Low	64.5	Low	109 Å²	109	120.9 Å²	120.9	76%	0.762	71%	0.712	S	S	*	*			trans	-76.6	103.7	173.4	-65.2	0	0	0	0	108.3	M9 V13	M9-S11 PolarHBondContact O-N 3.43Å; S11-V13 PolarHBondContact O-N 3.3Å
12	F	62.7	Low	66.7	Low	191 Å²	191	113.2 Å²	113.2	84%	0.838	68%	0.679	S	S	*	*			trans	-74.1	104.8	172.3	-70.3	-87.7	0	0	0	108.9	A10 L14	A10-F12 HydrophobicContact CB-CE2 4.19Å; A10-F12 WeakPolarHBondContact O-CD2 3.34Å; A10-F12 PolarHBondContact O-N 3.38Å; F12-L14 PolarHBondContact O-N 3.46Å
13	V	67.8	Low	68.6	Low	121 Å²	121	113.3 Å²	113.3	73%	0.733	67%	0.668	S	S	*	*			trans	-78.7	105.2	168.8	-179.1	0	0	0	0	107.4	S11 V15	S11-V13 PolarHBondContact O-N 3.3Å; V13-V15 HydrophobicContact CG1-CG2 4.34Å; V13-V15 PolarHBondContact O-N 3.19Å
14	L	68.6	Low	70.4	Confident	168 Å²	168	112.6 Å²	112.6	88%	0.88	65%	0.65	S	S	*	*			trans	-68.2	99.4	168	-85.1	161.1	0	0	0	108.4	F12 Y16	F12-L14 PolarHBondContact O-N 3.46Å; L14-Y16 PolarHBondContact O-N 2.93Å; L14-Y16 VanDerWaalsContact O-N 3.09Å
15	V	70.4	Confident	71.9	Confident	128 Å²	128	110.8 Å²	110.8	78%	0.776	64%	0.639	S	S	*	*			trans	-73.3	100.4	172.9	-177.6	0	0	0	0	107.9	V13 D17	V13-V15 HydrophobicContact CG1-CG2 4.34Å; V13-V15 PolarHBondContact O-N 3.19Å; V15-D17 PolarHBondContact O-N 3.35Å
16	Y	74.3	Confident	73.9	Confident	173 Å²	173	116.4 Å²	116.4	68%	0.678	64%	0.638	S	S	*	*			trans	-74.9	109.9	170.2	177.5	-104.7	0	0	0	109.1	L14 P18 A21	L14-Y16 PolarHBondContact O-N 2.93Å; L14-Y16 VanDerWaalsContact O-N 3.09Å; Y16-P18 HydrophobicContact CD1-CB 4.48Å; Y16-P18 HydrophobicContact CE1-CB 3.83Å; Y16-P18 HydrophobicContact CE1-CG 4.5Å; Y16-P18 WeakPolarHBondContact O-CD 3.48Å; Y16-A21 HydrophobicContact CE2-CB 4.36Å
17	D	77.8	Confident	75.5	Confident	77 Å²	77	116.7 Å²	116.7	41%	0.412	63%	0.627	S	S	.	*			trans	-93.2	103.1	170.3	-173.3	-14.7	0	0	0	109.8	V15 S19 V20 A21	V15-D17 PolarHBondContact O-N 3.35Å; D17-S19 PolarHBondContact O-N 3.31Å; D17-S19 VanDerWaalsContact O-N 3.15Å; D17-S19 WeakPolarHBondContact OD1-CA 3.46Å; D17-S19 WeakPolarHBondContact OD1-CB 3.43Å; D17-S19 PolarHBondContact OD1-N 3.49Å; D17-S19 PolarHBondContact OD1-OG 2.97Å; D17-V20 HydrophobicContact CB-CB 4.49Å; D17-V20 HydrophobicContact CB-CG2 3.97Å; D17-V20 PolarHBondContact O-N 3.47Å; D17-V20 VanDerWaalsContact O-N 3.16Å; D17-A21 PolarHBondContact O-N 3.41Å
