D2HVF2_AILME Loading...

SUI1 domain-containing protein

AlphaFold DB , UniProt , Accession D2HVF2, Species AILME (Ailuropoda melanoleuca, Giant panda), Gene n/a, Length 103 aa.

						>D2HVF2_AILME|D2HVF2
DPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	D	45.3	Very low	50.1	Low	165 Å²	165	124.2 Å²	124.2	88%	0.882	72%	0.716	S	S	*	*				0	111.2	0	-174.1	-5.7	0	0	0	107.6	F3	D1-F3 PolarHBondContact O-N 3.39Å; D1-F3 PolarHBondContact OD1-N 3.28Å
2	P	55.7	Low	50.2	Low	118 Å²	118	126.8 Å²	126.8	77%	0.766	72%	0.724	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.6	4.3	-172.5	33.5	-33.8	0	0	0	113.7
3	F	59.3	Low	49.8	Very low	171 Å²	171	125.8 Å²	125.8	75%	0.75	71%	0.714	S	S	*	*	T	Hydrogen-bonded Turn	trans	-102.6	8.6	179.1	-71.9	-81.1	0	0	0	114.5	D1 D5	D1-F3 PolarHBondContact O-N 3.39Å; D1-F3 PolarHBondContact OD1-N 3.28Å; F3-D5 PolarHBondContact O-N 3.09Å
4	A	50.1	Low	49.2	Very low	79 Å²	79	123.6 Å²	123.6	65%	0.653	71%	0.708	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.2	3	-177.8	0	0	0	0	0	115.1
5	D	50.1	Low	48.9	Very low	150 Å²	150	123.1 Å²	123.1	80%	0.802	72%	0.724	S	S	*	*	T	Hydrogen-bonded Turn	trans	-122	28.2	-170.7	-107.4	-45.3	0	0	0	114.6	F3	F3-D5 PolarHBondContact O-N 3.09Å
6	A	52	Low	48.3	Very low	85 Å²	85	119.4 Å²	119.4	70%	0.702	72%	0.72	S	S	*	*	S	Bend	trans	-118.3	11	179.8	0	0	0	0	0	115.6
7	T	48.2	Very low	48.2	Very low	140 Å²	140	115.3 Å²	115.3	86%	0.859	70%	0.696	S	S	*	*			trans	-148.6	59.9	175.2	34.8	0	0	0	0	111.5
8	K	46.3	Very low	48.5	Very low	193 Å²	193	119.1 Å²	119.1	84%	0.839	71%	0.705	S	S	*	*	S	Bend	trans	-118.5	96.6	158	-83.3	-177.2	178.6	175.5	0	108.5
9	G	45.5	Very low	49.5	Very low	41 Å²	41	118.5 Å²	118.5	42%	0.423	70%	0.698	S	S	.	*			trans	35.5	101.2	155.1	0	0	0	0	0	117	D11	G9-D11 PolarHBondContact O-N 3.25Å
10	D	45.3	Very low	51.2	Low	148 Å²	148	117.4 Å²	117.4	79%	0.791	68%	0.682	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.5	38.2	143.1	-161	88.4	0	0	0	110.6
11	D	53.5	Low	53	Low	76 Å²	76	112 Å²	112	41%	0.406	65%	0.651	S	S	.	*	T	Hydrogen-bonded Turn	trans	-121.2	12	179.1	-69.1	-48.9	0	0	0	110.6	G9 Y69	G9-D11 PolarHBondContact O-N 3.25Å; D11-Y69 PolarHBondContact OD1-OH 2.86Å
12	L	50.4	Low	55	Low	156 Å²	156	105.9 Å²	105.9	82%	0.817	62%	0.617	S	S	*	*			trans	-106.1	78.4	166.4	-73	165.7	0	0	0	107.8	P14	L12-P14 VanDerWaalsContact O-CD 3.29Å; L12-P14 WeakPolarHBondContact O-CD 3.04Å
13	L	45.9	Very low	56.7	Low	113 Å²	113	100.2 Å²	100.2	59%	0.592	58%	0.58	S	S	*	*			trans	-60.3	120.9	169.5	-68.2	178	0	0	0	108.6	A15	L13-A15 PolarHBondContact O-N 3.44Å
14	P	41.7	Very low	58.2	Low	96 Å²	96	95.2 Å²	95.2	62%	0.623	56%	0.556	S	S	*	*			trans	-65.7	135.3	165.3	27.7	-29.8	0	0	0	107.9	L12 G16 T17	L12-P14 VanDerWaalsContact O-CD 3.29Å; L12-P14 WeakPolarHBondContact O-CD 3.04Å; P14-G16 PolarHBondContact O-N 3.24Å; P14-T17 PolarHBondContact O-OG1 2.94Å
15	A	43.4	Very low	60.2	Low	115 Å²	115	92.1 Å²	92.1	95%	0.95	53%	0.528	S	S	*	.	T	Hydrogen-bonded Turn	trans	-47.5	107.9	173.7	0	0	0	0	0	110	L13	L13-A15 PolarHBondContact O-N 3.44Å
16	G	40.2	Very low	62.1	Low	65 Å²	65	90 Å²	90	67%	0.67	51%	0.513	S	S	*	.	T	Hydrogen-bonded Turn	trans	142.1	7.3	-174.9	0	0	0	0	0	116.6	P14	P14-G16 PolarHBondContact O-N 3.24Å
17	T	45.9	Very low	63.8	Low	49 Å²	49	91.9 Å²	91.9	30%	0.301	51%	0.508	S	S	.	.			trans	-120.7	33.2	-178.6	48.6	0	0	0	0	113	P14 D19	P14-T17 PolarHBondContact O-OG1 2.94Å; T17-D19 PolarHBondContact O-N 3.46Å
18	E	54	Low	65.7	Low	183 Å²	183	91.8 Å²	91.8	86%	0.855	49%	0.492	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68.6	3.1	-170.3	-65	-179.8	124.4	0	0	115.6
19	D	67.6	Low	67.6	Low	108 Å²	108	88 Å²	88	58%	0.578	48%	0.481	S	S	*	.	T	Hydrogen-bonded Turn	trans	-116.4	-2.5	-166.4	-73.9	-62.6	0	0	0	116	T17 Q97	T17-D19 PolarHBondContact O-N 3.46Å; D19-Q97 WeakPolarHBondContact O-CB 3.42Å
20	Y	83.6	Confident	69.6	Low	96 Å²	96	88.9 Å²	88.9	38%	0.376	49%	0.49	S	S	.	.	P	Polyproline II helix	trans	-91.9	126.5	-177.1	-67.7	-81.4	0	0	0	112.4	E96 Q97 K99	Y20-E96 VanDerWaalsContact CE1-O 3.29Å; Y20-E96 WeakPolarHBondContact CE1-O 3.21Å; Y20-Q97 CarbonylContact C-O 3.52Å; Y20-Q97 VanDerWaalsContact CA-O 3.29Å; Y20-Q97 WeakPolarHBondContact CA-O 3.27Å; Y20-Q97 WeakPolarHBondContact CD1-O 3.45Å; Y20-K99 HydrophobicContact CD1-CG 4.04Å
21	I	87.9	Confident	71.5	Confident	5 Å²	5	93.7 Å²	93.7	3%	0.026	50%	0.497	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.6	118.9	169.2	-65.3	-169.2	0	0	0	109.1	I23 V37 Q38 I40 L87 V93 Q97 K99	I21-I23 HydrophobicContact CG2-CG1 4.41Å; I21-V37 HydrophobicContact CG2-CG1 3.49Å; I21-V37 VanDerWaalsContact CG2-CG1 3.49Å; I21-Q38 WeakPolarHBondContact CA-O 3.43Å; I21-I40 HydrophobicContact CD1-CG1 4.08Å; I21-L87 HydrophobicContact CD1-CD1 4.35Å; I21-L87 HydrophobicContact CG2-CD1 4.18Å; I21-V93 HydrophobicContact CD1-CB 4.32Å; I21-V93 HydrophobicContact CD1-CG1 3.15Å; I21-V93 HydrophobicContact CD1-CG2 4.36Å; I21-V93 HydrophobicContact CG1-CG1 3.78Å; I21-Q97 PolarHBondContact N-O 3.49Å; I21-K99 PolarHBondContact O-N 3.1Å
22	H	88.7	Confident	73.2	Confident	36 Å²	36	97.1 Å²	97.1	17%	0.167	51%	0.508	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.5	122	175.3	-62.8	-81.6	0	0	0	110.7	V37 Q38 K99 H101	H22-V37 WeakPolarHBondContact O-CA 3.34Å; H22-Q38 HydrophobicContact CB-CB 4.29Å; H22-Q38 PolarHBondContact N-O 3.32Å; H22-Q38 PolarHBondContact O-N 2.89Å; H22-K99 CarbonylContact C-O 3.57Å; H22-K99 WeakPolarHBondContact CA-O 3.31Å; H22-K99 WeakPolarHBondContact ND1-CB 3.48Å; H22-H101 AromaticContact CE1-NE2 3.9Å; H22-H101 AromaticContact CG-NE2 3.83Å; H22-H101 AromaticContact ND1-CD2 3.8Å; H22-H101 AromaticContact ND1-NE2 2.99Å; H22-H101 PolarHBondContact ND1-NE2 3.33Å
23	I	91.3	Very high	75.2	Confident	0 Å²	0	90.8 Å²	90.8	0%	0	48%	0.476	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104	108.1	170.8	-54.1	-177.9	0	0	0	107.5	I21 T35 V37 R80 I83 C84 L87 L98 K99 V100 H101	I21-I23 HydrophobicContact CG2-CG1 4.41Å; I23-T35 HydrophobicContact CG2-CG2 3.59Å; I23-V37 HydrophobicContact CG1-CG1 4.5Å; I23-R80 HydrophobicContact CG2-CB 4.21Å; I23-I83 HydrophobicContact CD1-CB 4.01Å; I23-I83 HydrophobicContact CD1-CG2 3.57Å; I23-I83 HydrophobicContact CG1-CG2 4.33Å; I23-I83 HydrophobicContact CG2-CD1 4.44Å; I23-C84 HydrophobicContact CD1-CB 4.39Å; I23-L87 HydrophobicContact CD1-CD1 4.42Å; I23-L98 HydrophobicContact CD1-CD1 4.33Å; I23-L98 HydrophobicContact CD1-CD2 3.57Å; I23-L98 HydrophobicContact CD1-CG 4.18Å; I23-L98 HydrophobicContact CG1-CD2 4.13Å; I23-K99 PolarHBondContact N-O 3.32Å; I23-V100 HydrophobicContact CD1-CG2 4.43Å; I23-H101 PolarHBondContact O-N 3.33Å
