F7EHG3_MACMU Loading...

Centrosomal protein 15

AlphaFold DB , UniProt , Accession F7EHG3, Species MACMU (Macaca mulatta, Rhesus macaque), Gene CEP15, Length 126 aa.

						>F7EHG3_MACMU|F7EHG3|CEP15
MTSLFAQEIRLSKRHEEIVSQRLMLLQQMENKLGDQHTEKASQLQTVETAFKRNLSLLKDIEAAEKSLQTRIHPLPRPEVVSLETRYWASVEEYIPKWEQFLLGRAPYPFAVENQNEAENTIQNEA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	55.8	Low	87.5	Confident	241 Å²	241	123.5 Å²	123.5	100%	1.187	63%	0.629	S	S	*	*				0	123.6	0	-73.7	-167	-83.5	0	0	108.1
2	T	67.8	Low	88.3	Confident	118 Å²	118	118.2 Å²	118.2	72%	0.724	61%	0.612	S	S	*	*			trans	-68.3	131.2	173.4	42.8	0	0	0	0	109.2
3	S	87.9	Confident	89	Confident	76 Å²	76	119.6 Å²	119.6	53%	0.531	61%	0.611	S	S	.	*			trans	-56.3	139.6	175.3	169.1	0	0	0	0	110.6	F5 A6 Q7	S3-F5 PolarHBondContact O-N 3.17Å; S3-F5 VanDerWaalsContact O-N 3.11Å; S3-F5 PolarHBondContact OG-N 2.89Å; S3-A6 WeakPolarHBondContact O-CB 3.46Å; S3-A6 PolarHBondContact O-N 3.47Å; S3-Q7 PolarHBondContact O-N 3.39Å
4	L	89.8	Confident	89.6	Confident	145 Å²	145	122.9 Å²	122.9	76%	0.759	61%	0.612	S	S	*	*	H	α-helix	trans	-50.5	-35.7	175.2	-72.2	169.5	0	0	0	111.9	Q7 E8	L4-Q7 WeakPolarHBondContact O-CB 3.21Å; L4-Q7 PolarHBondContact O-N 2.89Å; L4-E8 PolarHBondContact O-N 3.22Å
5	F	91.3	Very high	90.1	Very high	148 Å²	148	121.9 Å²	121.9	65%	0.649	60%	0.604	S	S	*	*	H	α-helix	trans	-63.5	-41.4	177	-177.9	-111.4	0	0	0	113.1	S3 Q7 E8 I9	S3-F5 PolarHBondContact O-N 3.17Å; S3-F5 VanDerWaalsContact O-N 3.11Å; S3-F5 PolarHBondContact OG-N 2.89Å; F5-Q7 VanDerWaalsContact C-N 3.27Å; F5-Q7 PolarHBondContact O-N 3.26Å; F5-E8 PolarHBondContact O-N 3.45Å; F5-I9 HydrophobicContact CD1-CD1 3.77Å; F5-I9 HydrophobicContact CE1-CD1 3.34Å; F5-I9 HydrophobicContact CE1-CG1 4.43Å; F5-I9 HydrophobicContact CE2-CD1 4.2Å; F5-I9 HydrophobicContact CG-CD1 4.37Å; F5-I9 HydrophobicContact CZ-CD1 3.59Å; F5-I9 HydrophobicContact CZ-CG1 4.33Å; F5-I9 WeakPolarHBondContact O-CG1 3.42Å; F5-I9 PolarHBondContact O-N 3.36Å; F5-I9 VanDerWaalsContact O-N 3.1Å
6	A	93.1	Very high	90.6	Very high	50 Å²	50	121.4 Å²	121.4	41%	0.413	60%	0.6	S	S	.	*	H	α-helix	trans	-67.8	-31	177.2	0	0	0	0	0	111.8	S3 R10	S3-A6 WeakPolarHBondContact O-CB 3.46Å; S3-A6 PolarHBondContact O-N 3.47Å; A6-R10 PolarHBondContact O-N 2.89Å
7	Q	94.3	Very high	91.1	Very high	97 Å²	97	119.4 Å²	119.4	45%	0.453	59%	0.589	S	S	.	*	H	α-helix	trans	-69.7	-43.4	174.6	-178.2	172.1	-6.6	0	0	111.8	S3 L4 F5 R10 L11	S3-Q7 PolarHBondContact O-N 3.39Å; L4-Q7 WeakPolarHBondContact O-CB 3.21Å; L4-Q7 PolarHBondContact O-N 2.89Å; F5-Q7 VanDerWaalsContact C-N 3.27Å; F5-Q7 PolarHBondContact O-N 3.26Å; Q7-R10 PolarHBondContact O-N 3.18Å; Q7-L11 PolarHBondContact O-N 3.34Å