18	P	80	Confident	77	Confident	70 Å²	70	117.1 Å²	117.1	46%	0.455	62%	0.62	S	S	.	*	H	α-helix	trans	-60.2	-24.3	178	23.1	-32.3	0	0	0	112.8	Y16 V20 A21 V22	Y16-P18 HydrophobicContact CD1-CB 4.48Å; Y16-P18 HydrophobicContact CE1-CB 3.83Å; Y16-P18 HydrophobicContact CE1-CG 4.5Å; Y16-P18 WeakPolarHBondContact O-CD 3.48Å; P18-V20 VanDerWaalsContact C-N 3.32Å; P18-V20 PolarHBondContact O-N 3.38Å; P18-A21 PolarHBondContact O-N 3.27Å; P18-V22 VanDerWaalsContact O-CG2 3.27Å; P18-V22 WeakPolarHBondContact O-CG2 3.19Å; P18-V22 PolarHBondContact O-N 3.24Å
19	S	84.3	Confident	78.6	Confident	65 Å²	65	115.7 Å²	115.7	46%	0.455	60%	0.602	S	S	.	*	H	α-helix	trans	-65.8	-37.4	179	-42.3	0	0	0	0	111.5	D17 K23	D17-S19 PolarHBondContact O-N 3.31Å; D17-S19 VanDerWaalsContact O-N 3.15Å; D17-S19 WeakPolarHBondContact OD1-CA 3.46Å; D17-S19 WeakPolarHBondContact OD1-CB 3.43Å; D17-S19 PolarHBondContact OD1-N 3.49Å; D17-S19 PolarHBondContact OD1-OG 2.97Å; S19-K23 WeakPolarHBondContact O-CB 3.46Å; S19-K23 VanDerWaalsContact O-CG 3.28Å; S19-K23 WeakPolarHBondContact O-CG 3.49Å; S19-K23 PolarHBondContact O-N 2.93Å
20	V	81.7	Confident	80.1	Confident	74 Å²	74	112.8 Å²	112.8	45%	0.448	59%	0.589	S	S	.	*	H	α-helix	trans	-67.3	-44.4	176.2	178.6	0	0	0	0	109.9	D17 P18 V22 K23 N24	D17-V20 HydrophobicContact CB-CB 4.49Å; D17-V20 HydrophobicContact CB-CG2 3.97Å; D17-V20 PolarHBondContact O-N 3.47Å; D17-V20 VanDerWaalsContact O-N 3.16Å; P18-V20 VanDerWaalsContact C-N 3.32Å; P18-V20 PolarHBondContact O-N 3.38Å; V20-V22 PolarHBondContact O-N 2.96Å; V20-K23 PolarHBondContact O-N 3.32Å; V20-N24 WeakPolarHBondContact O-CB 3.45Å; V20-N24 PolarHBondContact O-N 3.44Å
21	A	81.8	Confident	81.6	Confident	36 Å²	36	115.1 Å²	115.1	30%	0.298	59%	0.589	S	S	.	*	H	α-helix	trans	-59.6	-45.3	176.5	0	0	0	0	0	111.7	Y16 D17 P18 N24 Y25	Y16-A21 HydrophobicContact CE2-CB 4.36Å; D17-A21 PolarHBondContact O-N 3.41Å; P18-A21 PolarHBondContact O-N 3.27Å; A21-N24 PolarHBondContact O-N 2.84Å; A21-Y25 WeakPolarHBondContact O-CB 3.4Å; A21-Y25 PolarHBondContact O-N 3.05Å
22	V	85.7	Confident	83.1	Confident	81 Å²	81	112.7 Å²	112.7	49%	0.491	58%	0.576	S	S	.	*	H	α-helix	trans	-65.2	-40.7	178.2	171.7	0	0	0	0	112	P18 V20 Y25 R26	P18-V22 VanDerWaalsContact O-CG2 3.27Å; P18-V22 WeakPolarHBondContact O-CG2 3.19Å; P18-V22 PolarHBondContact O-N 3.24Å; V20-V22 PolarHBondContact O-N 2.96Å; V22-Y25 PolarHBondContact O-N 3Å; V22-R26 WeakPolarHBondContact O-CB 3.31Å; V22-R26 PolarHBondContact O-N 3.26Å
23	K	88.1	Confident	84.6	Confident	145 Å²	145	106.9 Å²	106.9	63%	0.63	56%	0.556	S	S	*	*	H	α-helix	trans	-62.4	-47.1	175.7	-77.5	175.8	-176.6	178.6	0	111.5	S19 V20 Y25 R26 Q27	S19-K23 WeakPolarHBondContact O-CB 3.46Å; S19-K23 VanDerWaalsContact O-CG 3.28Å; S19-K23 WeakPolarHBondContact O-CG 3.49Å; S19-K23 PolarHBondContact O-N 2.93Å; V20-K23 PolarHBondContact O-N 3.32Å; K23-Y25 VanDerWaalsContact C-N 3.35Å; K23-Y25 PolarHBondContact O-N 3.48Å; K23-R26 PolarHBondContact O-N 3.4Å; K23-Q27 PolarHBondContact O-N 2.97Å