24	R	90.3	Very high	77.3	Confident	65 Å²	65	87 Å²	87	25%	0.245	46%	0.456	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.8	146.4	179	-56.5	178.7	-176.1	-94.6	9.8	110.4	T35 T36 H101	R24-T35 CarbonylContact O-C 3.59Å; R24-T35 WeakPolarHBondContact O-CA 3.48Å; R24-T36 PolarHBondContact N-O 3.49Å; R24-T36 PolarHBondContact O-N 3.37Å; R24-H101 HydrophobicContact CB-CB 4.41Å; R24-H101 HydrophobicContact CG-CB 3.98Å
25	I	92.2	Very high	79.8	Confident	14 Å²	14	82.4 Å²	82.4	7%	0.072	43%	0.426	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.7	137.5	171.1	-60.4	167.7	0	0	0	109	T33 L34 T35 D78 R80 H101 F103	I25-T33 HydrophobicContact CG2-CG2 4.29Å; I25-L34 CarbonylContact C-O 3.55Å; I25-L34 WeakPolarHBondContact CA-O 3.48Å; I25-T35 HydrophobicContact CG1-CG2 4.42Å; I25-D78 WeakPolarHBondContact CD1-OD1 3.32Å; I25-R80 HydrophobicContact CD1-CB 3.94Å; I25-R80 HydrophobicContact CD1-CG 3.94Å; I25-R80 HydrophobicContact CG1-CB 4.47Å; I25-H101 PolarHBondContact N-O 3.22Å; I25-F103 HydrophobicContact CB-CE2 4.38Å; I25-F103 HydrophobicContact CG2-CD2 4.05Å; I25-F103 HydrophobicContact CG2-CE2 3.41Å; I25-F103 VanDerWaalsContact CG2-CE2 3.41Å; I25-F103 HydrophobicContact CG2-CZ 3.93Å
26	Q	89.3	Confident	82	Confident	105 Å²	105	77 Å²	77	49%	0.491	38%	0.382	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.9	142.3	174.8	-59.7	-171.6	51.7	0	0	109.8	T33 L34	Q26-T33 CarbonylContact O-C 3.47Å; Q26-T33 VanDerWaalsContact O-CA 3.27Å; Q26-T33 WeakPolarHBondContact O-CA 3.03Å; Q26-L34 PolarHBondContact N-O 2.69Å; Q26-L34 PolarHBondContact O-N 2.67Å
27	Q	89.1	Confident	84.4	Confident	126 Å²	126	74 Å²	74	59%	0.589	35%	0.35	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-81.3	122.4	172.4	-159	168.7	29.9	0	0	109.3	G30 F103	Q27-G30 WeakPolarHBondContact CG-O 3.24Å; Q27-G30 PolarHBondContact NE2-O 3.17Å; Q27-F103 HydrophobicContact CB-CE1 3.82Å; Q27-F103 HydrophobicContact CB-CZ 3.84Å; Q27-F103 HydrophobicContact CG-CZ 4.38Å
28	R	87.3	Confident	86.4	Confident	138 Å²	138	72.7 Å²	72.7	52%	0.521	34%	0.341	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.6	-51.1	178.2	-171.2	-177.7	179.3	-179.3	-0.7	111.8	K32 L34	R28-K32 HydrophobicContact CB-CB 4.45Å; R28-K32 PolarHBondContact N-O 2.83Å; R28-L34 HydrophobicContact CB-CD1 3.85Å; R28-L34 HydrophobicContact CB-CG 3.96Å; R28-L34 HydrophobicContact CG-CD1 3.85Å; R28-L34 HydrophobicContact CG-CG 4.33Å
29	N	87.3	Confident	87.9	Confident	113 Å²	113	66 Å²	66	60%	0.604	32%	0.321	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-161.6	114.3	-175.6	-87.3	-31	0	0	0	110.4	R31 K32	N29-R31 PolarHBondContact O-N 2.95Å; N29-K32 PolarHBondContact N-O 3.14Å; N29-K32 WeakPolarHBondContact O-CB 3.29Å; N29-K32 PolarHBondContact O-N 3.13Å
30	G	86	Confident	88.7	Confident	59 Å²	59	61.3 Å²	61.3	61%	0.608	30%	0.296	S	S	*	.	T	Hydrogen-bonded Turn	trans	51.4	-107.8	177.9	0	0	0	0	0	111.3	Q27	Q27-G30 WeakPolarHBondContact CG-O 3.24Å; Q27-G30 PolarHBondContact NE2-O 3.17Å
31	R	85.6	Confident	88.5	Confident	250 Å²	250	59 Å²	59	94%	0.943	30%	0.296	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.2	-6.3	179.1	-59.5	-177.7	-176.5	177.5	0.4	115.1	N29	N29-R31 PolarHBondContact O-N 2.95Å
32	K	89.9	Confident	88	Confident	148 Å²	148	64.6 Å²	64.6	64%	0.643	33%	0.326	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-85.6	131	-178.8	-65	-175.2	178.3	-179	0	110.1	R28 N29	R28-K32 HydrophobicContact CB-CB 4.45Å; R28-K32 PolarHBondContact N-O 2.83Å; N29-K32 PolarHBondContact N-O 3.14Å; N29-K32 WeakPolarHBondContact O-CB 3.29Å; N29-K32 PolarHBondContact O-N 3.13Å
33	T	91.6	Very high	87.6	Confident	23 Å²	23	70.5 Å²	70.5	14%	0.141	36%	0.359	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.6	160	178.1	53.9	0	0	0	0	110.9	I25 Q26 G77 D78 F103	I25-T33 HydrophobicContact CG2-CG2 4.29Å; Q26-T33 CarbonylContact O-C 3.47Å; Q26-T33 VanDerWaalsContact O-CA 3.27Å; Q26-T33 WeakPolarHBondContact O-CA 3.03Å; T33-G77 WeakPolarHBondContact O-CA 3.38Å; T33-G77 PolarHBondContact O-N 2.83Å; T33-G77 WeakPolarHBondContact OG1-CA 3.11Å; T33-D78 PolarHBondContact OG1-N 2.87Å; T33-F103 HydrophobicContact CG2-CE2 3.78Å; T33-F103 HydrophobicContact CG2-CZ 3.79Å
34	L	91.4	Very high	87.1	Confident	32 Å²	32	75.6 Å²	75.6	17%	0.168	38%	0.379	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.9	135.4	171.5	-73.2	165.1	0	0	0	107.3	I25 Q26 R28 L75 Q76	I25-L34 CarbonylContact C-O 3.55Å; I25-L34 WeakPolarHBondContact CA-O 3.48Å; Q26-L34 PolarHBondContact N-O 2.69Å; Q26-L34 PolarHBondContact O-N 2.67Å; R28-L34 HydrophobicContact CB-CD1 3.85Å; R28-L34 HydrophobicContact CB-CG 3.96Å; R28-L34 HydrophobicContact CG-CD1 3.85Å; R28-L34 HydrophobicContact CG-CG 4.33Å; L34-L75 WeakPolarHBondContact CA-O 3.25Å; L34-Q76 HydrophobicContact CD2-CG 4.3Å
35	T	92.4	Very high	86.9	Confident	0 Å²	0	76 Å²	76	0%	0	39%	0.386	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.9	126.3	171.9	-54.8	0	0	0	0	108.1	I23 R24 I25 L75 G77 Q79 I83	I23-T35 HydrophobicContact CG2-CG2 3.59Å; R24-T35 CarbonylContact O-C 3.59Å; R24-T35 WeakPolarHBondContact O-CA 3.48Å; I25-T35 HydrophobicContact CG1-CG2 4.42Å; T35-L75 PolarHBondContact N-O 2.77Å; T35-L75 PolarHBondContact O-N 3.28Å; T35-G77 PolarHBondContact N-O 3.17Å; T35-G77 PolarHBondContact OG1-O 3.07Å; T35-Q79 PolarHBondContact OG1-N 2.93Å; T35-Q79 VanDerWaalsContact OG1-N 3.09Å; T35-I83 HydrophobicContact CG2-CD1 3.47Å; T35-I83 VanDerWaalsContact CG2-CD1 3.47Å
36	T	90.8	Very high	86.6	Confident	3 Å²	3	75.6 Å²	75.6	2%	0.018	38%	0.384	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.1	130.5	177.8	59.5	0	0	0	0	110.2	R24 I73 Q74	R24-T36 PolarHBondContact N-O 3.49Å; R24-T36 PolarHBondContact O-N 3.37Å; T36-I73 CarbonylContact C-O 3.55Å; T36-I73 WeakPolarHBondContact CA-O 3.24Å; T36-Q74 HydrophobicContact CG2-CG 3.88Å
37	V	89.8	Confident	86.5	Confident	1 Å²	1	77.8 Å²	77.8	1%	0.006	39%	0.392	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.9	120.7	175.2	-170.2	0	0	0	0	108.1	I21 H22 I23 I40 I73 I83	I21-V37 HydrophobicContact CG2-CG1 3.49Å; I21-V37 VanDerWaalsContact CG2-CG1 3.49Å; H22-V37 WeakPolarHBondContact O-CA 3.34Å; I23-V37 HydrophobicContact CG1-CG1 4.5Å; V37-I40 HydrophobicContact CG1-CD1 3.93Å; V37-I40 HydrophobicContact CG1-CG1 4Å; V37-I73 HydrophobicContact CB-CB 4.35Å; V37-I73 PolarHBondContact N-O 2.89Å; V37-I73 PolarHBondContact O-N 3.14Å; V37-I83 HydrophobicContact CG2-CD1 3.91Å; V37-I83 HydrophobicContact CG2-CG2 3.87Å
38	Q	89.1	Confident	86.5	Confident	22 Å²	22	78.6 Å²	78.6	10%	0.103	39%	0.393	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117	153.5	-178.8	-54.9	174.6	-23.9	0	0	109.4	I21 H22 V72	I21-Q38 WeakPolarHBondContact CA-O 3.43Å; H22-Q38 HydrophobicContact CB-CB 4.29Å; H22-Q38 PolarHBondContact N-O 3.32Å; H22-Q38 PolarHBondContact O-N 2.89Å; Q38-V72 HydrophobicContact CB-CG1 4.35Å; Q38-V72 HydrophobicContact CG-CG1 3.83Å