8	E	94.4	Very high	91.5	Very high	121 Å²	121	118.5 Å²	118.5	57%	0.565	59%	0.585	S	S	*	*	H	α-helix	trans	-61	-46.8	177.3	-170.2	58.9	-144.8	0	0	111.7	L4 F5 R10 L11 S12	L4-E8 PolarHBondContact O-N 3.22Å; F5-E8 PolarHBondContact O-N 3.45Å; E8-R10 VanDerWaalsContact C-N 3.29Å; E8-R10 PolarHBondContact O-N 3.31Å; E8-L11 PolarHBondContact O-N 3.04Å; E8-L11 VanDerWaalsContact O-N 3.1Å; E8-S12 WeakPolarHBondContact O-CB 3.42Å; E8-S12 PolarHBondContact O-N 2.87Å
9	I	95.4	Very high	91.9	Very high	91 Å²	91	115.6 Å²	115.6	47%	0.467	58%	0.575	S	S	.	*	H	α-helix	trans	-57.1	-44.2	176	-69.1	167.8	0	0	0	111.1	F5 L11 S12 K13	F5-I9 HydrophobicContact CD1-CD1 3.77Å; F5-I9 HydrophobicContact CE1-CD1 3.34Å; F5-I9 HydrophobicContact CE1-CG1 4.43Å; F5-I9 HydrophobicContact CE2-CD1 4.2Å; F5-I9 HydrophobicContact CG-CD1 4.37Å; F5-I9 HydrophobicContact CZ-CD1 3.59Å; F5-I9 HydrophobicContact CZ-CG1 4.33Å; F5-I9 WeakPolarHBondContact O-CG1 3.42Å; F5-I9 PolarHBondContact O-N 3.36Å; F5-I9 VanDerWaalsContact O-N 3.1Å; I9-L11 VanDerWaalsContact C-N 3.32Å; I9-L11 PolarHBondContact O-N 3.26Å; I9-S12 PolarHBondContact O-N 3.41Å; I9-K13 WeakPolarHBondContact O-CB 3.26Å; I9-K13 PolarHBondContact O-N 3.27Å
10	R	96.1	Very high	92.2	Very high	167 Å²	167	113.2 Å²	113.2	63%	0.63	57%	0.569	S	S	*	*	H	α-helix	trans	-65	-38.4	179	-171.1	-177.9	70.4	170.9	1.2	111.7	A6 Q7 E8 R14	A6-R10 PolarHBondContact O-N 2.89Å; Q7-R10 PolarHBondContact O-N 3.18Å; E8-R10 VanDerWaalsContact C-N 3.29Å; E8-R10 PolarHBondContact O-N 3.31Å; R10-R14 PolarHBondContact O-N 3.47Å; R10-R14 VanDerWaalsContact O-N 3.11Å
11	L	96.6	Very high	92.5	Very high	104 Å²	104	114.1 Å²	114.1	55%	0.545	57%	0.572	S	S	.	*	H	α-helix	trans	-69.4	-44.8	179.5	-154.5	77.4	0	0	0	111	Q7 E8 I9 K13 R14 H15	Q7-L11 PolarHBondContact O-N 3.34Å; E8-L11 PolarHBondContact O-N 3.04Å; E8-L11 VanDerWaalsContact O-N 3.1Å; I9-L11 VanDerWaalsContact C-N 3.32Å; I9-L11 PolarHBondContact O-N 3.26Å; L11-K13 VanDerWaalsContact C-N 3.35Å; L11-K13 PolarHBondContact O-N 3.2Å; L11-R14 PolarHBondContact O-N 3.4Å; L11-H15 PolarHBondContact O-N 3.27Å
12	S	96.8	Very high	94.5	Very high	60 Å²	60	111 Å²	111	42%	0.42	55%	0.547	S	S	.	.	H	α-helix	trans	-58.9	-44.7	174.3	175.8	0	0	0	0	111.4	E8 I9 R14 H15 E16	E8-S12 WeakPolarHBondContact O-CB 3.42Å; E8-S12 PolarHBondContact O-N 2.87Å; I9-S12 PolarHBondContact O-N 3.41Å; S12-R14 PolarHBondContact O-N 2.87Å; S12-H15 WeakPolarHBondContact O-CB 3.49Å; S12-H15 PolarHBondContact O-N 2.97Å; S12-E16 PolarHBondContact O-N 3.43Å
