D2HUF4_AILME Loading...

Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit TMEM258

Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity.

AlphaFold DB , UniProt , Accession D2HUF4, Species AILME (Ailuropoda melanoleuca, Giant panda), Gene n/a, Length 78 aa.

						>D2HUF4_AILME|D2HUF4
ELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLWVGIYV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	E	49.4	Very low	56.9	Low	222 Å²	222	149.5 Å²	149.5	100%	1.037	78%	0.777	S	S	*	*				0	-47.6	0	-45.5	-53.8	80.6	0	0	115.7
2	L	54.8	Low	57.2	Low	145 Å²	145	140.8 Å²	140.8	76%	0.759	74%	0.735	S	S	*	*			trans	-101.2	-14.9	-179.1	-74.5	170.8	0	0	0	116.1	A4	L2-A4 VanDerWaalsContact C-N 3.31Å; L2-A4 PolarHBondContact O-N 3.45Å
3	E	53.7	Low	57.8	Low	203 Å²	203	137.8 Å²	137.8	95%	0.949	72%	0.72	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.1	-9.3	-178.1	-78.6	173.5	91.2	0	0	114.8
4	A	55.8	Low	58.5	Low	94 Å²	94	133.8 Å²	133.8	78%	0.777	71%	0.707	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94	1	178.5	0	0	0	0	0	113.7	L2 S6	L2-A4 VanDerWaalsContact C-N 3.31Å; L2-A4 PolarHBondContact O-N 3.45Å; A4-S6 VanDerWaalsContact C-N 3.31Å; A4-S6 PolarHBondContact O-N 3.36Å
5	M	58	Low	59.3	Low	152 Å²	152	129 Å²	129	75%	0.749	69%	0.694	S	S	*	*			trans	-75.5	88.1	170.3	-80.8	-172.5	-174.2	0	0	108.8	R7	M5-R7 PolarHBondContact O-N 2.9Å; M5-R7 VanDerWaalsContact O-N 3.12Å
6	S	60.3	Low	60.3	Low	107 Å²	107	124.8 Å²	124.8	75%	0.748	67%	0.674	S	S	*	*			trans	-49.7	122.7	163.6	61	0	0	0	0	107.8	A4 Y8	A4-S6 VanDerWaalsContact C-N 3.31Å; A4-S6 PolarHBondContact O-N 3.36Å; S6-Y8 PolarHBondContact O-N 2.98Å
7	R	58.8	Low	61.2	Low	234 Å²	234	119.1 Å²	119.1	88%	0.883	64%	0.641	S	S	*	*			trans	-45.3	120.1	178.1	-173.6	177.5	-174.9	170.9	1.9	108.4	M5 T9	M5-R7 PolarHBondContact O-N 2.9Å; M5-R7 VanDerWaalsContact O-N 3.12Å; R7-T9 VanDerWaalsContact C-N 3.26Å; R7-T9 PolarHBondContact O-N 2.58Å
8	Y	56.7	Low	62.2	Low	198 Å²	198	114.4 Å²	114.4	78%	0.776	62%	0.618	S	S	*	*			trans	-60.4	96.9	173.6	-177.6	-95.3	0	0	0	107.1	S6	S6-Y8 PolarHBondContact O-N 2.98Å
9	T	56.2	Low	63.3	Low	118 Å²	118	115.7 Å²	115.7	72%	0.724	62%	0.62	S	S	*	*			trans	-84.5	120	168	-152.3	0	0	0	0	104.5	R7 P11	R7-T9 VanDerWaalsContact C-N 3.26Å; R7-T9 PolarHBondContact O-N 2.58Å; T9-P11 WeakPolarHBondContact O-CD 3.36Å; T9-P11 VanDerWaalsContact O-N 3.09Å
10	S	56.8	Low	64.4	Low	60 Å²	60	113.2 Å²	113.2	42%	0.42	61%	0.606	S	S	.	*			trans	-54.4	120.7	175.1	50.4	0	0	0	0	107.4	V12	S10-V12 PolarHBondContact O-N 3.46Å; S10-V12 PolarHBondContact OG-O 3.01Å
11	P	65.4	Low	65.5	Low	111 Å²	111	107.9 Å²	107.9	72%	0.721	58%	0.578	S	S	*	*	S	Bend	trans	-62.3	-11.3	-173.2	21.6	-31.8	0	0	0	113.1	T9	T9-P11 WeakPolarHBondContact O-CD 3.36Å; T9-P11 VanDerWaalsContact O-N 3.09Å
12	V	60.4	Low	67.3	Low	45 Å²	45	101.6 Å²	101.6	27%	0.273	55%	0.554	S	S	.	*	S	Bend	trans	-120.6	124.4	176.1	-171.2	0	0	0	0	108.9	S10 V16 F17 L20	S10-V12 PolarHBondContact O-N 3.46Å; S10-V12 PolarHBondContact OG-O 3.01Å; V12-V16 HydrophobicContact CG1-CG2 3.4Å; V12-V16 VanDerWaalsContact CG1-CG2 3.4Å; V12-F17 HydrophobicContact CB-CD1 4.35Å; V12-F17 HydrophobicContact CB-CE1 3.48Å; V12-F17 VanDerWaalsContact CB-CE1 3.48Å; V12-F17 HydrophobicContact CB-CZ 4.01Å; V12-F17 HydrophobicContact CG1-CD1 3.55Å; V12-F17 HydrophobicContact CG1-CE1 3.17Å; V12-F17 HydrophobicContact CG1-CZ 4.02Å; V12-F17 HydrophobicContact CG2-CE1 4.42Å; V12-L20 HydrophobicContact CG1-CD1 4.31Å
13	N	64.7	Low	69.1	Low	102 Å²	102	98.6 Å²	98.6	55%	0.545	54%	0.541	S	S	.	.			trans	-69.1	131.9	176.3	-174.3	-6.3	0	0	0	109.5	A15 V16	N13-A15 PolarHBondContact O-N 3.36Å; N13-A15 PolarHBondContact OD1-N 3.18Å; N13-V16 HydrophobicContact CB-CG2 4.33Å; N13-V16 WeakPolarHBondContact O-CG2 3.47Å; N13-V16 PolarHBondContact O-N 3.2Å
14	P	67.6	Low	70.8	Confident	82 Å²	82	90.3 Å²	90.3	53%	0.532	50%	0.504	S	S	.	.	T	Hydrogen-bonded Turn	trans	-51.2	-28.2	177.4	-29.4	34.3	0	0	0	115.1	V16 F17	P14-V16 VanDerWaalsContact C-N 3.27Å; P14-V16 PolarHBondContact O-N 3.43Å; P14-F17 VanDerWaalsContact CA-CD2 3.49Å; P14-F17 HydrophobicContact CB-CD2 4.25Å; P14-F17 HydrophobicContact CB-CE2 4.18Å; P14-F17 HydrophobicContact CG-CE2 4.33Å
15	A	71.3	Confident	72.4	Confident	62 Å²	62	87.5 Å²	87.5	51%	0.512	48%	0.475	S	S	.	.	T	Hydrogen-bonded Turn	trans	-65.2	-24.2	176.8	0	0	0	0	0	114.4	N13	N13-A15 PolarHBondContact O-N 3.36Å; N13-A15 PolarHBondContact OD1-N 3.18Å
16	V	75.3	Confident	74.1	Confident	62 Å²	62	82.7 Å²	82.7	38%	0.376	46%	0.46	S	S	.	.	T	Hydrogen-bonded Turn	trans	-95.9	-13.6	-177.4	-59.9	0	0	0	0	113.7	V12 N13 P14 H19 L20	V12-V16 HydrophobicContact CG1-CG2 3.4Å; V12-V16 VanDerWaalsContact CG1-CG2 3.4Å; N13-V16 HydrophobicContact CB-CG2 4.33Å; N13-V16 WeakPolarHBondContact O-CG2 3.47Å; N13-V16 PolarHBondContact O-N 3.2Å; P14-V16 VanDerWaalsContact C-N 3.27Å; P14-V16 PolarHBondContact O-N 3.43Å; V16-H19 PolarHBondContact O-N 2.76Å; V16-L20 HydrophobicContact CG2-CD1 4.28Å; V16-L20 WeakPolarHBondContact O-CG 3.47Å; V16-L20 PolarHBondContact O-N 2.81Å