24	N	87.1	Confident	85.9	Confident	82 Å²	82	107.3 Å²	107.3	44%	0.439	55%	0.548	S	S	.	.	H	α-helix	trans	-61.1	-44.5	177.7	-73.7	-8.8	0	0	0	111.3	V20 A21 Q27 Q28	V20-N24 WeakPolarHBondContact O-CB 3.45Å; V20-N24 PolarHBondContact O-N 3.44Å; A21-N24 PolarHBondContact O-N 2.84Å; N24-Q27 PolarHBondContact O-N 3.32Å; N24-Q28 WeakPolarHBondContact O-CG 3.46Å; N24-Q28 PolarHBondContact O-N 3.49Å
25	Y	89.6	Confident	87	Confident	160 Å²	160	104.4 Å²	104.4	63%	0.627	53%	0.532	S	S	*	.	H	α-helix	trans	-61.6	-47.1	176.9	-176.9	-102.5	0	0	0	112.1	A21 V22 K23 Q27 Q28 V29	A21-Y25 WeakPolarHBondContact O-CB 3.4Å; A21-Y25 PolarHBondContact O-N 3.05Å; V22-Y25 PolarHBondContact O-N 3Å; K23-Y25 VanDerWaalsContact C-N 3.35Å; K23-Y25 PolarHBondContact O-N 3.48Å; Y25-Q27 VanDerWaalsContact C-N 3.32Å; Y25-Q27 PolarHBondContact O-N 2.99Å; Y25-Q28 PolarHBondContact O-N 3.1Å; Y25-V29 HydrophobicContact CD1-CG2 4.17Å; Y25-V29 HydrophobicContact CE1-CG2 3.73Å; Y25-V29 HydrophobicContact CE2-CG2 4.21Å; Y25-V29 WeakPolarHBondContact O-CG2 3.41Å; Y25-V29 PolarHBondContact O-N 2.93Å
26	R	91.1	Very high	88.1	Confident	187 Å²	187	104.7 Å²	104.7	71%	0.706	52%	0.523	S	S	*	.	H	α-helix	trans	-58.8	-42.1	176.3	-84.1	-175	167	-169.4	-2.3	112.4	V22 K23 V29 L30	V22-R26 WeakPolarHBondContact O-CB 3.31Å; V22-R26 PolarHBondContact O-N 3.26Å; K23-R26 PolarHBondContact O-N 3.4Å; R26-V29 PolarHBondContact O-N 3.2Å; R26-L30 WeakPolarHBondContact O-CB 3.38Å; R26-L30 PolarHBondContact O-N 3.02Å
27	Q	91.2	Very high	89	Confident	123 Å²	123	101.7 Å²	101.7	58%	0.575	52%	0.515	S	S	*	.	H	α-helix	trans	-62.5	-43.7	176.4	-82.6	-175.2	-19.2	0	0	112	K23 N24 Y25 L30 M31	K23-Q27 PolarHBondContact O-N 2.97Å; N24-Q27 PolarHBondContact O-N 3.32Å; Y25-Q27 VanDerWaalsContact C-N 3.32Å; Y25-Q27 PolarHBondContact O-N 2.99Å; Q27-L30 PolarHBondContact O-N 3.31Å; Q27-M31 WeakPolarHBondContact O-CG 3.28Å; Q27-M31 PolarHBondContact O-N 2.92Å
28	Q	92.3	Very high	89.6	Confident	136 Å²	136	101.5 Å²	101.5	64%	0.636	52%	0.517	S	S	*	.	H	α-helix	trans	-61.6	-46.2	177.4	-72.7	-177.1	27.2	0	0	112.2	N24 Y25 L30 M31 A32	N24-Q28 WeakPolarHBondContact O-CG 3.46Å; N24-Q28 PolarHBondContact O-N 3.49Å; Y25-Q28 PolarHBondContact O-N 3.1Å; Q28-L30 VanDerWaalsContact C-N 3.3Å; Q28-L30 PolarHBondContact O-N 3.4Å; Q28-M31 PolarHBondContact O-N 3.34Å; Q28-A32 PolarHBondContact O-N 2.99Å