13	K	97.3	Very high	95.9	Very high	137 Å²	137	110.9 Å²	110.9	60%	0.596	54%	0.541	S	S	*	.	H	α-helix	trans	-59.1	-45	174.7	-174.1	176.9	177.6	-179.5	0	112.5	I9 L11 H15 E16 E17	I9-K13 WeakPolarHBondContact O-CB 3.26Å; I9-K13 PolarHBondContact O-N 3.27Å; L11-K13 VanDerWaalsContact C-N 3.35Å; L11-K13 PolarHBondContact O-N 3.2Å; K13-H15 VanDerWaalsContact C-N 3.29Å; K13-H15 PolarHBondContact O-N 3.08Å; K13-E16 PolarHBondContact O-N 3.45Å; K13-E17 VanDerWaalsContact CE-OE1 3.3Å; K13-E17 WeakPolarHBondContact CE-OE1 3.43Å; K13-E17 WeakPolarHBondContact O-CG 3.47Å; K13-E17 PolarHBondContact O-N 3.08Å
14	R	97.6	Very high	96.4	Very high	165 Å²	165	112.9 Å²	112.9	62%	0.623	54%	0.544	S	S	*	.	H	α-helix	trans	-62.5	-37	174.4	-89.8	-163.1	178.3	-149.6	0.7	112.4	R10 L11 S12 E17 I18	R10-R14 PolarHBondContact O-N 3.47Å; R10-R14 VanDerWaalsContact O-N 3.11Å; L11-R14 PolarHBondContact O-N 3.4Å; S12-R14 PolarHBondContact O-N 2.87Å; R14-E17 PolarHBondContact O-N 3.38Å; R14-I18 WeakPolarHBondContact O-CD1 3.19Å; R14-I18 VanDerWaalsContact O-CG1 3.25Å; R14-I18 WeakPolarHBondContact O-CG1 3.39Å; R14-I18 PolarHBondContact O-N 3.29Å
15	H	97.9	Very high	96.8	Very high	109 Å²	109	110.7 Å²	110.7	51%	0.505	53%	0.532	S	S	.	.	H	α-helix	trans	-62.9	-48	178	-177.6	70.1	0	0	0	111	L11 S12 K13 E17 I18 V19	L11-H15 PolarHBondContact O-N 3.27Å; S12-H15 WeakPolarHBondContact O-CB 3.49Å; S12-H15 PolarHBondContact O-N 2.97Å; K13-H15 VanDerWaalsContact C-N 3.29Å; K13-H15 PolarHBondContact O-N 3.08Å; H15-E17 VanDerWaalsContact C-N 3.3Å; H15-E17 PolarHBondContact O-N 3.09Å; H15-I18 PolarHBondContact O-N 3.27Å; H15-I18 VanDerWaalsContact O-N 3.1Å; H15-V19 WeakPolarHBondContact O-CG2 3.49Å; H15-V19 PolarHBondContact O-N 2.85Å
16	E	98.1	Very high	97.1	Very high	114 Å²	114	107.9 Å²	107.9	53%	0.533	52%	0.523	S	S	.	.	H	α-helix	trans	-60.6	-39	176	-67.2	-56	145.8	0	0	112.3	S12 K13 V19 S20	S12-E16 PolarHBondContact O-N 3.43Å; K13-E16 PolarHBondContact O-N 3.45Å; E16-V19 PolarHBondContact O-N 3.32Å; E16-S20 WeakPolarHBondContact O-CB 3.37Å; E16-S20 PolarHBondContact O-N 3.06Å; E16-S20 PolarHBondContact O-OG 2.88Å