39	G	84.6	Confident	86.5	Confident	42 Å²	42	72.8 Å²	72.8	43%	0.433	37%	0.372	S	S	.	.			trans	82.7	19.9	176.8	0	0	0	0	0	115	A41	G39-A41 PolarHBondContact O-N 3.09Å
40	I	83.8	Confident	86.7	Confident	10 Å²	10	67.9 Å²	67.9	5%	0.051	35%	0.346	C	S	.	.			trans	-78.5	121.4	169.3	-55.6	-158.5	0	0	0	108.4	I21 V37 K46 L49 I73	I21-I40 HydrophobicContact CD1-CG1 4.08Å; V37-I40 HydrophobicContact CG1-CD1 3.93Å; V37-I40 HydrophobicContact CG1-CG1 4Å; I40-K46 HydrophobicContact CG2-CG 4.4Å; I40-K46 WeakPolarHBondContact O-CE 3.36Å; I40-L49 HydrophobicContact CD1-CD2 3.54Å; I40-I73 HydrophobicContact CD1-CD1 3.78Å
41	A	80.3	Confident	86.9	Confident	48 Å²	48	72.5 Å²	72.5	40%	0.397	35%	0.35	S	S	.	.			trans	-54.6	142	178.1	0	0	0	0	0	112.4	G39 D43 Y44	G39-A41 PolarHBondContact O-N 3.09Å; A41-D43 PolarHBondContact O-N 2.94Å; A41-Y44 HydrophobicContact CB-CD2 4.07Å; A41-Y44 HydrophobicContact CB-CE2 4.43Å; A41-Y44 PolarHBondContact O-N 3.05Å; A41-Y44 VanDerWaalsContact O-N 3.09Å
42	D	77.4	Confident	87.1	Confident	122 Å²	122	62.3 Å²	62.3	65%	0.652	32%	0.319	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.6	-19.7	-176.5	-68.5	-69	0	0	0	114.1	Y44 K46	D42-Y44 PolarHBondContact O-N 3.5Å; D42-K46 IonicContact OD1-NZ 3.61Å; D42-K46 PolarHBondContact OD1-NZ 3.39Å
43	D	80.3	Confident	87.1	Confident	160 Å²	160	55.2 Å²	55.2	86%	0.856	29%	0.288	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.7	-24.6	171.7	-65.3	-83.2	0	0	0	113.1	A41	A41-D43 PolarHBondContact O-N 2.94Å
44	Y	81.3	Confident	87	Confident	106 Å²	106	58.2 Å²	58.2	42%	0.416	30%	0.299	S	S	.	.	S	Bend	trans	-84.7	133.2	177.3	-70.4	-78.1	0	0	0	111.8	A41 D42 K46 I92	A41-Y44 HydrophobicContact CB-CD2 4.07Å; A41-Y44 HydrophobicContact CB-CE2 4.43Å; A41-Y44 PolarHBondContact O-N 3.05Å; A41-Y44 VanDerWaalsContact O-N 3.09Å; D42-Y44 PolarHBondContact O-N 3.5Å; Y44-K46 PolarHBondContact O-N 3.08Å; Y44-I92 HydrophobicContact CD1-CG2 4.48Å; Y44-I92 HydrophobicContact CD2-CG2 4.42Å; Y44-I92 HydrophobicContact CE1-CG1 4.41Å; Y44-I92 HydrophobicContact CE1-CG2 4.16Å; Y44-I92 HydrophobicContact CE2-CG2 4.1Å
45	D	84.9	Confident	87	Confident	73 Å²	73	66 Å²	66	39%	0.39	33%	0.332	S	S	.	.			trans	-70.9	89.5	174.8	-172.4	-20.1	0	0	0	110.9	K47 K48 L49	D45-K47 PolarHBondContact O-N 3.43Å; D45-K47 VanDerWaalsContact O-N 3.17Å; D45-K47 WeakPolarHBondContact OD1-CB 3.29Å; D45-K47 PolarHBondContact OD1-N 2.87Å; D45-K47 VanDerWaalsContact OD1-N 3.13Å; D45-K48 HydrophobicContact CB-CB 4.2Å; D45-K48 HydrophobicContact CB-CD 3.98Å; D45-K48 HydrophobicContact CB-CG 4.22Å; D45-K48 WeakPolarHBondContact O-CB 3.5Å; D45-K48 PolarHBondContact O-N 3.48Å; D45-K48 PolarHBondContact OD1-N 2.97Å; D45-K48 VanDerWaalsContact OD1-N 3.14Å; D45-K48 WeakPolarHBondContact OD2-CD 3.31Å; D45-K48 WeakPolarHBondContact OD2-CE 3.46Å; D45-K48 VanDerWaalsContact OD2-CG 3.31Å; D45-K48 WeakPolarHBondContact OD2-CG 3.46Å; D45-K48 IonicContact OD2-NZ 3.39Å; D45-K48 PolarHBondContact OD2-NZ 3.12Å; D45-L49 PolarHBondContact O-N 2.98Å; D45-L49 VanDerWaalsContact O-N 3.09Å
46	K	85.9	Confident	86.8	Confident	6 Å²	6	70.8 Å²	70.8	3%	0.026	35%	0.352	C	S	.	.	H	α-helix	trans	-57.1	-30.1	179.6	-56.1	-171.9	-170	80.7	0	111.9	I40 D42 Y44 L49 V50 V63 E71 I73	I40-K46 HydrophobicContact CG2-CG 4.4Å; I40-K46 WeakPolarHBondContact O-CE 3.36Å; D42-K46 IonicContact OD1-NZ 3.61Å; D42-K46 PolarHBondContact OD1-NZ 3.39Å; Y44-K46 PolarHBondContact O-N 3.08Å; K46-L49 WeakPolarHBondContact O-CB 3.29Å; K46-L49 PolarHBondContact O-N 2.63Å; K46-V50 WeakPolarHBondContact O-CG2 3.42Å; K46-V50 PolarHBondContact O-N 3.43Å; K46-V63 HydrophobicContact CB-CG1 4.34Å; K46-V63 HydrophobicContact CB-CG2 3.96Å; K46-V63 HydrophobicContact CD-CG1 4.34Å; K46-E71 HydrophobicContact CD-CB 3.69Å; K46-E71 WeakPolarHBondContact CD-OE2 3.27Å; K46-E71 WeakPolarHBondContact CE-O 3.45Å; K46-E71 WeakPolarHBondContact CE-OE2 3.46Å; K46-E71 IonicContact NZ-OE2 2.67Å; K46-E71 PolarHBondContact NZ-OE2 3.2Å; K46-I73 HydrophobicContact CB-CD1 4.18Å; K46-I73 HydrophobicContact CB-CG1 4.42Å
47	K	87.3	Confident	86.6	Confident	152 Å²	152	71.8 Å²	71.8	66%	0.661	36%	0.357	S	S	*	.	H	α-helix	trans	-68.7	-39.8	177.2	-67.6	175	-178.5	166.1	0	111.6	D45 L49 K51	D45-K47 PolarHBondContact O-N 3.43Å; D45-K47 VanDerWaalsContact O-N 3.17Å; D45-K47 WeakPolarHBondContact OD1-CB 3.29Å; D45-K47 PolarHBondContact OD1-N 2.87Å; D45-K47 VanDerWaalsContact OD1-N 3.13Å; K47-L49 VanDerWaalsContact C-N 3.34Å; K47-K51 WeakPolarHBondContact O-CG 3.37Å; K47-K51 PolarHBondContact O-N 3.19Å
48	K	89.2	Confident	86.5	Confident	143 Å²	143	76.4 Å²	76.4	62%	0.622	40%	0.395	S	S	*	.	H	α-helix	trans	-64.9	-41	172.2	-75.4	176	-170.1	157.4	0	111.2	D45 V50 K51 A52	D45-K48 HydrophobicContact CB-CB 4.2Å; D45-K48 HydrophobicContact CB-CD 3.98Å; D45-K48 HydrophobicContact CB-CG 4.22Å; D45-K48 WeakPolarHBondContact O-CB 3.5Å; D45-K48 PolarHBondContact O-N 3.48Å; D45-K48 PolarHBondContact OD1-N 2.97Å; D45-K48 VanDerWaalsContact OD1-N 3.14Å; D45-K48 WeakPolarHBondContact OD2-CD 3.31Å; D45-K48 WeakPolarHBondContact OD2-CE 3.46Å; D45-K48 VanDerWaalsContact OD2-CG 3.31Å; D45-K48 WeakPolarHBondContact OD2-CG 3.46Å; D45-K48 IonicContact OD2-NZ 3.39Å; D45-K48 PolarHBondContact OD2-NZ 3.12Å; K48-V50 PolarHBondContact O-N 2.95Å; K48-K51 WeakPolarHBondContact O-CB 3.46Å; K48-K51 PolarHBondContact O-N 3.49Å; K48-A52 PolarHBondContact O-N 2.89Å
49	L	88	Confident	86.5	Confident	15 Å²	15	76.7 Å²	76.7	8%	0.079	40%	0.399	C	S	.	.	H	α-helix	trans	-59.7	-47.7	177.2	-143.5	103	0	0	0	111.4	I40 D45 K46 K47 K51 A52 F53 I73 I92	I40-L49 HydrophobicContact CD1-CD2 3.54Å; D45-L49 PolarHBondContact O-N 2.98Å; D45-L49 VanDerWaalsContact O-N 3.09Å; K46-L49 WeakPolarHBondContact O-CB 3.29Å; K46-L49 PolarHBondContact O-N 2.63Å; K47-L49 VanDerWaalsContact C-N 3.34Å; L49-K51 VanDerWaalsContact C-N 3.32Å; L49-K51 PolarHBondContact O-N 3.38Å; L49-A52 WeakPolarHBondContact O-CB 3.35Å; L49-A52 PolarHBondContact O-N 3.41Å; L49-A52 VanDerWaalsContact O-N 3.12Å; L49-F53 HydrophobicContact CD2-CD2 4.27Å; L49-F53 HydrophobicContact CD2-CE1 4.34Å; L49-F53 HydrophobicContact CD2-CE2 3.35Å; L49-F53 HydrophobicContact CD2-CZ 3.39Å; L49-F53 HydrophobicContact CG-CE2 4.1Å; L49-F53 HydrophobicContact CG-CZ 4.07Å; L49-F53 WeakPolarHBondContact O-CD2 3.36Å; L49-F53 VanDerWaalsContact O-CG 3.29Å; L49-F53 WeakPolarHBondContact O-CG 3.38Å; L49-F53 PolarHBondContact O-N 3.24Å; L49-I73 HydrophobicContact CB-CD1 4.19Å; L49-I73 HydrophobicContact CD2-CD1 3.55Å; L49-I92 HydrophobicContact CD1-CD1 3.41Å; L49-I92 VanDerWaalsContact CD1-CD1 3.41Å