17	F	74.8	Confident	75.5	Confident	28 Å²	28	80.8 Å²	80.8	12%	0.123	44%	0.44	C	S	.	.	H	α-helix	trans	-53.3	-52.1	174.6	-64.3	-38.3	0	0	0	113.7	V12 P14 H19 L20 T21 F69 L72	V12-F17 HydrophobicContact CB-CD1 4.35Å; V12-F17 HydrophobicContact CB-CE1 3.48Å; V12-F17 VanDerWaalsContact CB-CE1 3.48Å; V12-F17 HydrophobicContact CB-CZ 4.01Å; V12-F17 HydrophobicContact CG1-CD1 3.55Å; V12-F17 HydrophobicContact CG1-CE1 3.17Å; V12-F17 HydrophobicContact CG1-CZ 4.02Å; V12-F17 HydrophobicContact CG2-CE1 4.42Å; P14-F17 VanDerWaalsContact CA-CD2 3.49Å; P14-F17 HydrophobicContact CB-CD2 4.25Å; P14-F17 HydrophobicContact CB-CE2 4.18Å; P14-F17 HydrophobicContact CG-CE2 4.33Å; F17-H19 VanDerWaalsContact C-N 3.29Å; F17-H19 PolarHBondContact O-N 3.2Å; F17-L20 PolarHBondContact O-N 3.46Å; F17-T21 WeakPolarHBondContact O-CB 3.44Å; F17-T21 PolarHBondContact O-N 3.01Å; F17-T21 PolarHBondContact O-OG1 2.91Å; F17-F69 HydrophobicContact CD1-CD1 4.01Å; F17-F69 HydrophobicContact CD1-CE1 4.38Å; F17-L72 HydrophobicContact CD2-CB 4.42Å; F17-L72 HydrophobicContact CE1-CD1 4.41Å; F17-L72 HydrophobicContact CG-CB 4.5Å
18	P	79.6	Confident	77	Confident	35 Å²	35	69.7 Å²	69.7	23%	0.227	40%	0.398	C	S	.	.	H	α-helix	trans	-61.8	-36.2	-178.5	20.7	-32	0	0	0	112.9	V22 W73	P18-V22 WeakPolarHBondContact O-CB 3.34Å; P18-V22 WeakPolarHBondContact O-CG2 3.33Å; P18-V22 PolarHBondContact O-N 2.93Å; P18-W73 HydrophobicContact CB-CD2 4.32Å; P18-W73 HydrophobicContact CB-CG 4.32Å
19	H	83.1	Confident	78.6	Confident	139 Å²	139	65.4 Å²	65.4	64%	0.644	39%	0.387	S	S	*	.	H	α-helix	trans	-67.3	-45.3	177.5	-74	84.8	0	0	0	111.6	V16 F17 V22 V23	V16-H19 PolarHBondContact O-N 2.76Å; F17-H19 VanDerWaalsContact C-N 3.29Å; F17-H19 PolarHBondContact O-N 3.2Å; H19-V22 PolarHBondContact O-N 2.9Å; H19-V23 VanDerWaalsContact O-CG2 3.31Å; H19-V23 WeakPolarHBondContact O-CG2 3.42Å; H19-V23 PolarHBondContact O-N 3.49Å; H19-V23 VanDerWaalsContact O-N 3.09Å
20	L	85.3	Confident	80.3	Confident	65 Å²	65	66.1 Å²	66.1	34%	0.34	38%	0.38	S	S	.	.	H	α-helix	trans	-63.5	-48.1	177	-68.6	171.9	0	0	0	111.1	V12 V16 F17 V22 V23 L24 F69	V12-L20 HydrophobicContact CG1-CD1 4.31Å; V16-L20 HydrophobicContact CG2-CD1 4.28Å; V16-L20 WeakPolarHBondContact O-CG 3.47Å; V16-L20 PolarHBondContact O-N 2.81Å; F17-L20 PolarHBondContact O-N 3.46Å; L20-V22 VanDerWaalsContact C-N 3.35Å; L20-V22 PolarHBondContact O-N 3.44Å; L20-V23 PolarHBondContact O-N 3.25Å; L20-L24 HydrophobicContact CB-CD1 4.35Å; L20-L24 WeakPolarHBondContact O-CB 3.29Å; L20-L24 WeakPolarHBondContact O-CD1 3.38Å; L20-L24 PolarHBondContact O-N 3.25Å; L20-F69 HydrophobicContact CB-CD1 4.45Å; L20-F69 HydrophobicContact CB-CG 4.47Å; L20-F69 HydrophobicContact CD1-CE1 4.05Å; L20-F69 HydrophobicContact CD1-CZ 4.38Å
21	T	87.1	Confident	81.7	Confident	2 Å²	2	66.4 Å²	66.4	1%	0.012	37%	0.374	C	S	.	.	H	α-helix	trans	-52.5	-52.1	176.3	-59.8	0	0	0	0	111.5	F17 V23 L24 L25 F69 L70	F17-T21 WeakPolarHBondContact O-CB 3.44Å; F17-T21 PolarHBondContact O-N 3.01Å; F17-T21 PolarHBondContact O-OG1 2.91Å; T21-V23 PolarHBondContact O-N 3.48Å; T21-L24 PolarHBondContact O-N 3.44Å; T21-L25 HydrophobicContact CG2-CD1 3.91Å; T21-L25 VanDerWaalsContact O-CB 3.27Å; T21-L25 WeakPolarHBondContact O-CB 3.47Å; T21-L25 PolarHBondContact O-N 3.22Å; T21-F69 WeakPolarHBondContact OG1-CB 3.26Å; T21-F69 PolarHBondContact OG1-O 2.99Å; T21-L70 HydrophobicContact CG2-CB 3.67Å; T21-L70 HydrophobicContact CG2-CD1 4.4Å; T21-L70 HydrophobicContact CG2-CG 4.28Å; T21-L70 PolarHBondContact OG1-N 3.19Å
22	V	88.3	Confident	82.8	Confident	90 Å²	90	63.2 Å²	63.2	55%	0.545	35%	0.353	S	S	.	.	H	α-helix	trans	-63.8	-43	-176.6	170.8	0	0	0	0	111.2	P18 H19 L20 A26	P18-V22 WeakPolarHBondContact O-CB 3.34Å; P18-V22 WeakPolarHBondContact O-CG2 3.33Å; P18-V22 PolarHBondContact O-N 2.93Å; H19-V22 PolarHBondContact O-N 2.9Å; L20-V22 VanDerWaalsContact C-N 3.35Å; L20-V22 PolarHBondContact O-N 3.44Å; V22-A26 WeakPolarHBondContact O-CB 3.05Å; V22-A26 PolarHBondContact O-N 2.83Å
23	V	90.9	Very high	84.1	Confident	81 Å²	81	63.6 Å²	63.6	49%	0.491	36%	0.36	S	S	.	.	H	α-helix	trans	-65.6	-47.8	178.8	172.2	0	0	0	0	111.2	H19 L20 T21 A26 I27	H19-V23 VanDerWaalsContact O-CG2 3.31Å; H19-V23 WeakPolarHBondContact O-CG2 3.42Å; H19-V23 PolarHBondContact O-N 3.49Å; H19-V23 VanDerWaalsContact O-N 3.09Å; L20-V23 PolarHBondContact O-N 3.25Å; T21-V23 PolarHBondContact O-N 3.48Å; V23-A26 PolarHBondContact O-N 2.9Å; V23-I27 HydrophobicContact CG1-CD1 3.79Å; V23-I27 VanDerWaalsContact O-CG1 3.31Å; V23-I27 WeakPolarHBondContact O-CG1 3.16Å; V23-I27 PolarHBondContact O-N 3.28Å; V23-I27 VanDerWaalsContact O-N 3.07Å