17	E	98.3	Very high	97.3	Very high	87 Å²	87	110.8 Å²	110.8	41%	0.407	53%	0.528	S	S	.	.	H	α-helix	trans	-61.6	-43	173.1	-73.3	168.6	-173.3	0	0	111.8	K13 R14 H15 S20 Q21	K13-E17 VanDerWaalsContact CE-OE1 3.3Å; K13-E17 WeakPolarHBondContact CE-OE1 3.43Å; K13-E17 WeakPolarHBondContact O-CG 3.47Å; K13-E17 PolarHBondContact O-N 3.08Å; R14-E17 PolarHBondContact O-N 3.38Å; H15-E17 VanDerWaalsContact C-N 3.3Å; H15-E17 PolarHBondContact O-N 3.09Å; E17-S20 WeakPolarHBondContact CA-OG 3.37Å; E17-S20 PolarHBondContact O-OG 2.89Å; E17-Q21 WeakPolarHBondContact O-CB 3.48Å; E17-Q21 VanDerWaalsContact O-CG 3.24Å; E17-Q21 WeakPolarHBondContact O-CG 3.18Å; E17-Q21 PolarHBondContact O-N 3.42Å
18	I	98.3	Very high	97.4	Very high	103 Å²	103	111.2 Å²	111.2	53%	0.528	53%	0.53	S	S	.	.	H	α-helix	trans	-66.5	-43.3	177.3	-69.2	163.7	0	0	0	111	R14 H15 Q21 R22	R14-I18 WeakPolarHBondContact O-CD1 3.19Å; R14-I18 VanDerWaalsContact O-CG1 3.25Å; R14-I18 WeakPolarHBondContact O-CG1 3.39Å; R14-I18 PolarHBondContact O-N 3.29Å; H15-I18 PolarHBondContact O-N 3.27Å; H15-I18 VanDerWaalsContact O-N 3.1Å; I18-Q21 PolarHBondContact O-N 2.74Å; I18-R22 WeakPolarHBondContact O-CB 3.17Å; I18-R22 PolarHBondContact O-N 2.92Å
19	V	98.4	Very high	97.5	Very high	64 Å²	64	111.1 Å²	111.1	39%	0.388	53%	0.531	S	S	.	.	H	α-helix	trans	-64.9	-44.7	-179.6	171.8	0	0	0	0	110.6	H15 E16 R22 L23	H15-V19 WeakPolarHBondContact O-CG2 3.49Å; H15-V19 PolarHBondContact O-N 2.85Å; E16-V19 PolarHBondContact O-N 3.32Å; V19-R22 PolarHBondContact O-N 3.42Å; V19-L23 WeakPolarHBondContact O-CB 3.36Å; V19-L23 PolarHBondContact O-N 3.01Å
20	S	98.2	Very high	97.4	Very high	66 Å²	66	113.5 Å²	113.5	46%	0.462	54%	0.541	S	S	.	.	H	α-helix	trans	-63.5	-42.4	177.4	56	0	0	0	0	112.6	E16 E17 L23 M24	E16-S20 WeakPolarHBondContact O-CB 3.37Å; E16-S20 PolarHBondContact O-N 3.06Å; E16-S20 PolarHBondContact O-OG 2.88Å; E17-S20 WeakPolarHBondContact CA-OG 3.37Å; E17-S20 PolarHBondContact O-OG 2.89Å; S20-L23 PolarHBondContact O-N 2.94Å; S20-M24 PolarHBondContact O-N 3.48Å
21	Q	98.3	Very high	97.3	Very high	134 Å²	134	109.7 Å²	109.7	63%	0.626	53%	0.532	S	S	*	.	H	α-helix	trans	-62.1	-43.6	174.4	-74	174.6	11.9	0	0	112.2	E17 I18 L23 M24 L25	E17-Q21 WeakPolarHBondContact O-CB 3.48Å; E17-Q21 VanDerWaalsContact O-CG 3.24Å; E17-Q21 WeakPolarHBondContact O-CG 3.18Å; E17-Q21 PolarHBondContact O-N 3.42Å; I18-Q21 PolarHBondContact O-N 2.74Å; Q21-L23 VanDerWaalsContact C-N 3.35Å; Q21-L23 PolarHBondContact O-N 3.18Å; Q21-M24 PolarHBondContact O-N 3.45Å; Q21-L25 PolarHBondContact O-N 3.43Å