29	V	93.3	Very high	90.2	Very high	63 Å²	63	101.9 Å²	101.9	38%	0.382	52%	0.521	S	S	.	.	H	α-helix	trans	-60.4	-42.7	177.5	174.1	0	0	0	0	110.8	Y25 R26 M31 A32 T33	Y25-V29 HydrophobicContact CD1-CG2 4.17Å; Y25-V29 HydrophobicContact CE1-CG2 3.73Å; Y25-V29 HydrophobicContact CE2-CG2 4.21Å; Y25-V29 WeakPolarHBondContact O-CG2 3.41Å; Y25-V29 PolarHBondContact O-N 2.93Å; R26-V29 PolarHBondContact O-N 3.2Å; V29-M31 PolarHBondContact O-N 3.38Å; V29-A32 PolarHBondContact O-N 3.48Å; V29-T33 PolarHBondContact O-N 3.45Å; V29-T33 PolarHBondContact O-OG1 2.92Å; V29-T33 VanDerWaalsContact O-OG1 3.05Å
30	L	93.5	Very high	90.5	Very high	106 Å²	106	104.8 Å²	104.8	56%	0.555	53%	0.527	S	S	*	.	H	α-helix	trans	-66.9	-38	-179.1	-158.7	127.2	0	0	0	112.4	R26 Q27 Q28 K34	R26-L30 WeakPolarHBondContact O-CB 3.38Å; R26-L30 PolarHBondContact O-N 3.02Å; Q27-L30 PolarHBondContact O-N 3.31Å; Q28-L30 VanDerWaalsContact C-N 3.3Å; Q28-L30 PolarHBondContact O-N 3.4Å; L30-K34 HydrophobicContact CD2-CD 4.43Å; L30-K34 PolarHBondContact O-N 3.39Å; L30-K34 VanDerWaalsContact O-N 3.1Å
31	M	92.7	Very high	90.9	Very high	122 Å²	122	109.3 Å²	109.3	60%	0.601	54%	0.54	S	S	*	.	H	α-helix	trans	-64.5	-45.6	172.9	-72.4	-171.8	-175.5	0	0	111.7	Q27 Q28 V29 T33 K34 I35	Q27-M31 WeakPolarHBondContact O-CG 3.28Å; Q27-M31 PolarHBondContact O-N 2.92Å; Q28-M31 PolarHBondContact O-N 3.34Å; V29-M31 PolarHBondContact O-N 3.38Å; M31-T33 VanDerWaalsContact C-N 3.33Å; M31-T33 PolarHBondContact O-N 3.03Å; M31-K34 PolarHBondContact O-N 3.31Å; M31-I35 VanDerWaalsContact O-CG1 3.31Å; M31-I35 WeakPolarHBondContact O-CG1 3.45Å; M31-I35 PolarHBondContact O-N 3.49Å
32	A	92.2	Very high	91	Very high	58 Å²	58	115.8 Å²	115.8	48%	0.479	56%	0.562	S	S	.	*	H	α-helix	trans	-59.9	-42.7	178.6	0	0	0	0	0	111.9	Q28 V29 I35 K36	Q28-A32 PolarHBondContact O-N 2.99Å; V29-A32 PolarHBondContact O-N 3.48Å; A32-I35 PolarHBondContact O-N 3.33Å; A32-K36 WeakPolarHBondContact O-CB 3.44Å; A32-K36 PolarHBondContact O-N 2.97Å
33	T	93.4	Very high	90.7	Very high	70 Å²	70	123 Å²	123	43%	0.429	58%	0.581	S	S	.	*	H	α-helix	trans	-63.5	-45.5	176.4	-56.6	0	0	0	0	111.7	V29 M31 I35 K36 E37	V29-T33 PolarHBondContact O-N 3.45Å; V29-T33 PolarHBondContact O-OG1 2.92Å; V29-T33 VanDerWaalsContact O-OG1 3.05Å; M31-T33 VanDerWaalsContact C-N 3.33Å; M31-T33 PolarHBondContact O-N 3.03Å; T33-I35 PolarHBondContact O-N 3Å; T33-K36 WeakPolarHBondContact O-CB 3.27Å; T33-K36 PolarHBondContact O-N 2.92Å; T33-E37 PolarHBondContact O-N 3.44Å