24	L	89.9	Confident	85.1	Confident	30 Å²	30	65.3 Å²	65.3	16%	0.157	36%	0.359	C	S	.	.	H	α-helix	trans	-64.6	-42.5	179.3	-85.3	87.1	0	0	0	111.8	L20 T21 G28 F65 F69	L20-L24 HydrophobicContact CB-CD1 4.35Å; L20-L24 WeakPolarHBondContact O-CB 3.29Å; L20-L24 WeakPolarHBondContact O-CD1 3.38Å; L20-L24 PolarHBondContact O-N 3.25Å; T21-L24 PolarHBondContact O-N 3.44Å; L24-G28 PolarHBondContact O-N 2.96Å; L24-F65 HydrophobicContact CD2-CB 3.44Å; L24-F65 VanDerWaalsContact CD2-CB 3.44Å; L24-F69 HydrophobicContact CD2-CD2 4.19Å; L24-F69 HydrophobicContact CD2-CE2 4.2Å
25	L	90.4	Very high	85.9	Confident	34 Å²	34	63.4 Å²	63.4	18%	0.178	34%	0.342	C	S	.	.	H	α-helix	trans	-67	-41.2	176.6	-98.4	166.7	0	0	0	112.5	T21 G28 M29 M63 L70	T21-L25 HydrophobicContact CG2-CD1 3.91Å; T21-L25 VanDerWaalsContact O-CB 3.27Å; T21-L25 WeakPolarHBondContact O-CB 3.47Å; T21-L25 PolarHBondContact O-N 3.22Å; L25-G28 PolarHBondContact O-N 2.91Å; L25-M29 WeakPolarHBondContact O-CB 3.31Å; L25-M29 WeakPolarHBondContact O-CG 3.46Å; L25-M29 PolarHBondContact O-N 3.47Å; L25-M63 HydrophobicContact CD2-CE 3.79Å; L25-M63 HydrophobicContact CD2-SD 3.58Å; L25-M63 VanDerWaalsContact CD2-SD 3.58Å; L25-L70 HydrophobicContact CD1-CD1 3.69Å
26	A	92.5	Very high	86.4	Confident	51 Å²	51	66.4 Å²	66.4	42%	0.421	34%	0.344	S	S	.	.	H	α-helix	trans	-62.6	-46.7	179.5	0	0	0	0	0	111.2	V22 V23 M29 F30	V22-A26 WeakPolarHBondContact O-CB 3.05Å; V22-A26 PolarHBondContact O-N 2.83Å; V23-A26 PolarHBondContact O-N 2.9Å; A26-M29 PolarHBondContact O-N 3.01Å; A26-F30 WeakPolarHBondContact O-CB 3.21Å; A26-F30 PolarHBondContact O-N 3.38Å
27	I	90.9	Very high	86.9	Confident	68 Å²	68	67.4 Å²	67.4	35%	0.349	35%	0.35	S	S	.	.	H	α-helix	trans	-66.2	-43.1	176.9	-64.3	168.9	0	0	0	110.4	V23 M29 F30 F31	V23-I27 HydrophobicContact CG1-CD1 3.79Å; V23-I27 VanDerWaalsContact O-CG1 3.31Å; V23-I27 WeakPolarHBondContact O-CG1 3.16Å; V23-I27 PolarHBondContact O-N 3.28Å; V23-I27 VanDerWaalsContact O-N 3.07Å; I27-M29 PolarHBondContact O-N 3.29Å; I27-F30 WeakPolarHBondContact O-CB 3.45Å; I27-F30 PolarHBondContact O-N 3.5Å; I27-F31 HydrophobicContact CG2-CD2 3.63Å; I27-F31 HydrophobicContact CG2-CE2 3.44Å; I27-F31 VanDerWaalsContact CG2-CE2 3.44Å; I27-F31 WeakPolarHBondContact O-CD2 3.19Å; I27-F31 PolarHBondContact O-N 3.25Å
28	G	90.3	Very high	87.2	Confident	0 Å²	0	68 Å²	68	0%	0	35%	0.352	C	S	.	.	H	α-helix	trans	-57.9	-46	175.1	0	0	0	0	0	112.7	L24 L25 F30 F31 T32	L24-G28 PolarHBondContact O-N 2.96Å; L25-G28 PolarHBondContact O-N 2.91Å; G28-F30 VanDerWaalsContact C-N 3.32Å; G28-F30 PolarHBondContact O-N 3.05Å; G28-F31 PolarHBondContact O-N 3.42Å; G28-T32 WeakPolarHBondContact O-CG2 3.46Å; G28-T32 PolarHBondContact O-N 3.02Å; G28-T32 PolarHBondContact O-OG1 3.41Å
29	M	90.8	Very high	87.1	Confident	109 Å²	109	69.7 Å²	69.7	54%	0.537	36%	0.357	S	S	.	.	H	α-helix	trans	-65.5	-36.4	178.2	-79.8	-165.2	-78.3	0	0	111.8	L25 A26 I27 T32 A33 M63	L25-M29 WeakPolarHBondContact O-CB 3.31Å; L25-M29 WeakPolarHBondContact O-CG 3.46Å; L25-M29 PolarHBondContact O-N 3.47Å; A26-M29 PolarHBondContact O-N 3.01Å; I27-M29 PolarHBondContact O-N 3.29Å; M29-T32 WeakPolarHBondContact CA-OG1 3.12Å; M29-T32 PolarHBondContact O-OG1 3.09Å; M29-A33 VanDerWaalsContact O-CB 3.26Å; M29-A33 WeakPolarHBondContact O-CB 3.31Å; M29-A33 PolarHBondContact O-N 3.48Å; M29-M63 HydrophobicContact CB-CE 3.98Å; M29-M63 HydrophobicContact CG-CE 3.19Å; M29-M63 VanDerWaalsContact N-CE 3.32Å
30	F	90.6	Very high	86.9	Confident	132 Å²	132	68.8 Å²	68.8	58%	0.579	36%	0.361	S	S	*	.	H	α-helix	trans	-63.4	-46	175	-176.3	-96.4	0	0	0	111.4	A26 I27 G28 A33 W34	A26-F30 WeakPolarHBondContact O-CB 3.21Å; A26-F30 PolarHBondContact O-N 3.38Å; I27-F30 WeakPolarHBondContact O-CB 3.45Å; I27-F30 PolarHBondContact O-N 3.5Å; G28-F30 VanDerWaalsContact C-N 3.32Å; G28-F30 PolarHBondContact O-N 3.05Å; F30-A33 PolarHBondContact O-N 3.42Å; F30-W34 HydrophobicContact CZ-CE3 4.33Å; F30-W34 WeakPolarHBondContact O-CB 3.43Å; F30-W34 PolarHBondContact O-N 3.37Å
31	F	87.1	Confident	86.3	Confident	67 Å²	67	70.5 Å²	70.5	29%	0.294	37%	0.374	S	S	.	.	H	α-helix	trans	-68.1	-36.3	177.6	-78.3	-66.9	0	0	0	113.3	I27 G28 W34 F35 V58 A59 F62	I27-F31 HydrophobicContact CG2-CD2 3.63Å; I27-F31 HydrophobicContact CG2-CE2 3.44Å; I27-F31 VanDerWaalsContact CG2-CE2 3.44Å; I27-F31 WeakPolarHBondContact O-CD2 3.19Å; I27-F31 PolarHBondContact O-N 3.25Å; G28-F31 PolarHBondContact O-N 3.42Å; F31-W34 PolarHBondContact O-N 2.86Å; F31-F35 WeakPolarHBondContact O-CB 3.23Å; F31-F35 PolarHBondContact O-N 3.43Å; F31-V58 HydrophobicContact CE2-CG1 4.5Å; F31-A59 HydrophobicContact CB-CB 3.81Å; F31-F62 HydrophobicContact CD2-CD2 4.47Å