22	R	98.3	Very high	97.2	Very high	176 Å²	176	111.1 Å²	111.1	66%	0.664	53%	0.534	S	S	*	.	H	α-helix	trans	-62.9	-42.9	177.5	-175.4	179.6	-179.8	-132	-0.4	111.4	I18 V19 L25 L26	I18-R22 WeakPolarHBondContact O-CB 3.17Å; I18-R22 PolarHBondContact O-N 2.92Å; V19-R22 PolarHBondContact O-N 3.42Å; R22-L25 PolarHBondContact O-N 3.27Å; R22-L26 HydrophobicContact CG-CD1 4.1Å; R22-L26 HydrophobicContact CG-CG 4.49Å; R22-L26 WeakPolarHBondContact O-CG 3.41Å; R22-L26 PolarHBondContact O-N 3.47Å
23	L	98.2	Very high	96.9	Very high	115 Å²	115	114 Å²	114	60%	0.602	54%	0.544	S	S	*	.	H	α-helix	trans	-60.5	-47.3	177.5	-177.6	65.5	0	0	0	111.1	V19 S20 Q21 L25 L26 Q27	V19-L23 WeakPolarHBondContact O-CB 3.36Å; V19-L23 PolarHBondContact O-N 3.01Å; S20-L23 PolarHBondContact O-N 2.94Å; Q21-L23 VanDerWaalsContact C-N 3.35Å; Q21-L23 PolarHBondContact O-N 3.18Å; L23-L25 VanDerWaalsContact C-N 3.35Å; L23-L25 PolarHBondContact O-N 2.96Å; L23-L26 PolarHBondContact O-N 3.33Å; L23-Q27 PolarHBondContact O-N 3.49Å
24	M	97.9	Very high	96.4	Very high	118 Å²	118	109.2 Å²	109.2	58%	0.581	53%	0.534	S	S	*	.	H	α-helix	trans	-59.5	-44.8	177.4	-176.6	-177.4	174.1	0	0	111.9	S20 Q21 Q27 Q28	S20-M24 PolarHBondContact O-N 3.48Å; Q21-M24 PolarHBondContact O-N 3.45Å; M24-Q27 PolarHBondContact O-N 3.46Å; M24-Q28 WeakPolarHBondContact O-CG 3.31Å; M24-Q28 PolarHBondContact O-N 3.41Å
25	L	97.9	Very high	96	Very high	98 Å²	98	106.5 Å²	106.5	51%	0.513	53%	0.532	S	S	.	.	H	α-helix	trans	-64.3	-43	179.2	-177.7	64	0	0	0	111.9	Q21 R22 L23 Q27 Q28 M29	Q21-L25 PolarHBondContact O-N 3.43Å; R22-L25 PolarHBondContact O-N 3.27Å; L23-L25 VanDerWaalsContact C-N 3.35Å; L23-L25 PolarHBondContact O-N 2.96Å; L25-Q27 VanDerWaalsContact C-N 3.34Å; L25-Q27 PolarHBondContact O-N 3Å; L25-Q28 PolarHBondContact O-N 2.81Å; L25-M29 HydrophobicContact CG-SD 4.31Å; L25-M29 VanDerWaalsContact O-CG 3.32Å; L25-M29 WeakPolarHBondContact O-CG 3.49Å; L25-M29 PolarHBondContact O-N 2.86Å
26	L	97.4	Very high	95.4	Very high	89 Å²	89	105.1 Å²	105.1	47%	0.466	53%	0.526	S	S	.	.	H	α-helix	trans	-60.9	-44.2	177.3	-74.8	170.7	0	0	0	111.4	R22 L23 Q28 M29 E30	R22-L26 HydrophobicContact CG-CD1 4.1Å; R22-L26 HydrophobicContact CG-CG 4.49Å; R22-L26 WeakPolarHBondContact O-CG 3.41Å; R22-L26 PolarHBondContact O-N 3.47Å; L23-L26 PolarHBondContact O-N 3.33Å; L26-Q28 PolarHBondContact O-N 3.29Å; L26-M29 PolarHBondContact O-N 2.94Å; L26-E30 PolarHBondContact O-N 2.83Å
27	Q	97.1	Very high	94.9	Very high	112 Å²	112	106.2 Å²	106.2	52%	0.523	53%	0.53	S	S	.	.	H	α-helix	trans	-64	-39.9	177.1	-171.9	171.8	2.4	0	0	112.1	L23 M24 L25 M29 E30 N31	L23-Q27 PolarHBondContact O-N 3.49Å; M24-Q27 PolarHBondContact O-N 3.46Å; L25-Q27 VanDerWaalsContact C-N 3.34Å; L25-Q27 PolarHBondContact O-N 3Å; Q27-M29 VanDerWaalsContact C-N 3.34Å; Q27-M29 PolarHBondContact O-N 2.98Å; Q27-E30 PolarHBondContact O-N 3.15Å; Q27-N31 WeakPolarHBondContact O-CB 3.41Å; Q27-N31 PolarHBondContact O-N 3.42Å; Q27-N31 PolarHBondContact O-ND2 2.92Å