34	K	93.8	Very high	89.2	Confident	129 Å²	129	122 Å²	122	56%	0.561	61%	0.612	S	S	*	*	H	α-helix	trans	-61.1	-43.3	176.4	-82.6	-175.1	174.1	-176.7	0	112.4	L30 M31 K36 E37 V38	L30-K34 HydrophobicContact CD2-CD 4.43Å; L30-K34 PolarHBondContact O-N 3.39Å; L30-K34 VanDerWaalsContact O-N 3.1Å; M31-K34 PolarHBondContact O-N 3.31Å; K34-K36 VanDerWaalsContact C-N 3.29Å; K34-K36 PolarHBondContact O-N 3.45Å; K34-E37 PolarHBondContact O-N 3.15Å; K34-V38 VanDerWaalsContact O-CG2 3.28Å; K34-V38 WeakPolarHBondContact O-CG2 3.44Å; K34-V38 PolarHBondContact O-N 3.09Å
35	I	93.3	Very high	89.4	Confident	107 Å²	107	124.1 Å²	124.1	55%	0.549	62%	0.621	S	S	.	*	H	α-helix	trans	-60.3	-44.5	176.4	-68.7	166.1	0	0	0	109.8	M31 A32 T33 E37 V38 C39	M31-I35 VanDerWaalsContact O-CG1 3.31Å; M31-I35 WeakPolarHBondContact O-CG1 3.45Å; M31-I35 PolarHBondContact O-N 3.49Å; A32-I35 PolarHBondContact O-N 3.33Å; T33-I35 PolarHBondContact O-N 3Å; I35-E37 PolarHBondContact O-N 2.86Å; I35-V38 PolarHBondContact O-N 3.03Å; I35-C39 WeakPolarHBondContact O-CB 3.48Å; I35-C39 PolarHBondContact O-N 3.32Å; I35-C39 PolarHBondContact O-SG 3.22Å
36	K	92.5	Very high	89.3	Confident	135 Å²	135	122.2 Å²	122.2	59%	0.587	62%	0.62	S	S	*	*	H	α-helix	trans	-60	-45.4	177.2	-172.8	-178.6	178.6	-177.2	0	112.3	A32 T33 K34 V38 C39 Q40	A32-K36 WeakPolarHBondContact O-CB 3.44Å; A32-K36 PolarHBondContact O-N 2.97Å; T33-K36 WeakPolarHBondContact O-CB 3.27Å; T33-K36 PolarHBondContact O-N 2.92Å; K34-K36 VanDerWaalsContact C-N 3.29Å; K34-K36 PolarHBondContact O-N 3.45Å; K36-V38 VanDerWaalsContact C-N 3.34Å; K36-V38 PolarHBondContact O-N 3.3Å; K36-C39 PolarHBondContact O-N 2.95Å; K36-Q40 WeakPolarHBondContact O-CB 3.22Å; K36-Q40 WeakPolarHBondContact O-CG 3.05Å; K36-Q40 PolarHBondContact O-N 3.16Å
37	E	92.8	Very high	89.2	Confident	109 Å²	109	118.6 Å²	118.6	51%	0.509	62%	0.616	S	S	.	*	H	α-helix	trans	-60.1	-43.7	175.7	-74.1	179	172.2	0	0	111.9	T33 K34 I35 Q40 K41	T33-E37 PolarHBondContact O-N 3.44Å; K34-E37 PolarHBondContact O-N 3.15Å; I35-E37 PolarHBondContact O-N 2.86Å; E37-Q40 PolarHBondContact O-N 2.81Å; E37-K41 WeakPolarHBondContact O-CG 3.28Å; E37-K41 PolarHBondContact O-N 3.04Å; E37-K41 VanDerWaalsContact O-N 3.1Å