50	V	90.5	Very high	86.8	Confident	10 Å²	10	78.8 Å²	78.8	6%	0.061	40%	0.4	C	S	.	.	H	α-helix	trans	-60.3	-39.7	174.9	170.5	0	0	0	0	111.9	K46 K48 A52 F53 K54 V63 I73	K46-V50 WeakPolarHBondContact O-CG2 3.42Å; K46-V50 PolarHBondContact O-N 3.43Å; K48-V50 PolarHBondContact O-N 2.95Å; V50-A52 VanDerWaalsContact C-N 3.35Å; V50-F53 PolarHBondContact O-N 3.44Å; V50-K54 HydrophobicContact CG1-CD 4.18Å; V50-K54 HydrophobicContact CG1-CG 4.41Å; V50-K54 WeakPolarHBondContact O-CB 3.44Å; V50-K54 VanDerWaalsContact O-CG 3.28Å; V50-K54 WeakPolarHBondContact O-CG 3.46Å; V50-K54 PolarHBondContact O-N 3.23Å; V50-V63 HydrophobicContact CG2-CG2 3.63Å; V50-I73 HydrophobicContact CG2-CB 4.41Å; V50-I73 HydrophobicContact CG2-CD1 4.04Å; V50-I73 HydrophobicContact CG2-CG1 4.04Å; V50-I73 HydrophobicContact CG2-CG2 3.6Å
51	K	90.7	Very high	87.1	Confident	156 Å²	156	78.5 Å²	78.5	68%	0.678	40%	0.4	S	S	*	.	H	α-helix	trans	-62.8	-41.8	174.6	-75.6	178.6	-178.4	178.5	0	111.8	K47 K48 L49 K54 K55	K47-K51 WeakPolarHBondContact O-CG 3.37Å; K47-K51 PolarHBondContact O-N 3.19Å; K48-K51 WeakPolarHBondContact O-CB 3.46Å; K48-K51 PolarHBondContact O-N 3.49Å; L49-K51 VanDerWaalsContact C-N 3.32Å; L49-K51 PolarHBondContact O-N 3.38Å; K51-K54 PolarHBondContact O-N 2.9Å; K51-K55 PolarHBondContact O-N 2.83Å; K51-K55 VanDerWaalsContact O-N 3.08Å
52	A	90.2	Very high	87.7	Confident	36 Å²	36	79.6 Å²	79.6	30%	0.298	40%	0.402	S	S	.	.	H	α-helix	trans	-64.5	-44.2	176.5	0	0	0	0	0	111.4	K48 L49 V50 K54 K55 K56 F86	K48-A52 PolarHBondContact O-N 2.89Å; L49-A52 WeakPolarHBondContact O-CB 3.35Å; L49-A52 PolarHBondContact O-N 3.41Å; L49-A52 VanDerWaalsContact O-N 3.12Å; V50-A52 VanDerWaalsContact C-N 3.35Å; A52-K54 PolarHBondContact O-N 3.22Å; A52-K55 PolarHBondContact O-N 2.89Å; A52-K56 WeakPolarHBondContact O-CB 2.84Å; A52-K56 PolarHBondContact O-N 3.06Å; A52-F86 HydrophobicContact CB-CE1 4.47Å; A52-F86 HydrophobicContact CB-CE2 4.38Å; A52-F86 HydrophobicContact CB-CZ 3.68Å
53	F	89.6	Confident	88.3	Confident	0 Å²	0	75.4 Å²	75.4	0%	0	38%	0.381	C	S	.	.	H	α-helix	trans	-60	-44.6	174.6	-67.6	-27.7	0	0	0	112.7	L49 V50 K55 K56 F57 I73 L75 I83 F86 L87	L49-F53 HydrophobicContact CD2-CD2 4.27Å; L49-F53 HydrophobicContact CD2-CE1 4.34Å; L49-F53 HydrophobicContact CD2-CE2 3.35Å; L49-F53 HydrophobicContact CD2-CZ 3.39Å; L49-F53 HydrophobicContact CG-CE2 4.1Å; L49-F53 HydrophobicContact CG-CZ 4.07Å; L49-F53 WeakPolarHBondContact O-CD2 3.36Å; L49-F53 VanDerWaalsContact O-CG 3.29Å; L49-F53 WeakPolarHBondContact O-CG 3.38Å; L49-F53 PolarHBondContact O-N 3.24Å; V50-F53 PolarHBondContact O-N 3.44Å; F53-K55 VanDerWaalsContact C-N 3.3Å; F53-K55 PolarHBondContact O-N 3.4Å; F53-K56 PolarHBondContact O-N 3.36Å; F53-F57 HydrophobicContact CB-CD2 3.82Å; F53-F57 HydrophobicContact CB-CE2 3.89Å; F53-F57 HydrophobicContact CD1-CD2 4.04Å; F53-F57 AromaticContact CD1-CE2 3.2Å; F53-F57 HydrophobicContact CD1-CE2 3.2Å; F53-F57 AromaticContact CD1-CZ 3.77Å; F53-F57 HydrophobicContact CD1-CZ 3.77Å; F53-F57 AromaticContact CE1-CE2 3.76Å; F53-F57 HydrophobicContact CE1-CE2 3.76Å; F53-F57 HydrophobicContact CE1-CZ 4.1Å; F53-F57 HydrophobicContact CG-CD2 4.19Å; F53-F57 AromaticContact CG-CE2 3.74Å; F53-F57 HydrophobicContact CG-CE2 3.74Å; F53-F57 VanDerWaalsContact O-CB 3.32Å; F53-F57 WeakPolarHBondContact O-CB 3.38Å; F53-F57 WeakPolarHBondContact O-CD2 3.47Å; F53-F57 WeakPolarHBondContact O-CG 3.28Å; F53-F57 PolarHBondContact O-N 2.99Å; F53-I73 HydrophobicContact CD2-CG2 4.18Å; F53-I73 HydrophobicContact CE2-CD1 4.18Å; F53-I73 HydrophobicContact CE2-CG2 4.2Å; F53-L75 HydrophobicContact CB-CD1 4.3Å; F53-L75 HydrophobicContact CB-CD2 3.91Å; F53-L75 HydrophobicContact CD2-CD1 3.79Å; F53-L75 HydrophobicContact CD2-CD2 4.32Å; F53-L75 HydrophobicContact CD2-CG 4.47Å; F53-L75 HydrophobicContact CE2-CD1 4.21Å; F53-L75 HydrophobicContact CG-CD1 4.16Å; F53-I83 HydrophobicContact CZ-CG2 4.2Å; F53-F86 AromaticContact CD1-CD1 3.87Å; F53-F86 HydrophobicContact CD1-CD1 3.87Å; F53-F86 AromaticContact CD1-CE1 3.95Å; F53-F86 HydrophobicContact CD1-CE1 3.95Å; F53-F86 HydrophobicContact CD1-CG 4.3Å; F53-F86 HydrophobicContact CE1-CB 4.35Å; F53-F86 AromaticContact CE1-CD1 3.23Å; F53-F86 HydrophobicContact CE1-CD1 3.23Å; F53-F86 AromaticContact CE1-CE1 3.59Å; F53-F86 HydrophobicContact CE1-CE1 3.59Å; F53-F86 AromaticContact CE1-CG 3.91Å; F53-F86 HydrophobicContact CE1-CG 3.91Å; F53-F86 HydrophobicContact CZ-CD1 4.19Å; F53-F86 HydrophobicContact CZ-CE1 4.46Å; F53-L87 HydrophobicContact CZ-CD2 4.45Å
54	K	90.1	Very high	88.7	Confident	85 Å²	85	70.7 Å²	70.7	37%	0.37	36%	0.355	S	S	.	.	H	α-helix	trans	-57.8	-43.5	174.9	-75.4	177.1	177.1	-174.8	0	111.8	V50 K51 A52 A58 C59 N60 G61	V50-K54 HydrophobicContact CG1-CD 4.18Å; V50-K54 HydrophobicContact CG1-CG 4.41Å; V50-K54 WeakPolarHBondContact O-CB 3.44Å; V50-K54 VanDerWaalsContact O-CG 3.28Å; V50-K54 WeakPolarHBondContact O-CG 3.46Å; V50-K54 PolarHBondContact O-N 3.23Å; K51-K54 PolarHBondContact O-N 2.9Å; A52-K54 PolarHBondContact O-N 3.22Å; K54-A58 WeakPolarHBondContact O-CA 3.37Å; K54-A58 PolarHBondContact O-N 2.95Å; K54-C59 WeakPolarHBondContact CA-O 3.38Å; K54-C59 WeakPolarHBondContact CG-O 3.45Å; K54-N60 WeakPolarHBondContact CE-OD1 3.46Å; K54-N60 PolarHBondContact NZ-OD1 3.5Å; K54-G61 VanDerWaalsContact CE-N 3.31Å; K54-G61 WeakPolarHBondContact CE-O 3.32Å; K54-G61 PolarHBondContact NZ-O 3.36Å
55	K	90.1	Very high	88.9	Confident	195 Å²	195	73.1 Å²	73.1	85%	0.848	37%	0.37	S	S	*	.	H	α-helix	trans	-70.4	-40.7	-179.1	-168.2	178.3	-179.7	-177.5	0	112.5	K51 A52 F53	K51-K55 PolarHBondContact O-N 2.83Å; K51-K55 VanDerWaalsContact O-N 3.08Å; A52-K55 PolarHBondContact O-N 2.89Å; F53-K55 VanDerWaalsContact C-N 3.3Å; F53-K55 PolarHBondContact O-N 3.4Å
56	K	88.4	Confident	88.6	Confident	101 Å²	101	72.9 Å²	72.9	44%	0.439	37%	0.367	S	S	.	.	H	α-helix	trans	-84	-37.8	-174.8	-164.6	164.9	180	166	0	113.1	A52 F53 F86 E89	A52-K56 WeakPolarHBondContact O-CB 2.84Å; A52-K56 PolarHBondContact O-N 3.06Å; F53-K56 PolarHBondContact O-N 3.36Å; K56-F86 HydrophobicContact CD-CD2 3.48Å; K56-F86 VanDerWaalsContact CD-CD2 3.48Å; K56-F86 HydrophobicContact CD-CE2 3.85Å; K56-E89 IonicContact NZ-OE1 2.69Å; K56-E89 PolarHBondContact NZ-OE1 3.04Å; K56-E89 IonicContact NZ-OE2 2.98Å; K56-E89 PolarHBondContact NZ-OE2 2.96Å