32	T	87.3	Confident	85	Confident	44 Å²	44	71.3 Å²	71.3	27%	0.27	38%	0.38	S	S	.	.	H	α-helix	trans	-68.2	-41.1	174.4	57.6	0	0	0	0	111.7	G28 M29 W34 F35 F36 A59 M63	G28-T32 WeakPolarHBondContact O-CG2 3.46Å; G28-T32 PolarHBondContact O-N 3.02Å; G28-T32 PolarHBondContact O-OG1 3.41Å; M29-T32 WeakPolarHBondContact CA-OG1 3.12Å; M29-T32 PolarHBondContact O-OG1 3.09Å; T32-W34 VanDerWaalsContact C-N 3.33Å; T32-W34 PolarHBondContact O-N 3.46Å; T32-F35 WeakPolarHBondContact O-CB 3.36Å; T32-F35 PolarHBondContact O-N 3.35Å; T32-F36 WeakPolarHBondContact O-CD2 3.27Å; T32-F36 PolarHBondContact O-N 3.07Å; T32-A59 HydrophobicContact CG2-CB 3.92Å; T32-M63 HydrophobicContact CG2-CG 4.22Å
33	A	88.6	Confident	83.8	Confident	52 Å²	52	71.6 Å²	71.6	43%	0.43	38%	0.382	S	S	.	.	H	α-helix	trans	-62.4	-42.5	173.9	0	0	0	0	0	111.3	M29 F30 F35 F36 V37	M29-A33 VanDerWaalsContact O-CB 3.26Å; M29-A33 WeakPolarHBondContact O-CB 3.31Å; M29-A33 PolarHBondContact O-N 3.48Å; F30-A33 PolarHBondContact O-N 3.42Å; A33-F35 VanDerWaalsContact C-N 3.34Å; A33-F35 PolarHBondContact O-N 2.87Å; A33-F36 PolarHBondContact O-N 2.79Å; A33-V37 WeakPolarHBondContact O-CG2 3.44Å; A33-V37 PolarHBondContact O-N 2.87Å
34	W	85	Confident	82.1	Confident	139 Å²	139	77.3 Å²	77.3	53%	0.527	40%	0.4	S	S	.	.	H	α-helix	trans	-62.3	-40.7	175.3	-171.1	-85.1	0	0	0	112.3	F30 F31 T32 V37 Y38	F30-W34 HydrophobicContact CZ-CE3 4.33Å; F30-W34 WeakPolarHBondContact O-CB 3.43Å; F30-W34 PolarHBondContact O-N 3.37Å; F31-W34 PolarHBondContact O-N 2.86Å; T32-W34 VanDerWaalsContact C-N 3.33Å; T32-W34 PolarHBondContact O-N 3.46Å; W34-V37 PolarHBondContact O-N 3.01Å; W34-Y38 WeakPolarHBondContact O-CB 3.13Å; W34-Y38 PolarHBondContact O-N 3.41Å
35	F	84.3	Confident	80.3	Confident	41 Å²	41	86.6 Å²	86.6	18%	0.18	44%	0.435	C	S	.	.	H	α-helix	trans	-59.9	-47.2	173.1	175.4	-97	0	0	0	111.4	F31 T32 A33 V37 Y38 E39 E52 I55	F31-F35 WeakPolarHBondContact O-CB 3.23Å; F31-F35 PolarHBondContact O-N 3.43Å; T32-F35 WeakPolarHBondContact O-CB 3.36Å; T32-F35 PolarHBondContact O-N 3.35Å; A33-F35 VanDerWaalsContact C-N 3.34Å; A33-F35 PolarHBondContact O-N 2.87Å; F35-V37 PolarHBondContact O-N 2.75Å; F35-Y38 PolarHBondContact O-N 3.24Å; F35-E39 WeakPolarHBondContact CE1-OE2 3.42Å; F35-E39 WeakPolarHBondContact CZ-OE2 3.2Å; F35-E39 WeakPolarHBondContact O-CB 3.38Å; F35-E39 PolarHBondContact O-N 2.93Å; F35-E52 HydrophobicContact CE2-CB 4.13Å; F35-I55 HydrophobicContact CB-CG2 4.03Å; F35-I55 HydrophobicContact CD2-CG2 4.44Å
36	F	83.4	Confident	78.6	Confident	126 Å²	126	89.4 Å²	89.4	55%	0.553	45%	0.453	S	S	*	.	H	α-helix	trans	-60.6	-43.7	175.9	-79.6	-60.5	0	0	0	112.2	T32 A33 Y38 E39 V40	T32-F36 WeakPolarHBondContact O-CD2 3.27Å; T32-F36 PolarHBondContact O-N 3.07Å; A33-F36 PolarHBondContact O-N 2.79Å; F36-Y38 VanDerWaalsContact C-N 3.34Å; F36-Y38 PolarHBondContact O-N 3.36Å; F36-E39 PolarHBondContact O-N 3.18Å; F36-V40 WeakPolarHBondContact O-CG1 3.4Å; F36-V40 VanDerWaalsContact O-CG2 3.29Å; F36-V40 WeakPolarHBondContact O-CG2 3.26Å; F36-V40 PolarHBondContact O-N 3.29Å
37	V	85	Confident	77.1	Confident	83 Å²	83	91.6 Å²	91.6	50%	0.503	45%	0.451	S	S	.	.	H	α-helix	trans	-58.7	-47.6	175.5	171.4	0	0	0	0	110.5	A33 W34 F35 E39 V40 T41	A33-V37 WeakPolarHBondContact O-CG2 3.44Å; A33-V37 PolarHBondContact O-N 2.87Å; W34-V37 PolarHBondContact O-N 3.01Å; F35-V37 PolarHBondContact O-N 2.75Å; V37-E39 VanDerWaalsContact C-N 3.33Å; V37-E39 PolarHBondContact O-N 2.92Å; V37-V40 WeakPolarHBondContact O-CG2 3.43Å; V37-V40 PolarHBondContact O-N 3.44Å; V37-T41 WeakPolarHBondContact O-CB 3.45Å; V37-T41 PolarHBondContact O-N 3.3Å; V37-T41 PolarHBondContact O-OG1 3.29Å
38	Y	79.9	Confident	76.1	Confident	40 Å²	40	93.3 Å²	93.3	16%	0.157	46%	0.461	C	S	.	.	H	α-helix	trans	-61.7	-41.7	177.8	-170.7	-93.8	0	0	0	111.7	W34 F35 F36 S42 K51 E52	W34-Y38 WeakPolarHBondContact O-CB 3.13Å; W34-Y38 PolarHBondContact O-N 3.41Å; F35-Y38 PolarHBondContact O-N 3.24Å; F36-Y38 VanDerWaalsContact C-N 3.34Å; F36-Y38 PolarHBondContact O-N 3.36Å; Y38-S42 WeakPolarHBondContact O-CB 3.32Å; Y38-S42 PolarHBondContact O-N 3.04Å; Y38-K51 HydrophobicContact CE2-CD 4.29Å; Y38-E52 HydrophobicContact CD1-CG 3.81Å; Y38-E52 HydrophobicContact CE1-CG 3.57Å
39	E	79	Confident	75.3	Confident	71 Å²	71	99.3 Å²	99.3	33%	0.332	49%	0.491	S	S	.	.	H	α-helix	trans	-66.1	-43.2	179.6	-168.5	170.4	175.1	0	0	112.3	F35 F36 V37 R47	F35-E39 WeakPolarHBondContact CE1-OE2 3.42Å; F35-E39 WeakPolarHBondContact CZ-OE2 3.2Å; F35-E39 WeakPolarHBondContact O-CB 3.38Å; F35-E39 PolarHBondContact O-N 2.93Å; F36-E39 PolarHBondContact O-N 3.18Å; V37-E39 VanDerWaalsContact C-N 3.33Å; V37-E39 PolarHBondContact O-N 2.92Å; E39-R47 PolarHBondContact O-NH2 3.04Å