28	Q	96.5	Very high	94.3	Very high	105 Å²	105	106.3 Å²	106.3	49%	0.491	54%	0.537	S	S	.	.	H	α-helix	trans	-62.8	-40.9	174.2	-74.6	-179.4	-15.6	0	0	112.5	M24 L25 L26 K32	M24-Q28 WeakPolarHBondContact O-CG 3.31Å; M24-Q28 PolarHBondContact O-N 3.41Å; L25-Q28 PolarHBondContact O-N 2.81Å; L26-Q28 PolarHBondContact O-N 3.29Å; Q28-K32 WeakPolarHBondContact O-CB 3.39Å; Q28-K32 PolarHBondContact O-N 3.47Å
29	M	96.1	Very high	93.8	Very high	119 Å²	119	106.4 Å²	106.4	59%	0.586	54%	0.536	S	S	*	.	H	α-helix	trans	-65.2	-42.1	177.3	-72	178.8	67.6	0	0	111.8	L25 L26 Q27 K32 L33	L25-M29 HydrophobicContact CG-SD 4.31Å; L25-M29 VanDerWaalsContact O-CG 3.32Å; L25-M29 WeakPolarHBondContact O-CG 3.49Å; L25-M29 PolarHBondContact O-N 2.86Å; L26-M29 PolarHBondContact O-N 2.94Å; Q27-M29 VanDerWaalsContact C-N 3.34Å; Q27-M29 PolarHBondContact O-N 2.98Å; M29-K32 PolarHBondContact O-N 3.33Å; M29-L33 WeakPolarHBondContact O-CB 3.48Å; M29-L33 PolarHBondContact O-N 2.79Å
30	E	95	Very high	93.3	Very high	142 Å²	142	109.3 Å²	109.3	66%	0.664	54%	0.543	S	S	*	.	H	α-helix	trans	-62.5	-48.9	177	-176.5	170.4	-153.4	0	0	111.6	L26 Q27 K32 L33 G34	L26-E30 PolarHBondContact O-N 2.83Å; Q27-E30 PolarHBondContact O-N 3.15Å; E30-K32 PolarHBondContact O-N 3.01Å; E30-L33 PolarHBondContact O-N 2.95Å; E30-G34 PolarHBondContact O-N 3.38Å
31	N	93.1	Very high	92.9	Very high	86 Å²	86	108.5 Å²	108.5	46%	0.46	54%	0.54	S	S	.	.	H	α-helix	trans	-58.7	-47.2	177.4	-68.4	-15.3	0	0	0	111.5	Q27 L33 G34 D35	Q27-N31 WeakPolarHBondContact O-CB 3.41Å; Q27-N31 PolarHBondContact O-N 3.42Å; Q27-N31 PolarHBondContact O-ND2 2.92Å; N31-L33 VanDerWaalsContact C-N 3.29Å; N31-L33 PolarHBondContact O-N 2.74Å; N31-G34 PolarHBondContact O-N 2.92Å; N31-G34 VanDerWaalsContact O-N 3.14Å; N31-D35 VanDerWaalsContact O-CG 3.3Å; N31-D35 PolarHBondContact O-N 3.35Å
32	K	94.1	Very high	92.5	Very high	134 Å²	134	104.9 Å²	104.9	58%	0.583	53%	0.53	S	S	*	.	H	α-helix	trans	-60.9	-38.3	179.1	-175.5	177.9	180	-179.1	0	112.3	Q28 M29 E30 Q36	Q28-K32 WeakPolarHBondContact O-CB 3.39Å; Q28-K32 PolarHBondContact O-N 3.47Å; M29-K32 PolarHBondContact O-N 3.33Å; E30-K32 PolarHBondContact O-N 3.01Å; K32-Q36 WeakPolarHBondContact O-CB 3.39Å; K32-Q36 VanDerWaalsContact O-CG 3.26Å; K32-Q36 WeakPolarHBondContact O-CG 3.42Å; K32-Q36 PolarHBondContact O-N 3.07Å; K32-Q36 VanDerWaalsContact O-N 3.08Å