57	F	87	Confident	88.2	Confident	24 Å²	24	79 Å²	79	11%	0.105	41%	0.406	C	S	.	.	H	α-helix	trans	-98.7	-4.1	-175.1	-49.1	-35.4	0	0	0	113.4	F53 C59 L75 N82 I83 F86	F53-F57 HydrophobicContact CB-CD2 3.82Å; F53-F57 HydrophobicContact CB-CE2 3.89Å; F53-F57 HydrophobicContact CD1-CD2 4.04Å; F53-F57 AromaticContact CD1-CE2 3.2Å; F53-F57 HydrophobicContact CD1-CE2 3.2Å; F53-F57 AromaticContact CD1-CZ 3.77Å; F53-F57 HydrophobicContact CD1-CZ 3.77Å; F53-F57 AromaticContact CE1-CE2 3.76Å; F53-F57 HydrophobicContact CE1-CE2 3.76Å; F53-F57 HydrophobicContact CE1-CZ 4.1Å; F53-F57 HydrophobicContact CG-CD2 4.19Å; F53-F57 AromaticContact CG-CE2 3.74Å; F53-F57 HydrophobicContact CG-CE2 3.74Å; F53-F57 VanDerWaalsContact O-CB 3.32Å; F53-F57 WeakPolarHBondContact O-CB 3.38Å; F53-F57 WeakPolarHBondContact O-CD2 3.47Å; F53-F57 WeakPolarHBondContact O-CG 3.28Å; F53-F57 PolarHBondContact O-N 2.99Å; F57-C59 HydrophobicContact CB-CB 4.3Å; F57-C59 PolarHBondContact O-N 3.18Å; F57-C59 PolarHBondContact O-SG 3.41Å; F57-L75 HydrophobicContact CD2-CD1 4.42Å; F57-L75 HydrophobicContact CE2-CD1 4.48Å; F57-N82 HydrophobicContact CD1-CB 3.74Å; F57-N82 HydrophobicContact CE1-CB 3.52Å; F57-N82 HydrophobicContact CG-CB 4.43Å; F57-N82 HydrophobicContact CZ-CB 3.99Å; F57-N82 WeakPolarHBondContact CZ-O 3.38Å; F57-I83 HydrophobicContact CE2-CG1 3.84Å; F57-I83 HydrophobicContact CZ-CG1 4.37Å; F57-F86 HydrophobicContact CE1-CB 4.41Å; F57-F86 HydrophobicContact CZ-CB 3.82Å; F57-F86 HydrophobicContact CZ-CG 4.25Å
58	A	87.9	Confident	87.7	Confident	98 Å²	98	77.6 Å²	77.6	81%	0.81	40%	0.402	S	S	*	.			trans	50.6	28.9	-174.4	0	0	0	0	0	113.4	K54	K54-A58 WeakPolarHBondContact O-CA 3.37Å; K54-A58 PolarHBondContact O-N 2.95Å
59	C	89.4	Confident	86.8	Confident	28 Å²	28	74.4 Å²	74.4	19%	0.189	39%	0.387	C	S	.	.			trans	-110.8	156.3	-177.9	-71.6	0	0	0	0	110.6	K54 F57 Q76 Q79	K54-C59 WeakPolarHBondContact CA-O 3.38Å; K54-C59 WeakPolarHBondContact CG-O 3.45Å; F57-C59 HydrophobicContact CB-CB 4.3Å; F57-C59 PolarHBondContact O-N 3.18Å; F57-C59 PolarHBondContact O-SG 3.41Å; C59-Q76 PolarHBondContact SG-O 2.83Å; C59-Q79 PolarHBondContact SG-NE2 2.83Å
60	N	90.3	Very high	86.6	Confident	86 Å²	86	75.3 Å²	75.3	46%	0.46	40%	0.4	S	S	.	.			trans	-81.8	147.2	169.2	-160.9	7.5	0	0	0	110.4	K54 Q76	K54-N60 WeakPolarHBondContact CE-OD1 3.46Å; K54-N60 PolarHBondContact NZ-OD1 3.5Å; N60-Q76 HydrophobicContact CB-CG 4.28Å; N60-Q76 PolarHBondContact O-N 2.88Å
61	G	91.2	Very high	86.4	Confident	5 Å²	5	78.5 Å²	78.5	5%	0.052	41%	0.414	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.2	151	-177.4	0	0	0	0	0	112.3	K54 Q74	K54-G61 VanDerWaalsContact CE-N 3.31Å; K54-G61 WeakPolarHBondContact CE-O 3.32Å; K54-G61 PolarHBondContact NZ-O 3.36Å; G61-Q74 CarbonylContact C-O 3.47Å; G61-Q74 WeakPolarHBondContact CA-O 3.36Å
62	T	91.6	Very high	86.3	Confident	70 Å²	70	71.3 Å²	71.3	43%	0.429	38%	0.384	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.7	148.9	176.6	-171.3	0	0	0	0	109.8	I64 Q74	T62-I64 HydrophobicContact CG2-CD1 3.45Å; T62-I64 VanDerWaalsContact CG2-CD1 3.45Å; T62-I64 HydrophobicContact CG2-CG1 3.74Å; T62-Q74 HydrophobicContact CG2-CB 4.19Å; T62-Q74 PolarHBondContact N-O 2.85Å; T62-Q74 PolarHBondContact O-N 3.39Å
63	V	90.7	Very high	86.3	Confident	35 Å²	35	69.6 Å²	69.6	21%	0.212	37%	0.369	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.8	131.7	163.2	-172.2	0	0	0	0	106	K46 V50 E71 V72 I73	K46-V63 HydrophobicContact CB-CG1 4.34Å; K46-V63 HydrophobicContact CB-CG2 3.96Å; K46-V63 HydrophobicContact CD-CG1 4.34Å; V50-V63 HydrophobicContact CG2-CG2 3.63Å; V63-E71 HydrophobicContact CG1-CB 4.22Å; V63-E71 HydrophobicContact CG1-CG 4.48Å; V63-V72 WeakPolarHBondContact CA-O 3.45Å; V63-I73 HydrophobicContact CG2-CG1 4.4Å
64	I	89	Confident	86.4	Confident	60 Å²	60	72 Å²	72	31%	0.308	38%	0.38	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.9	137.5	176	-75.2	161.5	0	0	0	106.9	T62 V72 Q74	T62-I64 HydrophobicContact CG2-CD1 3.45Å; T62-I64 VanDerWaalsContact CG2-CD1 3.45Å; T62-I64 HydrophobicContact CG2-CG1 3.74Å; I64-V72 HydrophobicContact CB-CG2 4.33Å; I64-V72 PolarHBondContact N-O 2.75Å; I64-V72 VanDerWaalsContact O-CG2 3.25Å; I64-V72 WeakPolarHBondContact O-CG2 3.35Å; I64-V72 PolarHBondContact O-N 3.05Å; I64-V72 VanDerWaalsContact O-O 3.11Å; I64-Q74 HydrophobicContact CD1-CB 4.3Å; I64-Q74 HydrophobicContact CD1-CG 3.82Å
65	E	85.4	Confident	86.5	Confident	157 Å²	157	68 Å²	68	73%	0.734	36%	0.363	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-86.9	124.5	171.5	-166	177.2	169.5	0	0	108.9
66	H	78.5	Confident	86.6	Confident	69 Å²	69	62.8 Å²	62.8	32%	0.319	34%	0.342	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.6	133	175.3	-161.2	-86.4	0	0	0	108.9	E68 Y69 G70 V72	H66-E68 PolarHBondContact ND1-N 3.17Å; H66-E68 PolarHBondContact O-N 3.39Å; H66-E68 VanDerWaalsContact O-N 3.14Å; H66-Y69 HydrophobicContact CB-CD2 4.29Å; H66-Y69 AromaticContact CE1-CD2 3.59Å; H66-Y69 AromaticContact CE1-CE2 3.58Å; H66-Y69 AromaticContact CG-CD2 3.69Å; H66-Y69 AromaticContact ND1-CD2 3.17Å; H66-Y69 WeakPolarHBondContact ND1-CD2 3.29Å; H66-Y69 AromaticContact ND1-CE2 3.64Å; H66-Y69 PolarHBondContact O-N 2.84Å; H66-G70 PolarHBondContact N-O 2.86Å; H66-G70 WeakPolarHBondContact O-CA 3.29Å; H66-G70 PolarHBondContact O-N 2.85Å; H66-V72 HydrophobicContact CB-CG1 4.43Å; H66-V72 HydrophobicContact CB-CG2 4.34Å
67	P	77.9	Confident	86.7	Confident	133 Å²	133	59.1 Å²	59.1	86%	0.864	33%	0.333	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.9	-26.4	-176	23.2	-34	0	0	0	113.8
68	E	76.6	Confident	86.8	Confident	123 Å²	123	61.2 Å²	61.2	58%	0.575	35%	0.345	S	S	*	.	T	Hydrogen-bonded Turn	trans	-98.1	-30.6	-178.5	-169.9	173.8	-157.6	0	0	113.7	H66	H66-E68 PolarHBondContact ND1-N 3.17Å; H66-E68 PolarHBondContact O-N 3.39Å; H66-E68 VanDerWaalsContact O-N 3.14Å
69	Y	70.8	Confident	86.7	Confident	76 Å²	76	57.6 Å²	57.6	30%	0.298	31%	0.311	S	S	.	.	T	Hydrogen-bonded Turn	trans	-116.1	2.7	-171	-51.3	-67.1	0	0	0	113.5	D11 H66	D11-Y69 PolarHBondContact OD1-OH 2.86Å; H66-Y69 HydrophobicContact CB-CD2 4.29Å; H66-Y69 AromaticContact CE1-CD2 3.59Å; H66-Y69 AromaticContact CE1-CE2 3.58Å; H66-Y69 AromaticContact CG-CD2 3.69Å; H66-Y69 AromaticContact ND1-CD2 3.17Å; H66-Y69 WeakPolarHBondContact ND1-CD2 3.29Å; H66-Y69 AromaticContact ND1-CE2 3.64Å; H66-Y69 PolarHBondContact O-N 2.84Å
70	G	83.1	Confident	86.8	Confident	34 Å²	34	59.9 Å²	59.9	35%	0.351	32%	0.316	S	S	.	.	E	Extended strand (participates in β ladder)	trans	68	-148.7	-175.6	0	0	0	0	0	113	H66 V72	H66-G70 PolarHBondContact N-O 2.86Å; H66-G70 WeakPolarHBondContact O-CA 3.29Å; H66-G70 PolarHBondContact O-N 2.85Å; G70-V72 PolarHBondContact O-N 3.43Å
71	E	85.1	Confident	86.7	Confident	78 Å²	78	63.2 Å²	63.2	36%	0.364	33%	0.326	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.4	114.3	-179.7	-72.2	-165.9	141.8	0	0	112.4	K46 V63	K46-E71 HydrophobicContact CD-CB 3.69Å; K46-E71 WeakPolarHBondContact CD-OE2 3.27Å; K46-E71 WeakPolarHBondContact CE-O 3.45Å; K46-E71 WeakPolarHBondContact CE-OE2 3.46Å; K46-E71 IonicContact NZ-OE2 2.67Å; K46-E71 PolarHBondContact NZ-OE2 3.2Å; V63-E71 HydrophobicContact CG1-CB 4.22Å; V63-E71 HydrophobicContact CG1-CG 4.48Å