40	V	79.1	Confident	74.8	Confident	119 Å²	119	103.4 Å²	103.4	72%	0.721	50%	0.502	S	S	*	.	H	α-helix	trans	-78.5	-24.6	-177.7	-58.3	0	0	0	0	113.6	F36 V37	F36-V40 WeakPolarHBondContact O-CG1 3.4Å; F36-V40 VanDerWaalsContact O-CG2 3.29Å; F36-V40 WeakPolarHBondContact O-CG2 3.26Å; F36-V40 PolarHBondContact O-N 3.29Å; V37-V40 WeakPolarHBondContact O-CG2 3.43Å; V37-V40 PolarHBondContact O-N 3.44Å
41	T	71.5	Confident	74.2	Confident	102 Å²	102	102.5 Å²	102.5	63%	0.626	50%	0.498	S	S	*	.	H	α-helix	trans	-93.6	-22.8	177.5	47	0	0	0	0	113.9	V37 T43	V37-T41 WeakPolarHBondContact O-CB 3.45Å; V37-T41 PolarHBondContact O-N 3.3Å; V37-T41 PolarHBondContact O-OG1 3.29Å; T41-T43 PolarHBondContact O-N 2.91Å
42	S	60.4	Low	74	Confident	18 Å²	18	100.5 Å²	100.5	13%	0.126	49%	0.49	C	S	.	.			trans	-84.4	110.6	-176.6	-154.6	0	0	0	0	111.7	Y38 R47	Y38-S42 WeakPolarHBondContact O-CB 3.32Å; Y38-S42 PolarHBondContact O-N 3.04Å; S42-R47 PolarHBondContact O-NE 2.87Å
43	T	62	Low	73.9	Confident	96 Å²	96	103.6 Å²	103.6	59%	0.589	50%	0.504	S	S	*	.			trans	-72.4	154.7	177.1	71.2	0	0	0	0	111.8	T41 Y45 T46	T41-T43 PolarHBondContact O-N 2.91Å; T43-Y45 PolarHBondContact O-N 3.24Å; T43-T46 PolarHBondContact O-N 2.92Å
44	K	55.3	Low	73.9	Confident	202 Å²	202	106.6 Å²	106.6	88%	0.878	51%	0.512	S	S	*	.	T	Hydrogen-bonded Turn	trans	-47	-20.1	-174.3	-101.6	-177.3	178.7	-179.1	0	116.8
45	Y	52	Low	73.9	Confident	225 Å²	225	101 Å²	101	88%	0.882	49%	0.493	S	S	*	.	T	Hydrogen-bonded Turn	trans	-95	-13.7	-172.3	-100.2	-89.1	0	0	0	115.2	T43	T43-Y45 PolarHBondContact O-N 3.24Å
46	T	56.6	Low	74.1	Confident	93 Å²	93	100.9 Å²	100.9	57%	0.571	50%	0.496	S	S	*	.	S	Bend	trans	-124.7	17.8	-179.4	55.4	0	0	0	0	112.7	T43 D48	T43-T46 PolarHBondContact O-N 2.92Å; T46-D48 PolarHBondContact O-N 3.45Å
47	R	60	Low	74.4	Confident	96 Å²	96	99.1 Å²	99.1	36%	0.362	49%	0.492	S	S	.	.			trans	-78.6	102.1	-178.7	-83.4	-163.1	172.6	-161.7	-4.1	111.5	E39 S42 I49 E52	E39-R47 PolarHBondContact O-NH2 3.04Å; S42-R47 PolarHBondContact O-NE 2.87Å; R47-I49 PolarHBondContact O-N 2.91Å; R47-E52 WeakPolarHBondContact CD-OE1 3.47Å; R47-E52 IonicContact NE-OE1 3.72Å
48	D	69.8	Low	74.6	Confident	105 Å²	105	97.3 Å²	97.3	56%	0.561	48%	0.481	S	S	*	.			trans	-81.5	99.8	164.8	-79.4	-50.4	0	0	0	110.9	T46 Y50 K51 E52	T46-D48 PolarHBondContact O-N 3.45Å; D48-Y50 PolarHBondContact O-N 3.44Å; D48-K51 HydrophobicContact CB-CB 4.15Å; D48-K51 PolarHBondContact O-N 3.41Å; D48-E52 PolarHBondContact O-N 3.03Å
49	I	74.4	Confident	75.1	Confident	125 Å²	125	95.6 Å²	95.6	64%	0.641	48%	0.475	S	S	*	.	H	α-helix	trans	-56.7	-31.6	175.3	-60.1	-170.8	0	0	0	111.3	R47 K51 E52 L53	R47-I49 PolarHBondContact O-N 2.91Å; I49-K51 VanDerWaalsContact C-N 3.32Å; I49-K51 PolarHBondContact O-N 3.15Å; I49-E52 PolarHBondContact O-N 3.44Å; I49-L53 VanDerWaalsContact O-CB 3.28Å; I49-L53 WeakPolarHBondContact O-CB 3.44Å; I49-L53 PolarHBondContact O-N 3.44Å
50	Y	78.9	Confident	75.7	Confident	195 Å²	195	95.6 Å²	95.6	77%	0.765	48%	0.484	S	S	*	.	H	α-helix	trans	-59.5	-41.2	175.3	-93.9	-84.1	0	0	0	112.9	D48 L54	D48-Y50 PolarHBondContact O-N 3.44Å; Y50-L54 WeakPolarHBondContact O-CB 3.31Å; Y50-L54 PolarHBondContact O-N 2.9Å
51	K	78.9	Confident	76.3	Confident	113 Å²	113	94.3 Å²	94.3	49%	0.491	47%	0.472	S	S	.	.	H	α-helix	trans	-74.9	-38.9	-178.7	-165.2	175	-175.2	-179.3	0	111	Y38 D48 I49 L54 I55	Y38-K51 HydrophobicContact CE2-CD 4.29Å; D48-K51 HydrophobicContact CB-CB 4.15Å; D48-K51 PolarHBondContact O-N 3.41Å; I49-K51 VanDerWaalsContact C-N 3.32Å; I49-K51 PolarHBondContact O-N 3.15Å; K51-L54 PolarHBondContact O-N 3.49Å; K51-I55 HydrophobicContact CG-CD1 3.97Å; K51-I55 WeakPolarHBondContact O-CD1 3.39Å; K51-I55 VanDerWaalsContact O-CG1 3.23Å; K51-I55 WeakPolarHBondContact O-CG1 3.5Å; K51-I55 PolarHBondContact O-N 3.35Å
52	E	83.3	Confident	77.3	Confident	25 Å²	25	93.1 Å²	93.1	12%	0.117	46%	0.458	C	S	.	.	H	α-helix	trans	-60.6	-46.1	173.6	-67.8	175	178.7	0	0	111.4	F35 Y38 R47 D48 I49 I55 S56	F35-E52 HydrophobicContact CE2-CB 4.13Å; Y38-E52 HydrophobicContact CD1-CG 3.81Å; Y38-E52 HydrophobicContact CE1-CG 3.57Å; R47-E52 WeakPolarHBondContact CD-OE1 3.47Å; R47-E52 IonicContact NE-OE1 3.72Å; D48-E52 PolarHBondContact O-N 3.03Å; I49-E52 PolarHBondContact O-N 3.44Å; E52-I55 PolarHBondContact O-N 3.26Å; E52-S56 WeakPolarHBondContact O-CB 3.02Å; E52-S56 PolarHBondContact O-N 2.86Å; E52-S56 PolarHBondContact O-OG 3.44Å
53	L	85.3	Confident	78.7	Confident	109 Å²	109	94.4 Å²	94.4	57%	0.571	46%	0.463	S	S	*	.	H	α-helix	trans	-65.5	-41.4	178.8	-169.4	68.7	0	0	0	111.6	I49 S56 L57	I49-L53 VanDerWaalsContact O-CB 3.28Å; I49-L53 WeakPolarHBondContact O-CB 3.44Å; I49-L53 PolarHBondContact O-N 3.44Å; L53-S56 WeakPolarHBondContact CA-OG 3.1Å; L53-S56 PolarHBondContact O-OG 2.79Å; L53-S56 VanDerWaalsContact O-OG 3.12Å; L53-L57 WeakPolarHBondContact O-CB 3.27Å; L53-L57 PolarHBondContact O-N 3.47Å