33	L	90.4	Very high	92.3	Very high	121 Å²	121	101 Å²	101	63%	0.634	52%	0.519	S	S	*	.	H	α-helix	trans	-66.7	-42.6	176.6	-173.2	71.4	0	0	0	111.1	M29 E30 N31 Q36 H37	M29-L33 WeakPolarHBondContact O-CB 3.48Å; M29-L33 PolarHBondContact O-N 2.79Å; E30-L33 PolarHBondContact O-N 2.95Å; N31-L33 VanDerWaalsContact C-N 3.29Å; N31-L33 PolarHBondContact O-N 2.74Å; L33-Q36 PolarHBondContact O-N 3.36Å; L33-H37 WeakPolarHBondContact O-CB 3.42Å; L33-H37 PolarHBondContact O-N 3.06Å
34	G	87.1	Confident	92.1	Very high	37 Å²	37	101.4 Å²	101.4	38%	0.381	52%	0.521	S	S	.	.	H	α-helix	trans	-60.5	-47.4	175.7	0	0	0	0	0	112.7	E30 N31 Q36 H37 T38	E30-G34 PolarHBondContact O-N 3.38Å; N31-G34 PolarHBondContact O-N 2.92Å; N31-G34 VanDerWaalsContact O-N 3.14Å; G34-Q36 PolarHBondContact O-N 3.32Å; G34-H37 PolarHBondContact O-N 2.89Å; G34-T38 WeakPolarHBondContact O-CG2 3.46Å; G34-T38 PolarHBondContact O-N 2.83Å; G34-T38 PolarHBondContact O-OG1 3.35Å
35	D	88.4	Confident	92	Very high	108 Å²	108	102 Å²	102	58%	0.578	52%	0.523	S	S	*	.	H	α-helix	trans	-60.8	-46.4	177.8	-66.8	-20.7	0	0	0	111.1	N31 H37 T38 E39	N31-D35 VanDerWaalsContact O-CG 3.3Å; N31-D35 PolarHBondContact O-N 3.35Å; D35-H37 VanDerWaalsContact C-N 3.31Å; D35-H37 PolarHBondContact O-N 3.49Å; D35-T38 PolarHBondContact O-N 3.05Å; D35-T38 PolarHBondContact O-OG1 3.28Å; D35-E39 WeakPolarHBondContact O-CB 3.29Å; D35-E39 PolarHBondContact O-N 3.42Å
36	Q	87	Confident	91.8	Very high	79 Å²	79	101.9 Å²	101.9	37%	0.369	53%	0.526	S	S	.	.	H	α-helix	trans	-63.1	-35.9	177.2	-75	-177.2	4	0	0	113	K32 L33 G34 K40	K32-Q36 WeakPolarHBondContact O-CB 3.39Å; K32-Q36 VanDerWaalsContact O-CG 3.26Å; K32-Q36 WeakPolarHBondContact O-CG 3.42Å; K32-Q36 PolarHBondContact O-N 3.07Å; K32-Q36 VanDerWaalsContact O-N 3.08Å; L33-Q36 PolarHBondContact O-N 3.36Å; G34-Q36 PolarHBondContact O-N 3.32Å; Q36-K40 WeakPolarHBondContact O-CB 3.38Å; Q36-K40 WeakPolarHBondContact O-CG 3.35Å; Q36-K40 PolarHBondContact O-N 3.14Å
37	H	87	Confident	91.7	Very high	137 Å²	137	102.3 Å²	102.3	63%	0.634	53%	0.532	S	S	*	.	H	α-helix	trans	-68.7	-45.2	178.8	-178.3	-85.7	0	0	0	111.4	L33 G34 D35 K40 A41	L33-H37 WeakPolarHBondContact O-CB 3.42Å; L33-H37 PolarHBondContact O-N 3.06Å; G34-H37 PolarHBondContact O-N 2.89Å; D35-H37 VanDerWaalsContact C-N 3.31Å; D35-H37 PolarHBondContact O-N 3.49Å; H37-K40 PolarHBondContact O-N 3.49Å; H37-A41 WeakPolarHBondContact O-CB 3.4Å; H37-A41 PolarHBondContact O-N 3.48Å