38	V	92.1	Very high	89.1	Confident	74 Å²	74	118.3 Å²	118.3	45%	0.448	62%	0.618	S	S	.	*	H	α-helix	trans	-62.8	-49.8	176.9	172.9	0	0	0	0	110.3	K34 I35 K36 Q40 K41 F42	K34-V38 VanDerWaalsContact O-CG2 3.28Å; K34-V38 WeakPolarHBondContact O-CG2 3.44Å; K34-V38 PolarHBondContact O-N 3.09Å; I35-V38 PolarHBondContact O-N 3.03Å; K36-V38 VanDerWaalsContact C-N 3.34Å; K36-V38 PolarHBondContact O-N 3.3Å; V38-Q40 VanDerWaalsContact C-N 3.25Å; V38-Q40 PolarHBondContact O-N 3.01Å; V38-K41 WeakPolarHBondContact O-CB 3.41Å; V38-K41 PolarHBondContact O-N 3.12Å; V38-K41 VanDerWaalsContact O-N 3.09Å; V38-F42 HydrophobicContact CG1-CD2 3.91Å; V38-F42 HydrophobicContact CG1-CE2 3.57Å; V38-F42 WeakPolarHBondContact O-CD2 3.43Å; V38-F42 PolarHBondContact O-N 3.1Å
39	C	92	Very high	88.9	Confident	78 Å²	78	117.2 Å²	117.2	53%	0.527	62%	0.617	S	S	.	*	H	α-helix	trans	-59.7	-35.2	177.6	-68.6	0	0	0	0	112.7	I35 K36 F42 R43	I35-C39 WeakPolarHBondContact O-CB 3.48Å; I35-C39 PolarHBondContact O-N 3.32Å; I35-C39 PolarHBondContact O-SG 3.22Å; K36-C39 PolarHBondContact O-N 2.95Å; C39-F42 PolarHBondContact O-N 3.3Å; C39-R43 PolarHBondContact O-N 3.21Å
40	Q	90.9	Very high	88.6	Confident	126 Å²	126	120.8 Å²	120.8	59%	0.589	63%	0.633	S	S	*	*	H	α-helix	trans	-66.7	-38.6	175.4	-78.3	-178.2	-19.2	0	0	112.4	K36 E37 V38 F42 R43	K36-Q40 WeakPolarHBondContact O-CB 3.22Å; K36-Q40 WeakPolarHBondContact O-CG 3.05Å; K36-Q40 PolarHBondContact O-N 3.16Å; E37-Q40 PolarHBondContact O-N 2.81Å; V38-Q40 VanDerWaalsContact C-N 3.25Å; V38-Q40 PolarHBondContact O-N 3.01Å; Q40-F42 PolarHBondContact O-N 2.99Å; Q40-R43 PolarHBondContact O-N 3.09Å
41	K	90.1	Very high	88.3	Confident	168 Å²	168	121.9 Å²	121.9	73%	0.73	64%	0.638	S	S	*	*	H	α-helix	trans	-63.1	-29.1	175.5	-73.2	179.3	-179.9	179.9	0	113.4	E37 V38	E37-K41 WeakPolarHBondContact O-CG 3.28Å; E37-K41 PolarHBondContact O-N 3.04Å; E37-K41 VanDerWaalsContact O-N 3.1Å; V38-K41 WeakPolarHBondContact O-CB 3.41Å; V38-K41 PolarHBondContact O-N 3.12Å; V38-K41 VanDerWaalsContact O-N 3.09Å
42	F	82.8	Confident	88	Confident	173 Å²	173	121.8 Å²	121.8	76%	0.759	64%	0.641	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.4	-6.9	177.6	-74.3	-73.3	0	0	0	114	V38 C39 Q40	V38-F42 HydrophobicContact CG1-CD2 3.91Å; V38-F42 HydrophobicContact CG1-CE2 3.57Å; V38-F42 WeakPolarHBondContact O-CD2 3.43Å; V38-F42 PolarHBondContact O-N 3.1Å; C39-F42 PolarHBondContact O-N 3.3Å; Q40-F42 PolarHBondContact O-N 2.99Å
43	R	79.5	Confident	87.6	Confident	232 Å²	232	127.2 Å²	127.2	88%	0.875	65%	0.654	S	S	*	*			trans	-95.3	-3.4	-176.3	-152.2	-177	176.7	-174.7	-0.6	113.7	C39 Q40	C39-R43 PolarHBondContact O-N 3.21Å; Q40-R43 PolarHBondContact O-N 3.09Å
44	G	58.2	Low	87.1	Confident	125 Å²	125	132.4 Å²	132.4	100%	1.289	68%	0.675	S	S	*	*			trans	-132.3	0	175.5	0	0	0	0	0	110.9

Retrieved 44 of 44 residues in 14.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).