54	L	86.9	Confident	80.1	Confident	115 Å²	115	91.6 Å²	91.6	60%	0.602	45%	0.453	S	S	*	.	H	α-helix	trans	-62.1	-47.5	176.2	-100.1	165.8	0	0	0	112.1	Y50 K51 L57 V58	Y50-L54 WeakPolarHBondContact O-CB 3.31Å; Y50-L54 PolarHBondContact O-N 2.9Å; K51-L54 PolarHBondContact O-N 3.49Å; L54-L57 PolarHBondContact O-N 3.04Å; L54-V58 VanDerWaalsContact O-CG2 3.26Å; L54-V58 WeakPolarHBondContact O-CG2 3.38Å; L54-V58 PolarHBondContact O-N 2.88Å
55	I	86.4	Confident	81.7	Confident	23 Å²	23	87.4 Å²	87.4	12%	0.118	44%	0.435	C	S	.	.	H	α-helix	trans	-67.7	-43.5	-177.9	-63.6	164.7	0	0	0	110.4	F35 K51 E52 V58 A59	F35-I55 HydrophobicContact CB-CG2 4.03Å; F35-I55 HydrophobicContact CD2-CG2 4.44Å; K51-I55 HydrophobicContact CG-CD1 3.97Å; K51-I55 WeakPolarHBondContact O-CD1 3.39Å; K51-I55 VanDerWaalsContact O-CG1 3.23Å; K51-I55 WeakPolarHBondContact O-CG1 3.5Å; K51-I55 PolarHBondContact O-N 3.35Å; E52-I55 PolarHBondContact O-N 3.26Å; I55-V58 PolarHBondContact O-N 3.12Å; I55-A59 VanDerWaalsContact O-CB 3.27Å; I55-A59 WeakPolarHBondContact O-CB 3.48Å; I55-A59 PolarHBondContact O-N 3.29Å
56	S	87.6	Confident	83.4	Confident	37 Å²	37	76.7 Å²	76.7	26%	0.259	39%	0.393	S	S	.	.	H	α-helix	trans	-67.5	-36.9	178.1	56.8	0	0	0	0	112.7	E52 L53 A59 S60	E52-S56 WeakPolarHBondContact O-CB 3.02Å; E52-S56 PolarHBondContact O-N 2.86Å; E52-S56 PolarHBondContact O-OG 3.44Å; L53-S56 WeakPolarHBondContact CA-OG 3.1Å; L53-S56 PolarHBondContact O-OG 2.79Å; L53-S56 VanDerWaalsContact O-OG 3.12Å; S56-A59 PolarHBondContact O-N 2.88Å; S56-S60 VanDerWaalsContact O-CB 3.3Å; S56-S60 WeakPolarHBondContact O-CB 3.3Å; S56-S60 PolarHBondContact O-N 3.48Å; S56-S60 PolarHBondContact O-OG 2.89Å
57	L	90.4	Very high	85	Confident	89 Å²	89	75.6 Å²	75.6	47%	0.466	39%	0.386	S	S	.	.	H	α-helix	trans	-62.3	-51.1	174.6	-172.1	159.6	0	0	0	110.3	L53 L54 A59 S60 L61	L53-L57 WeakPolarHBondContact O-CB 3.27Å; L53-L57 PolarHBondContact O-N 3.47Å; L54-L57 PolarHBondContact O-N 3.04Å; L57-A59 VanDerWaalsContact C-N 3.34Å; L57-A59 PolarHBondContact O-N 3.35Å; L57-S60 PolarHBondContact O-N 3.17Å; L57-S60 PolarHBondContact O-OG 3.49Å; L57-L61 HydrophobicContact CD2-CD1 3.61Å; L57-L61 HydrophobicContact CD2-CG 4.21Å; L57-L61 WeakPolarHBondContact O-CG 3.28Å; L57-L61 PolarHBondContact O-N 3.04Å
58	V	89	Confident	86.3	Confident	45 Å²	45	74.8 Å²	74.8	27%	0.273	39%	0.389	S	S	.	.	H	α-helix	trans	-60	-45.6	177.8	174.4	0	0	0	0	110.7	F31 L54 I55 S60 L61 F62	F31-V58 HydrophobicContact CE2-CG1 4.5Å; L54-V58 VanDerWaalsContact O-CG2 3.26Å; L54-V58 WeakPolarHBondContact O-CG2 3.38Å; L54-V58 PolarHBondContact O-N 2.88Å; I55-V58 PolarHBondContact O-N 3.12Å; V58-S60 PolarHBondContact O-N 2.96Å; V58-L61 PolarHBondContact O-N 3.4Å; V58-F62 HydrophobicContact CG1-CD2 3.7Å; V58-F62 HydrophobicContact CG1-CE2 3.58Å; V58-F62 WeakPolarHBondContact O-CD2 3.05Å; V58-F62 PolarHBondContact O-N 3.49Å; V58-F62 VanDerWaalsContact O-N 3.15Å
59	A	90	Very high	87	Confident	4 Å²	4	72 Å²	72	3%	0.033	37%	0.372	C	S	.	.	H	α-helix	trans	-59.2	-45	177	0	0	0	0	0	112.3	F31 T32 I55 S56 L57 L61 F62 M63	F31-A59 HydrophobicContact CB-CB 3.81Å; T32-A59 HydrophobicContact CG2-CB 3.92Å; I55-A59 VanDerWaalsContact O-CB 3.27Å; I55-A59 WeakPolarHBondContact O-CB 3.48Å; I55-A59 PolarHBondContact O-N 3.29Å; S56-A59 PolarHBondContact O-N 2.88Å; L57-A59 VanDerWaalsContact C-N 3.34Å; L57-A59 PolarHBondContact O-N 3.35Å; A59-L61 PolarHBondContact O-N 3.36Å; A59-F62 PolarHBondContact O-N 3.31Å; A59-M63 VanDerWaalsContact O-CB 3.31Å; A59-M63 WeakPolarHBondContact O-CB 3.42Å; A59-M63 PolarHBondContact O-N 3.26Å
60	S	92.3	Very high	87.5	Confident	72 Å²	72	69 Å²	69	50%	0.503	36%	0.357	S	S	.	.	H	α-helix	trans	-66.2	-35.6	-179.4	72.6	0	0	0	0	112.9	S56 L57 V58 G64	S56-S60 VanDerWaalsContact O-CB 3.3Å; S56-S60 WeakPolarHBondContact O-CB 3.3Å; S56-S60 PolarHBondContact O-N 3.48Å; S56-S60 PolarHBondContact O-OG 2.89Å; L57-S60 PolarHBondContact O-N 3.17Å; L57-S60 PolarHBondContact O-OG 3.49Å; V58-S60 PolarHBondContact O-N 2.96Å; S60-G64 PolarHBondContact O-N 3.31Å
61	L	92.4	Very high	87.9	Confident	91 Å²	91	62 Å²	62	48%	0.476	33%	0.332	S	S	.	.	H	α-helix	trans	-64.5	-51.8	174.2	-75	176.2	0	0	0	111	L57 V58 A59 M63 G64 F65	L57-L61 HydrophobicContact CD2-CD1 3.61Å; L57-L61 HydrophobicContact CD2-CG 4.21Å; L57-L61 WeakPolarHBondContact O-CG 3.28Å; L57-L61 PolarHBondContact O-N 3.04Å; V58-L61 PolarHBondContact O-N 3.4Å; A59-L61 PolarHBondContact O-N 3.36Å; L61-M63 VanDerWaalsContact C-N 3.34Å; L61-M63 PolarHBondContact O-N 2.92Å; L61-G64 PolarHBondContact O-N 2.94Å; L61-F65 HydrophobicContact CD2-CE2 4.47Å; L61-F65 WeakPolarHBondContact O-CD2 3.46Å; L61-F65 PolarHBondContact O-N 3.39Å