72	V	88.8	Confident	86.6	Confident	5 Å²	5	66.5 Å²	66.5	3%	0.03	34%	0.343	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.8	147.4	178.1	-59.9	0	0	0	0	111.3	Q38 V63 I64 H66 G70	Q38-V72 HydrophobicContact CB-CG1 4.35Å; Q38-V72 HydrophobicContact CG-CG1 3.83Å; V63-V72 WeakPolarHBondContact CA-O 3.45Å; I64-V72 HydrophobicContact CB-CG2 4.33Å; I64-V72 PolarHBondContact N-O 2.75Å; I64-V72 VanDerWaalsContact O-CG2 3.25Å; I64-V72 WeakPolarHBondContact O-CG2 3.35Å; I64-V72 PolarHBondContact O-N 3.05Å; I64-V72 VanDerWaalsContact O-O 3.11Å; H66-V72 HydrophobicContact CB-CG1 4.43Å; H66-V72 HydrophobicContact CB-CG2 4.34Å; G70-V72 PolarHBondContact O-N 3.43Å
73	I	91.1	Very high	86.5	Confident	0 Å²	0	63.1 Å²	63.1	0%	0	32%	0.322	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.7	123.8	174.3	-62.6	177.6	0	0	0	109	T36 V37 I40 K46 L49 V50 F53 V63 L75	T36-I73 CarbonylContact C-O 3.55Å; T36-I73 WeakPolarHBondContact CA-O 3.24Å; V37-I73 HydrophobicContact CB-CB 4.35Å; V37-I73 PolarHBondContact N-O 2.89Å; V37-I73 PolarHBondContact O-N 3.14Å; I40-I73 HydrophobicContact CD1-CD1 3.78Å; K46-I73 HydrophobicContact CB-CD1 4.18Å; K46-I73 HydrophobicContact CB-CG1 4.42Å; L49-I73 HydrophobicContact CB-CD1 4.19Å; L49-I73 HydrophobicContact CD2-CD1 3.55Å; V50-I73 HydrophobicContact CG2-CB 4.41Å; V50-I73 HydrophobicContact CG2-CD1 4.04Å; V50-I73 HydrophobicContact CG2-CG1 4.04Å; V50-I73 HydrophobicContact CG2-CG2 3.6Å; F53-I73 HydrophobicContact CD2-CG2 4.18Å; F53-I73 HydrophobicContact CE2-CD1 4.18Å; F53-I73 HydrophobicContact CE2-CG2 4.2Å; V63-I73 HydrophobicContact CG2-CG1 4.4Å; I73-L75 HydrophobicContact CG2-CG 4.27Å
74	Q	91.3	Very high	86.4	Confident	50 Å²	50	63 Å²	63	23%	0.234	32%	0.322	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.7	132.6	173.1	-58.7	-161.6	-13.2	0	0	110.8	T36 G61 T62 I64	T36-Q74 HydrophobicContact CG2-CG 3.88Å; G61-Q74 CarbonylContact C-O 3.47Å; G61-Q74 WeakPolarHBondContact CA-O 3.36Å; T62-Q74 HydrophobicContact CG2-CB 4.19Å; T62-Q74 PolarHBondContact N-O 2.85Å; T62-Q74 PolarHBondContact O-N 3.39Å; I64-Q74 HydrophobicContact CD1-CB 4.3Å; I64-Q74 HydrophobicContact CD1-CG 3.82Å
75	L	93.3	Very high	86.4	Confident	0 Å²	0	66.3 Å²	66.3	0%	0	34%	0.336	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124	145.6	176.6	-69.5	165.4	0	0	0	110.3	L34 T35 F53 F57 I73 I83	L34-L75 WeakPolarHBondContact CA-O 3.25Å; T35-L75 PolarHBondContact N-O 2.77Å; T35-L75 PolarHBondContact O-N 3.28Å; F53-L75 HydrophobicContact CB-CD1 4.3Å; F53-L75 HydrophobicContact CB-CD2 3.91Å; F53-L75 HydrophobicContact CD2-CD1 3.79Å; F53-L75 HydrophobicContact CD2-CD2 4.32Å; F53-L75 HydrophobicContact CD2-CG 4.47Å; F53-L75 HydrophobicContact CE2-CD1 4.21Å; F53-L75 HydrophobicContact CG-CD1 4.16Å; F57-L75 HydrophobicContact CD2-CD1 4.42Å; F57-L75 HydrophobicContact CE2-CD1 4.48Å; I73-L75 HydrophobicContact CG2-CG 4.27Å; L75-I83 HydrophobicContact CD1-CD1 3.5Å; L75-I83 HydrophobicContact CD1-CG1 3.83Å
76	Q	91	Very high	86.6	Confident	86 Å²	86	59.9 Å²	59.9	40%	0.402	31%	0.306	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.8	139.1	174.3	-63.9	-174.5	3.4	0	0	111.4	L34 C59 N60	L34-Q76 HydrophobicContact CD2-CG 4.3Å; C59-Q76 PolarHBondContact SG-O 2.83Å; N60-Q76 HydrophobicContact CB-CG 4.28Å; N60-Q76 PolarHBondContact O-N 2.88Å
77	G	90.6	Very high	87	Confident	24 Å²	24	56.6 Å²	56.6	25%	0.247	29%	0.291	C	S	.	.	S	Bend	trans	85.9	176.9	-178.1	0	0	0	0	0	113.2	T33 T35 Q79	T33-G77 WeakPolarHBondContact O-CA 3.38Å; T33-G77 PolarHBondContact O-N 2.83Å; T33-G77 WeakPolarHBondContact OG1-CA 3.11Å; T35-G77 PolarHBondContact N-O 3.17Å; T35-G77 PolarHBondContact OG1-O 3.07Å; G77-Q79 PolarHBondContact O-N 2.82Å
78	D	89.7	Confident	87.4	Confident	68 Å²	68	53.2 Å²	53.2	36%	0.364	27%	0.265	S	S	.	.			trans	-88	104.4	173.4	179.2	-0.7	0	0	0	108.2	I25 T33 R80	I25-D78 WeakPolarHBondContact CD1-OD1 3.32Å; T33-D78 PolarHBondContact OG1-N 2.87Å; D78-R80 VanDerWaalsContact CG-NH1 3.33Å; D78-R80 WeakPolarHBondContact OD1-CG 3.29Å; D78-R80 PolarHBondContact OD1-N 2.75Å; D78-R80 IonicContact OD1-NH1 3.33Å; D78-R80 PolarHBondContact OD1-NH1 3.03Å; D78-R80 IonicContact OD2-CZ 3.51Å; D78-R80 IonicContact OD2-NH1 2.64Å; D78-R80 PolarHBondContact OD2-NH1 3.45Å; D78-R80 IonicContact OD2-NH2 3.96Å
79	Q	86.4	Confident	87.9	Confident	23 Å²	23	53.5 Å²	53.5	11%	0.107	27%	0.267	C	S	.	.			trans	-118	16.4	-177.4	-60.6	-60.1	-27.8	0	0	111.7	T35 C59 G77 K81 N82 I83	T35-Q79 PolarHBondContact OG1-N 2.93Å; T35-Q79 VanDerWaalsContact OG1-N 3.09Å; C59-Q79 PolarHBondContact SG-NE2 2.83Å; G77-Q79 PolarHBondContact O-N 2.82Å; Q79-K81 VanDerWaalsContact C-N 3.29Å; Q79-K81 PolarHBondContact O-N 2.87Å; Q79-N82 PolarHBondContact O-N 2.82Å; Q79-N82 VanDerWaalsContact O-N 3.1Å; Q79-N82 PolarHBondContact OE1-ND2 2.99Å; Q79-I83 HydrophobicContact CB-CD1 3.81Å; Q79-I83 HydrophobicContact CB-CG1 3.99Å; Q79-I83 VanDerWaalsContact O-CG1 3.27Å; Q79-I83 WeakPolarHBondContact O-CG1 3.41Å; Q79-I83 PolarHBondContact O-N 3.13Å
80	R	89.7	Confident	88.5	Confident	76 Å²	76	53.5 Å²	53.5	29%	0.287	27%	0.274	S	S	.	.	H	α-helix	trans	-54.6	-43.7	-172	66.2	176.6	174.8	-92.9	0.3	113.4	I23 I25 D78 C84 V100	I23-R80 HydrophobicContact CG2-CB 4.21Å; I25-R80 HydrophobicContact CD1-CB 3.94Å; I25-R80 HydrophobicContact CD1-CG 3.94Å; I25-R80 HydrophobicContact CG1-CB 4.47Å; D78-R80 VanDerWaalsContact CG-NH1 3.33Å; D78-R80 WeakPolarHBondContact OD1-CG 3.29Å; D78-R80 PolarHBondContact OD1-N 2.75Å; D78-R80 IonicContact OD1-NH1 3.33Å; D78-R80 PolarHBondContact OD1-NH1 3.03Å; D78-R80 IonicContact OD2-CZ 3.51Å; D78-R80 IonicContact OD2-NH1 2.64Å; D78-R80 PolarHBondContact OD2-NH1 3.45Å; D78-R80 IonicContact OD2-NH2 3.96Å; R80-C84 VanDerWaalsContact O-CB 3.24Å; R80-C84 WeakPolarHBondContact O-CB 3.4Å; R80-C84 PolarHBondContact O-N 3.18Å; R80-V100 HydrophobicContact CB-CG1 3.85Å; R80-V100 HydrophobicContact CG-CG1 4.28Å
81	K	88.8	Confident	88.4	Confident	156 Å²	156	54.7 Å²	54.7	68%	0.678	29%	0.286	S	S	*	.	H	α-helix	trans	-68.7	-43.9	-179.2	-64	-174.2	178.9	-177.4	0	111.2	Q79 C84 Q85	Q79-K81 VanDerWaalsContact C-N 3.29Å; Q79-K81 PolarHBondContact O-N 2.87Å; K81-C84 PolarHBondContact O-N 3.1Å; K81-Q85 WeakPolarHBondContact O-CB 3.17Å; K81-Q85 PolarHBondContact O-N 3.09Å
82	N	89.8	Confident	88	Confident	73 Å²	73	52.2 Å²	52.2	39%	0.39	28%	0.275	S	S	.	.	H	α-helix	trans	-69.2	-40	-176.7	-67.6	-19.5	0	0	0	111.8	F57 Q79 F86	F57-N82 HydrophobicContact CD1-CB 3.74Å; F57-N82 HydrophobicContact CE1-CB 3.52Å; F57-N82 HydrophobicContact CG-CB 4.43Å; F57-N82 HydrophobicContact CZ-CB 3.99Å; F57-N82 WeakPolarHBondContact CZ-O 3.38Å; Q79-N82 PolarHBondContact O-N 2.82Å; Q79-N82 VanDerWaalsContact O-N 3.1Å; Q79-N82 PolarHBondContact OE1-ND2 2.99Å; N82-F86 VanDerWaalsContact O-CB 3.29Å; N82-F86 WeakPolarHBondContact O-CB 3.42Å; N82-F86 PolarHBondContact O-N 3.48Å
83	I	88.9	Confident	87.6	Confident	0 Å²	0	52.7 Å²	52.7	0%	0	28%	0.278	C	S	.	.	H	α-helix	trans	-67.3	-46.4	175.3	-63	163.7	0	0	0	110.1	I23 T35 V37 F53 F57 L75 Q79 Q85 F86 L87	I23-I83 HydrophobicContact CD1-CB 4.01Å; I23-I83 HydrophobicContact CD1-CG2 3.57Å; I23-I83 HydrophobicContact CG1-CG2 4.33Å; I23-I83 HydrophobicContact CG2-CD1 4.44Å; T35-I83 HydrophobicContact CG2-CD1 3.47Å; T35-I83 VanDerWaalsContact CG2-CD1 3.47Å; V37-I83 HydrophobicContact CG2-CD1 3.91Å; V37-I83 HydrophobicContact CG2-CG2 3.87Å; F53-I83 HydrophobicContact CZ-CG2 4.2Å; F57-I83 HydrophobicContact CE2-CG1 3.84Å; F57-I83 HydrophobicContact CZ-CG1 4.37Å; L75-I83 HydrophobicContact CD1-CD1 3.5Å; L75-I83 HydrophobicContact CD1-CG1 3.83Å; Q79-I83 HydrophobicContact CB-CD1 3.81Å; Q79-I83 HydrophobicContact CB-CG1 3.99Å; Q79-I83 VanDerWaalsContact O-CG1 3.27Å; Q79-I83 WeakPolarHBondContact O-CG1 3.41Å; Q79-I83 PolarHBondContact O-N 3.13Å; I83-Q85 VanDerWaalsContact C-N 3.33Å; I83-Q85 PolarHBondContact O-N 3.31Å; I83-F86 PolarHBondContact O-N 2.71Å; I83-L87 HydrophobicContact CG2-CD1 3.7Å; I83-L87 HydrophobicContact CG2-CG 4.09Å; I83-L87 WeakPolarHBondContact O-CB 3.39Å; I83-L87 VanDerWaalsContact O-CG 3.31Å; I83-L87 WeakPolarHBondContact O-CG 3.41Å; I83-L87 PolarHBondContact O-N 3.45Å
84	C	88	Confident	87.2	Confident	31 Å²	31	58.9 Å²	58.9	21%	0.209	31%	0.305	C	S	.	.	H	α-helix	trans	-54.7	-51.1	177.3	-176.6	0	0	0	0	111	I23 R80 K81 F86 L87 L88 L98	I23-C84 HydrophobicContact CD1-CB 4.39Å; R80-C84 VanDerWaalsContact O-CB 3.24Å; R80-C84 WeakPolarHBondContact O-CB 3.4Å; R80-C84 PolarHBondContact O-N 3.18Å; K81-C84 PolarHBondContact O-N 3.1Å; C84-F86 PolarHBondContact O-N 2.78Å; C84-L87 PolarHBondContact O-N 2.87Å; C84-L88 WeakPolarHBondContact O-CG 3.46Å; C84-L88 PolarHBondContact O-N 2.85Å; C84-L98 HydrophobicContact CB-CD1 4.27Å; C84-L98 HydrophobicContact CB-CD2 4.13Å
85	Q	89.4	Confident	86.6	Confident	131 Å²	131	63.6 Å²	63.6	61%	0.612	33%	0.327	S	S	*	.	H	α-helix	trans	-64.1	-40.8	179.3	-169.4	163.8	22	0	0	112.8	K81 I83 L88 E89	K81-Q85 WeakPolarHBondContact O-CB 3.17Å; K81-Q85 PolarHBondContact O-N 3.09Å; I83-Q85 VanDerWaalsContact C-N 3.33Å; I83-Q85 PolarHBondContact O-N 3.31Å; Q85-L88 PolarHBondContact O-N 2.87Å; Q85-E89 VanDerWaalsContact O-CB 3.29Å; Q85-E89 WeakPolarHBondContact O-CB 3.46Å; Q85-E89 PolarHBondContact O-N 3.47Å
86	F	89.6	Confident	86.1	Confident	21 Å²	21	69.7 Å²	69.7	9%	0.092	36%	0.356	C	S	.	.	H	α-helix	trans	-64.4	-43.8	178.2	-179	-93	0	0	0	112.5	A52 F53 K56 F57 N82 I83 C84 L88 E89 V90	A52-F86 HydrophobicContact CB-CE1 4.47Å; A52-F86 HydrophobicContact CB-CE2 4.38Å; A52-F86 HydrophobicContact CB-CZ 3.68Å; F53-F86 AromaticContact CD1-CD1 3.87Å; F53-F86 HydrophobicContact CD1-CD1 3.87Å; F53-F86 AromaticContact CD1-CE1 3.95Å; F53-F86 HydrophobicContact CD1-CE1 3.95Å; F53-F86 HydrophobicContact CD1-CG 4.3Å; F53-F86 HydrophobicContact CE1-CB 4.35Å; F53-F86 AromaticContact CE1-CD1 3.23Å; F53-F86 HydrophobicContact CE1-CD1 3.23Å; F53-F86 AromaticContact CE1-CE1 3.59Å; F53-F86 HydrophobicContact CE1-CE1 3.59Å; F53-F86 AromaticContact CE1-CG 3.91Å; F53-F86 HydrophobicContact CE1-CG 3.91Å; F53-F86 HydrophobicContact CZ-CD1 4.19Å; F53-F86 HydrophobicContact CZ-CE1 4.46Å; K56-F86 HydrophobicContact CD-CD2 3.48Å; K56-F86 VanDerWaalsContact CD-CD2 3.48Å; K56-F86 HydrophobicContact CD-CE2 3.85Å; F57-F86 HydrophobicContact CE1-CB 4.41Å; F57-F86 HydrophobicContact CZ-CB 3.82Å; F57-F86 HydrophobicContact CZ-CG 4.25Å; N82-F86 VanDerWaalsContact O-CB 3.29Å; N82-F86 WeakPolarHBondContact O-CB 3.42Å; N82-F86 PolarHBondContact O-N 3.48Å; I83-F86 PolarHBondContact O-N 2.71Å; C84-F86 PolarHBondContact O-N 2.78Å; F86-L88 VanDerWaalsContact C-N 3.29Å; F86-L88 PolarHBondContact O-N 3.36Å; F86-E89 PolarHBondContact O-N 2.79Å; F86-V90 HydrophobicContact CD1-CG2 3.9Å; F86-V90 HydrophobicContact CD2-CG2 4.13Å; F86-V90 HydrophobicContact CE1-CG2 3.57Å; F86-V90 HydrophobicContact CE2-CG2 3.81Å; F86-V90 HydrophobicContact CG-CG2 4.23Å; F86-V90 HydrophobicContact CZ-CG2 3.53Å; F86-V90 VanDerWaalsContact O-CG2 3.24Å; F86-V90 WeakPolarHBondContact O-CG2 3.39Å; F86-V90 PolarHBondContact O-N 3.47Å
87	L	86.5	Confident	85.8	Confident	0 Å²	0	67.7 Å²	67.7	0%	0	35%	0.346	C	S	.	.	H	α-helix	trans	-64	-37.2	-178.5	-75.8	178.3	0	0	0	111.9	I21 I23 F53 I83 C84 G91 I92 V93 L98	I21-L87 HydrophobicContact CD1-CD1 4.35Å; I21-L87 HydrophobicContact CG2-CD1 4.18Å; I23-L87 HydrophobicContact CD1-CD1 4.42Å; F53-L87 HydrophobicContact CZ-CD2 4.45Å; I83-L87 HydrophobicContact CG2-CD1 3.7Å; I83-L87 HydrophobicContact CG2-CG 4.09Å; I83-L87 WeakPolarHBondContact O-CB 3.39Å; I83-L87 VanDerWaalsContact O-CG 3.31Å; I83-L87 WeakPolarHBondContact O-CG 3.41Å; I83-L87 PolarHBondContact O-N 3.45Å; C84-L87 PolarHBondContact O-N 2.87Å; L87-G91 PolarHBondContact O-N 3.01Å; L87-I92 HydrophobicContact CD2-CD1 4.47Å; L87-I92 PolarHBondContact O-N 3.23Å; L87-V93 HydrophobicContact CB-CG2 3.69Å; L87-V93 HydrophobicContact CD1-CG2 4.43Å; L87-L98 HydrophobicContact CB-CD1 4.13Å; L87-L98 HydrophobicContact CD1-CD1 4.01Å
88	L	86.6	Confident	85.6	Confident	62 Å²	62	67.4 Å²	67.4	33%	0.325	34%	0.339	S	S	.	.	H	α-helix	trans	-67.8	-43.8	171.8	-67	171.6	0	0	0	112.2	C84 Q85 F86 V90 G91 E95	C84-L88 WeakPolarHBondContact O-CG 3.46Å; C84-L88 PolarHBondContact O-N 2.85Å; Q85-L88 PolarHBondContact O-N 2.87Å; F86-L88 VanDerWaalsContact C-N 3.29Å; F86-L88 PolarHBondContact O-N 3.36Å; L88-V90 PolarHBondContact O-N 3.33Å; L88-G91 PolarHBondContact O-N 2.64Å; L88-G91 VanDerWaalsContact O-N 3.1Å; L88-E95 HydrophobicContact CD2-CB 3.87Å
89	E	87.1	Confident	85.6	Confident	130 Å²	130	68.6 Å²	68.6	61%	0.607	34%	0.341	S	S	*	.	H	α-helix	trans	-64.8	-37.6	-178.9	-174	-174.4	148.9	0	0	112.6	K56 Q85 F86 G91	K56-E89 IonicContact NZ-OE1 2.69Å; K56-E89 PolarHBondContact NZ-OE1 3.04Å; K56-E89 IonicContact NZ-OE2 2.98Å; K56-E89 PolarHBondContact NZ-OE2 2.96Å; Q85-E89 VanDerWaalsContact O-CB 3.29Å; Q85-E89 WeakPolarHBondContact O-CB 3.46Å; Q85-E89 PolarHBondContact O-N 3.47Å; F86-E89 PolarHBondContact O-N 2.79Å; E89-G91 PolarHBondContact O-N 2.75Å