62	F	90.9	Very high	88.1	Confident	78 Å²	78	59.2 Å²	59.2	34%	0.342	32%	0.322	S	S	.	.	H	α-helix	trans	-63.4	-39.8	180	-78.2	-69.1	0	0	0	112.4	F31 V58 A59 G66	F31-F62 HydrophobicContact CD2-CD2 4.47Å; V58-F62 HydrophobicContact CG1-CD2 3.7Å; V58-F62 HydrophobicContact CG1-CE2 3.58Å; V58-F62 WeakPolarHBondContact O-CD2 3.05Å; V58-F62 PolarHBondContact O-N 3.49Å; V58-F62 VanDerWaalsContact O-N 3.15Å; A59-F62 PolarHBondContact O-N 3.31Å; F62-G66 PolarHBondContact O-N 2.82Å
63	M	91	Very high	87.9	Confident	44 Å²	44	65 Å²	65	22%	0.217	34%	0.343	C	S	.	.	H	α-helix	trans	-64.5	-45.2	173.4	-87.7	-71.3	174.6	0	0	112.5	L25 M29 T32 A59 L61 G66 V67	L25-M63 HydrophobicContact CD2-CE 3.79Å; L25-M63 HydrophobicContact CD2-SD 3.58Å; L25-M63 VanDerWaalsContact CD2-SD 3.58Å; M29-M63 HydrophobicContact CB-CE 3.98Å; M29-M63 HydrophobicContact CG-CE 3.19Å; M29-M63 VanDerWaalsContact N-CE 3.32Å; T32-M63 HydrophobicContact CG2-CG 4.22Å; A59-M63 VanDerWaalsContact O-CB 3.31Å; A59-M63 WeakPolarHBondContact O-CB 3.42Å; A59-M63 PolarHBondContact O-N 3.26Å; L61-M63 VanDerWaalsContact C-N 3.34Å; L61-M63 PolarHBondContact O-N 2.92Å; M63-G66 PolarHBondContact O-N 3.48Å; M63-V67 VanDerWaalsContact O-CG2 3.28Å; M63-V67 WeakPolarHBondContact O-CG2 3.28Å; M63-V67 PolarHBondContact O-N 3.34Å
64	G	90.4	Very high	87.7	Confident	38 Å²	38	64.3 Å²	64.3	39%	0.392	34%	0.343	S	S	.	.	H	α-helix	trans	-59.9	-51.1	178.5	0	0	0	0	0	111.9	S60 L61 G66 V67 L68	S60-G64 PolarHBondContact O-N 3.31Å; L61-G64 PolarHBondContact O-N 2.94Å; G64-G66 PolarHBondContact O-N 3.42Å; G64-V67 PolarHBondContact O-N 2.91Å; G64-L68 WeakPolarHBondContact O-CG 3.17Å; G64-L68 PolarHBondContact O-N 3.27Å
65	F	88.4	Confident	87.3	Confident	114 Å²	114	60.5 Å²	60.5	50%	0.5	33%	0.331	S	S	.	.	H	α-helix	trans	-63.5	-41	175.6	-77.7	-68.8	0	0	0	112.4	L24 L61 V67 L68 F69	L24-F65 HydrophobicContact CD2-CB 3.44Å; L24-F65 VanDerWaalsContact CD2-CB 3.44Å; L61-F65 HydrophobicContact CD2-CE2 4.47Å; L61-F65 WeakPolarHBondContact O-CD2 3.46Å; L61-F65 PolarHBondContact O-N 3.39Å; F65-V67 VanDerWaalsContact C-N 3.32Å; F65-V67 PolarHBondContact O-N 2.95Å; F65-L68 HydrophobicContact CD1-CD1 4.33Å; F65-L68 WeakPolarHBondContact O-CB 3.08Å; F65-L68 PolarHBondContact O-N 3.34Å; F65-F69 WeakPolarHBondContact O-CD2 3.21Å; F65-F69 PolarHBondContact O-N 3.32Å
66	G	89.5	Confident	87	Confident	0 Å²	0	63.8 Å²	63.8	0%	0	35%	0.348	C	S	.	.	H	α-helix	trans	-59.1	-40.7	176.8	0	0	0	0	0	113	F62 M63 G64 F69 L70	F62-G66 PolarHBondContact O-N 2.82Å; M63-G66 PolarHBondContact O-N 3.48Å; G64-G66 PolarHBondContact O-N 3.42Å; G66-F69 PolarHBondContact O-N 2.97Å; G66-L70 PolarHBondContact O-N 3.13Å
67	V	88.9	Confident	86.2	Confident	69 Å²	69	71 Å²	71	42%	0.418	37%	0.371	S	S	.	.	H	α-helix	trans	-68.2	-36.3	177.2	172.9	0	0	0	0	112.1	M63 G64 F65 F69 L70 L71	M63-V67 VanDerWaalsContact O-CG2 3.28Å; M63-V67 WeakPolarHBondContact O-CG2 3.28Å; M63-V67 PolarHBondContact O-N 3.34Å; G64-V67 PolarHBondContact O-N 2.91Å; F65-V67 VanDerWaalsContact C-N 3.32Å; F65-V67 PolarHBondContact O-N 2.95Å; V67-F69 PolarHBondContact O-N 3.48Å; V67-L70 WeakPolarHBondContact O-CB 3.44Å; V67-L70 PolarHBondContact O-N 3.37Å; V67-L71 HydrophobicContact CG1-CD1 4.21Å; V67-L71 WeakPolarHBondContact O-CG 3.44Å; V67-L71 PolarHBondContact O-N 2.89Å
68	L	87.3	Confident	84.9	Confident	80 Å²	80	75.2 Å²	75.2	42%	0.419	40%	0.401	S	S	.	.	H	α-helix	trans	-60.3	-44.9	173.9	-66.9	175.5	0	0	0	111.6	G64 F65 L70 L71 L72	G64-L68 WeakPolarHBondContact O-CG 3.17Å; G64-L68 PolarHBondContact O-N 3.27Å; F65-L68 HydrophobicContact CD1-CD1 4.33Å; F65-L68 WeakPolarHBondContact O-CB 3.08Å; F65-L68 PolarHBondContact O-N 3.34Å; L68-L70 VanDerWaalsContact C-N 3.32Å; L68-L70 PolarHBondContact O-N 3.23Å; L68-L71 PolarHBondContact O-N 3.11Å; L68-L72 WeakPolarHBondContact O-CD1 3.39Å; L68-L72 WeakPolarHBondContact O-CG 3.47Å; L68-L72 PolarHBondContact O-N 2.92Å; L68-L72 VanDerWaalsContact O-N 3.13Å
69	F	84.1	Confident	84.7	Confident	46 Å²	46	76.8 Å²	76.8	20%	0.202	41%	0.407	C	S	.	.	H	α-helix	trans	-68.9	-30	175.3	-69.9	-72.6	0	0	0	112.7	F17 L20 T21 L24 F65 G66 V67 L72 W73	F17-F69 HydrophobicContact CD1-CD1 4.01Å; F17-F69 HydrophobicContact CD1-CE1 4.38Å; L20-F69 HydrophobicContact CB-CD1 4.45Å; L20-F69 HydrophobicContact CB-CG 4.47Å; L20-F69 HydrophobicContact CD1-CE1 4.05Å; L20-F69 HydrophobicContact CD1-CZ 4.38Å; T21-F69 WeakPolarHBondContact OG1-CB 3.26Å; T21-F69 PolarHBondContact OG1-O 2.99Å; L24-F69 HydrophobicContact CD2-CD2 4.19Å; L24-F69 HydrophobicContact CD2-CE2 4.2Å; F65-F69 WeakPolarHBondContact O-CD2 3.21Å; F65-F69 PolarHBondContact O-N 3.32Å; G66-F69 PolarHBondContact O-N 2.97Å; V67-F69 PolarHBondContact O-N 3.48Å; F69-L72 HydrophobicContact CD1-CD1 4.14Å; F69-W73 WeakPolarHBondContact O-CB 3.5Å; F69-W73 PolarHBondContact O-N 2.92Å