90	V	83.3	Confident	85.7	Confident	76 Å²	76	70.6 Å²	70.6	46%	0.461	36%	0.355	S	S	.	.	H	α-helix	trans	-78.4	-13.1	176.7	-172.6	0	0	0	0	111.5	F86 L88 I92	F86-V90 HydrophobicContact CD1-CG2 3.9Å; F86-V90 HydrophobicContact CD2-CG2 4.13Å; F86-V90 HydrophobicContact CE1-CG2 3.57Å; F86-V90 HydrophobicContact CE2-CG2 3.81Å; F86-V90 HydrophobicContact CG-CG2 4.23Å; F86-V90 HydrophobicContact CZ-CG2 3.53Å; F86-V90 VanDerWaalsContact O-CG2 3.24Å; F86-V90 WeakPolarHBondContact O-CG2 3.39Å; F86-V90 PolarHBondContact O-N 3.47Å; L88-V90 PolarHBondContact O-N 3.33Å; V90-I92 VanDerWaalsContact C-N 3.26Å; V90-I92 HydrophobicContact CB-CD1 4.06Å; V90-I92 HydrophobicContact CB-CG1 3.94Å; V90-I92 HydrophobicContact CG1-CD1 3.67Å; V90-I92 HydrophobicContact CG1-CG1 3.63Å; V90-I92 PolarHBondContact O-N 2.79Å
91	G	81	Confident	85.6	Confident	58 Å²	58	70 Å²	70	60%	0.598	36%	0.355	S	S	*	.	T	Hydrogen-bonded Turn	trans	70.2	22.7	-179.3	0	0	0	0	0	113.4	L87 L88 E89 V93	L87-G91 PolarHBondContact O-N 3.01Å; L88-G91 PolarHBondContact O-N 2.64Å; L88-G91 VanDerWaalsContact O-N 3.1Å; E89-G91 PolarHBondContact O-N 2.75Å; G91-V93 VanDerWaalsContact C-N 3.34Å
92	I	77.5	Confident	85.2	Confident	26 Å²	26	64.8 Å²	64.8	13%	0.133	35%	0.346	C	S	.	.	S	Bend	trans	-73.2	-34	178.9	-63	178.7	0	0	0	110.1	Y44 L49 L87 V90	Y44-I92 HydrophobicContact CD1-CG2 4.48Å; Y44-I92 HydrophobicContact CD2-CG2 4.42Å; Y44-I92 HydrophobicContact CE1-CG1 4.41Å; Y44-I92 HydrophobicContact CE1-CG2 4.16Å; Y44-I92 HydrophobicContact CE2-CG2 4.1Å; L49-I92 HydrophobicContact CD1-CD1 3.41Å; L49-I92 VanDerWaalsContact CD1-CD1 3.41Å; L87-I92 HydrophobicContact CD2-CD1 4.47Å; L87-I92 PolarHBondContact O-N 3.23Å; V90-I92 VanDerWaalsContact C-N 3.26Å; V90-I92 HydrophobicContact CB-CD1 4.06Å; V90-I92 HydrophobicContact CB-CG1 3.94Å; V90-I92 HydrophobicContact CG1-CD1 3.67Å; V90-I92 HydrophobicContact CG1-CG1 3.63Å; V90-I92 PolarHBondContact O-N 2.79Å
93	V	80.3	Confident	84.1	Confident	15 Å²	15	69.6 Å²	69.6	9%	0.091	36%	0.364	C	S	.	.	S	Bend	trans	-140	157.5	178.7	-67	0	0	0	0	111.4	I21 L87 G91 L98	I21-V93 HydrophobicContact CD1-CB 4.32Å; I21-V93 HydrophobicContact CD1-CG1 3.15Å; I21-V93 HydrophobicContact CD1-CG2 4.36Å; I21-V93 HydrophobicContact CG1-CG1 3.78Å; L87-V93 HydrophobicContact CB-CG2 3.69Å; L87-V93 HydrophobicContact CD1-CG2 4.43Å; G91-V93 VanDerWaalsContact C-N 3.34Å; V93-L98 HydrophobicContact CG2-CD1 3.98Å
94	K	82.4	Confident	83.9	Confident	130 Å²	130	73.1 Å²	73.1	57%	0.565	38%	0.382	S	S	*	.			trans	-88.2	157.1	168.8	-59.5	176.8	-177.1	174.4	0	110.3	E96 Q97	K94-E96 HydrophobicContact CB-CG 3.72Å; K94-E96 HydrophobicContact CD-CG 4.35Å; K94-E96 WeakPolarHBondContact CD-OE1 3.16Å; K94-E96 IonicContact NZ-OE1 2.63Å; K94-E96 PolarHBondContact O-N 3.23Å; K94-Q97 PolarHBondContact O-N 2.92Å
95	E	79.9	Confident	83.7	Confident	149 Å²	149	75.3 Å²	75.3	70%	0.696	39%	0.391	S	S	*	.	G	3₁₀ helix	trans	-59.3	-33.7	179.5	-169.3	172.9	-180	0	0	112.4	L88 Q97 L98	L88-E95 HydrophobicContact CD2-CB 3.87Å; E95-Q97 VanDerWaalsContact C-N 3.28Å; E95-Q97 PolarHBondContact O-N 2.82Å; E95-L98 PolarHBondContact O-N 2.68Å
96	E	82.4	Confident	83.4	Confident	129 Å²	129	72.2 Å²	72.2	60%	0.603	38%	0.379	S	S	*	.	G	3₁₀ helix	trans	-62.6	-32	176.4	57.2	-171.2	177.3	0	0	113.6	Y20 K94 L98	Y20-E96 VanDerWaalsContact CE1-O 3.29Å; Y20-E96 WeakPolarHBondContact CE1-O 3.21Å; K94-E96 HydrophobicContact CB-CG 3.72Å; K94-E96 HydrophobicContact CD-CG 4.35Å; K94-E96 WeakPolarHBondContact CD-OE1 3.16Å; K94-E96 IonicContact NZ-OE1 2.63Å; K94-E96 PolarHBondContact O-N 3.23Å; E96-L98 VanDerWaalsContact C-N 3.31Å
97	Q	83.6	Confident	83	Confident	44 Å²	44	75.2 Å²	75.2	21%	0.206	40%	0.395	C	S	.	.	G	3₁₀ helix	trans	-82.7	-9.2	-179.3	-71.5	172.1	-53.1	0	0	112.7	D19 Y20 I21 K94 E95	D19-Q97 WeakPolarHBondContact O-CB 3.42Å; Y20-Q97 CarbonylContact C-O 3.52Å; Y20-Q97 VanDerWaalsContact CA-O 3.29Å; Y20-Q97 WeakPolarHBondContact CA-O 3.27Å; Y20-Q97 WeakPolarHBondContact CD1-O 3.45Å; I21-Q97 PolarHBondContact N-O 3.49Å; K94-Q97 PolarHBondContact O-N 2.92Å; E95-Q97 VanDerWaalsContact C-N 3.28Å; E95-Q97 PolarHBondContact O-N 2.82Å
98	L	87.2	Confident	82.8	Confident	17 Å²	17	79.9 Å²	79.9	9%	0.089	42%	0.42	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.7	114.9	-170.4	-155.7	155.4	0	0	0	110.7	I23 C84 L87 V93 E95 E96 V100	I23-L98 HydrophobicContact CD1-CD1 4.33Å; I23-L98 HydrophobicContact CD1-CD2 3.57Å; I23-L98 HydrophobicContact CD1-CG 4.18Å; I23-L98 HydrophobicContact CG1-CD2 4.13Å; C84-L98 HydrophobicContact CB-CD1 4.27Å; C84-L98 HydrophobicContact CB-CD2 4.13Å; L87-L98 HydrophobicContact CB-CD1 4.13Å; L87-L98 HydrophobicContact CD1-CD1 4.01Å; V93-L98 HydrophobicContact CG2-CD1 3.98Å; E95-L98 PolarHBondContact O-N 2.68Å; E96-L98 VanDerWaalsContact C-N 3.31Å; L98-V100 HydrophobicContact CD2-CG2 3.37Å
99	K	89.1	Confident	82.5	Confident	94 Å²	94	81.1 Å²	81.1	41%	0.409	43%	0.426	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.6	107.8	-179.8	-63.8	-66.5	-179.6	-179.8	0	109.8	Y20 I21 H22 I23	Y20-K99 HydrophobicContact CD1-CG 4.04Å; I21-K99 PolarHBondContact O-N 3.1Å; H22-K99 CarbonylContact C-O 3.57Å; H22-K99 WeakPolarHBondContact CA-O 3.31Å; H22-K99 WeakPolarHBondContact ND1-CB 3.48Å; I23-K99 PolarHBondContact N-O 3.32Å
100	V	89.3	Confident	82.2	Confident	65 Å²	65	77.6 Å²	77.6	39%	0.394	41%	0.414	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.8	115.5	177.4	-173.3	0	0	0	0	109.7	I23 R80 L98	I23-V100 HydrophobicContact CD1-CG2 4.43Å; R80-V100 HydrophobicContact CB-CG1 3.85Å; R80-V100 HydrophobicContact CG-CG1 4.28Å; L98-V100 HydrophobicContact CD2-CG2 3.37Å
101	H	86.4	Confident	82.1	Confident	62 Å²	62	77.8 Å²	77.8	29%	0.287	41%	0.41	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.4	116.7	174.1	-59.6	-79.4	0	0	0	109.3	H22 I23 R24 I25	H22-H101 AromaticContact CE1-NE2 3.9Å; H22-H101 AromaticContact CG-NE2 3.83Å; H22-H101 AromaticContact ND1-CD2 3.8Å; H22-H101 AromaticContact ND1-NE2 2.99Å; H22-H101 PolarHBondContact ND1-NE2 3.33Å; I23-H101 PolarHBondContact O-N 3.33Å; R24-H101 HydrophobicContact CB-CB 4.41Å; R24-H101 HydrophobicContact CG-CB 3.98Å; I25-H101 PolarHBondContact N-O 3.22Å
102	G	81.2	Confident	82.2	Confident	48 Å²	48	79.4 Å²	79.4	50%	0.495	39%	0.394	S	S	.	.			trans	-81.9	-170.8	177.1	0	0	0	0	0	113.3
103	F	67.3	Low	82.6	Confident	174 Å²	174	84.3 Å²	84.3	76%	0.763	42%	0.418	S	S	*	.			trans	-72.3	0	164.3	-90.3	-76.8	0	0	0	111.4	I25 Q27 T33	I25-F103 HydrophobicContact CB-CE2 4.38Å; I25-F103 HydrophobicContact CG2-CD2 4.05Å; I25-F103 HydrophobicContact CG2-CE2 3.41Å; I25-F103 VanDerWaalsContact CG2-CE2 3.41Å; I25-F103 HydrophobicContact CG2-CZ 3.93Å; Q27-F103 HydrophobicContact CB-CE1 3.82Å; Q27-F103 HydrophobicContact CB-CZ 3.84Å; Q27-F103 HydrophobicContact CG-CZ 4.38Å; T33-F103 HydrophobicContact CG2-CE2 3.78Å; T33-F103 HydrophobicContact CG2-CZ 3.79Å

Retrieved 103 of 103 residues in 55.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).