70	L	85.9	Confident	84.4	Confident	62 Å²	62	80.6 Å²	80.6	33%	0.325	43%	0.427	S	S	.	.	H	α-helix	trans	-64.9	-44.8	172.5	-171.2	151	0	0	0	111.7	T21 L25 G66 V67 L68 L72 W73 V74	T21-L70 HydrophobicContact CG2-CB 3.67Å; T21-L70 HydrophobicContact CG2-CD1 4.4Å; T21-L70 HydrophobicContact CG2-CG 4.28Å; T21-L70 PolarHBondContact OG1-N 3.19Å; L25-L70 HydrophobicContact CD1-CD1 3.69Å; G66-L70 PolarHBondContact O-N 3.13Å; V67-L70 WeakPolarHBondContact O-CB 3.44Å; V67-L70 PolarHBondContact O-N 3.37Å; L68-L70 VanDerWaalsContact C-N 3.32Å; L68-L70 PolarHBondContact O-N 3.23Å; L70-L72 VanDerWaalsContact C-N 3.34Å; L70-L72 PolarHBondContact O-N 3.2Å; L70-W73 WeakPolarHBondContact O-CB 3.44Å; L70-W73 PolarHBondContact O-N 3.38Å; L70-W73 VanDerWaalsContact O-N 3.11Å; L70-V74 HydrophobicContact CD2-CG2 3.98Å; L70-V74 WeakPolarHBondContact O-CG2 3.23Å; L70-V74 PolarHBondContact O-N 3.05Å
71	L	85.9	Confident	84	Confident	47 Å²	47	81.1 Å²	81.1	25%	0.246	42%	0.422	C	S	.	.	H	α-helix	trans	-58.1	-48	175.9	-74.8	160	0	0	0	110.8	V67 L68 W73 V74 G75 I76	V67-L71 HydrophobicContact CG1-CD1 4.21Å; V67-L71 WeakPolarHBondContact O-CG 3.44Å; V67-L71 PolarHBondContact O-N 2.89Å; L68-L71 PolarHBondContact O-N 3.11Å; L71-W73 VanDerWaalsContact C-N 3.28Å; L71-W73 PolarHBondContact O-N 2.92Å; L71-V74 PolarHBondContact O-N 3.12Å; L71-G75 PolarHBondContact O-N 2.97Å; L71-G75 VanDerWaalsContact O-N 3.15Å; L71-I76 CarbonylContact C-O 3.16Å; L71-I76 HydrophobicContact CB-CB 4.43Å; L71-I76 HydrophobicContact CD2-CB 3.97Å; L71-I76 HydrophobicContact CD2-CD1 4.04Å; L71-I76 HydrophobicContact CD2-CG2 3.9Å; L71-I76 CarbonylContact O-C 3.59Å; L71-I76 PolarHBondContact O-N 3.41Å
72	L	83.4	Confident	83.5	Confident	56 Å²	56	80.5 Å²	80.5	29%	0.293	42%	0.419	S	S	.	.	H	α-helix	trans	-57.9	-39.2	174.1	-73.3	157.6	0	0	0	112.3	F17 L68 F69 L70 G75 Y77	F17-L72 HydrophobicContact CD2-CB 4.42Å; F17-L72 HydrophobicContact CE1-CD1 4.41Å; F17-L72 HydrophobicContact CG-CB 4.5Å; L68-L72 WeakPolarHBondContact O-CD1 3.39Å; L68-L72 WeakPolarHBondContact O-CG 3.47Å; L68-L72 PolarHBondContact O-N 2.92Å; L68-L72 VanDerWaalsContact O-N 3.13Å; F69-L72 HydrophobicContact CD1-CD1 4.14Å; L70-L72 VanDerWaalsContact C-N 3.34Å; L70-L72 PolarHBondContact O-N 3.2Å; L72-G75 PolarHBondContact O-N 3.15Å; L72-Y77 HydrophobicContact CD2-CD1 4.46Å
73	W	79.8	Confident	83	Confident	146 Å²	146	80.6 Å²	80.6	55%	0.553	42%	0.424	S	S	*	.	H	α-helix	trans	-69.6	-39.1	178.5	178.8	38.7	0	0	0	113.3	P18 F69 L70 L71 G75	P18-W73 HydrophobicContact CB-CD2 4.32Å; P18-W73 HydrophobicContact CB-CG 4.32Å; F69-W73 WeakPolarHBondContact O-CB 3.5Å; F69-W73 PolarHBondContact O-N 2.92Å; L70-W73 WeakPolarHBondContact O-CB 3.44Å; L70-W73 PolarHBondContact O-N 3.38Å; L70-W73 VanDerWaalsContact O-N 3.11Å; L71-W73 VanDerWaalsContact C-N 3.28Å; L71-W73 PolarHBondContact O-N 2.92Å; W73-G75 PolarHBondContact O-N 2.76Å
74	V	81.7	Confident	82.5	Confident	95 Å²	95	83.1 Å²	83.1	58%	0.576	44%	0.438	S	S	*	.	H	α-helix	trans	-71.4	-12.7	175.5	173.9	0	0	0	0	111.9	L70 L71 I76	L70-V74 HydrophobicContact CD2-CG2 3.98Å; L70-V74 WeakPolarHBondContact O-CG2 3.23Å; L70-V74 PolarHBondContact O-N 3.05Å; L71-V74 PolarHBondContact O-N 3.12Å; V74-I76 HydrophobicContact CG1-CD1 4.07Å; V74-I76 HydrophobicContact CG1-CG1 4.17Å
75	G	78.3	Confident	81.9	Confident	34 Å²	34	86.3 Å²	86.3	35%	0.351	44%	0.441	S	S	.	.	T	Hydrogen-bonded Turn	trans	87.7	17	-177.7	0	0	0	0	0	113.3	L71 L72 W73 Y77	L71-G75 PolarHBondContact O-N 2.97Å; L71-G75 VanDerWaalsContact O-N 3.15Å; L72-G75 PolarHBondContact O-N 3.15Å; W73-G75 PolarHBondContact O-N 2.76Å; G75-Y77 WeakPolarHBondContact O-CD2 3.37Å; G75-Y77 VanDerWaalsContact O-CE2 3.23Å; G75-Y77 WeakPolarHBondContact O-CE2 3.38Å
76	I	79.3	Confident	81.4	Confident	92 Å²	92	84.2 Å²	84.2	47%	0.472	44%	0.437	S	S	.	.			trans	-91.2	103.5	169.9	-57.7	171.5	0	0	0	106.9	L71 V74	L71-I76 CarbonylContact C-O 3.16Å; L71-I76 HydrophobicContact CB-CB 4.43Å; L71-I76 HydrophobicContact CD2-CB 3.97Å; L71-I76 HydrophobicContact CD2-CD1 4.04Å; L71-I76 HydrophobicContact CD2-CG2 3.9Å; L71-I76 CarbonylContact O-C 3.59Å; L71-I76 PolarHBondContact O-N 3.41Å; V74-I76 HydrophobicContact CG1-CD1 4.07Å; V74-I76 HydrophobicContact CG1-CG1 4.17Å
77	Y	70.7	Confident	80.7	Confident	188 Å²	188	91.2 Å²	91.2	74%	0.737	47%	0.473	S	S	*	.			trans	-84.2	135.4	179.5	-50.4	-77.2	0	0	0	109.9	L72 G75	L72-Y77 HydrophobicContact CD2-CD1 4.46Å; G75-Y77 WeakPolarHBondContact O-CD2 3.37Å; G75-Y77 VanDerWaalsContact O-CE2 3.23Å; G75-Y77 WeakPolarHBondContact O-CE2 3.38Å
78	V	63.3	Low	80	Confident	179 Å²	179	93.2 Å²	93.2	100%	1.085	48%	0.478	S	S	*	.			trans	-107.7	0	173.3	137.7	0	0	0	0	109.3

Retrieved 78 of 78 residues in 49.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).