38	T	85.4	Confident	91.7	Very high	89 Å²	89	102 Å²	102	55%	0.546	53%	0.53	S	S	.	.	H	α-helix	trans	-66.4	-41.5	178.5	56.8	0	0	0	0	111.9	G34 D35 A41 S42	G34-T38 WeakPolarHBondContact O-CG2 3.46Å; G34-T38 PolarHBondContact O-N 2.83Å; G34-T38 PolarHBondContact O-OG1 3.35Å; D35-T38 PolarHBondContact O-N 3.05Å; D35-T38 PolarHBondContact O-OG1 3.28Å; T38-A41 PolarHBondContact O-N 3.32Å; T38-S42 PolarHBondContact O-N 2.93Å
39	E	87.7	Confident	91.8	Very high	106 Å²	106	101 Å²	101	50%	0.495	53%	0.532	S	S	.	.	H	α-helix	trans	-60.4	-50.1	175	-168.5	-171.1	169.1	0	0	111.2	D35 A41 S42 Q43	D35-E39 WeakPolarHBondContact O-CB 3.29Å; D35-E39 PolarHBondContact O-N 3.42Å; E39-A41 VanDerWaalsContact C-N 3.32Å; E39-A41 PolarHBondContact O-N 2.84Å; E39-S42 PolarHBondContact O-N 3.27Å; E39-S42 PolarHBondContact O-OG 2.84Å; E39-Q43 WeakPolarHBondContact O-CG 3.29Å; E39-Q43 PolarHBondContact O-N 2.96Å; E39-Q43 PolarHBondContact OE1-NE2 3.14Å
40	K	88.9	Confident	91.9	Very high	125 Å²	125	97.4 Å²	97.4	54%	0.543	52%	0.521	S	S	.	.	H	α-helix	trans	-60.3	-40.1	177.8	-76.6	175.4	-179.1	177.7	0	112.7	Q36 H37 Q43 L44	Q36-K40 WeakPolarHBondContact O-CB 3.38Å; Q36-K40 WeakPolarHBondContact O-CG 3.35Å; Q36-K40 PolarHBondContact O-N 3.14Å; H37-K40 PolarHBondContact O-N 3.49Å; K40-Q43 PolarHBondContact O-N 3.24Å; K40-L44 WeakPolarHBondContact O-CB 3.33Å; K40-L44 WeakPolarHBondContact O-CG 3.4Å; K40-L44 PolarHBondContact O-N 3.03Å
41	A	88.9	Confident	92	Very high	48 Å²	48	97 Å²	97	40%	0.397	52%	0.517	S	S	.	.	H	α-helix	trans	-62.7	-44.3	176.4	0	0	0	0	0	111.5	H37 T38 E39 Q43 L44 Q45	H37-A41 WeakPolarHBondContact O-CB 3.4Å; H37-A41 PolarHBondContact O-N 3.48Å; T38-A41 PolarHBondContact O-N 3.32Å; E39-A41 VanDerWaalsContact C-N 3.32Å; E39-A41 PolarHBondContact O-N 2.84Å; A41-Q43 PolarHBondContact O-N 3.42Å; A41-L44 PolarHBondContact O-N 3.45Å; A41-Q45 PolarHBondContact O-N 2.93Å
42	S	90.2	Very high	92.2	Very high	59 Å²	59	98.9 Å²	98.9	41%	0.413	52%	0.521	S	S	.	.	H	α-helix	trans	-64.5	-38.7	177	74.8	0	0	0	0	112.9	T38 E39 Q45 T46	T38-S42 PolarHBondContact O-N 2.93Å; E39-S42 PolarHBondContact O-N 3.27Å; E39-S42 PolarHBondContact O-OG 2.84Å; S42-Q45 PolarHBondContact O-N 3.38Å; S42-T46 PolarHBondContact O-N 3.47Å; S42-T46 PolarHBondContact O-OG1 2.86Å
43	Q	93.1	Very high	92.4	Very high	95 Å²	95	100.8 Å²	100.8	44%	0.444	53%	0.525	S	S	.	.	H	α-helix	trans	-65.3	-46.2	175.6	-72.5	175.3	8.5	0	0	111.2	E39 K40 A41 Q45 T46 V47	E39-Q43 WeakPolarHBondContact O-CG 3.29Å; E39-Q43 PolarHBondContact O-N 2.96Å; E39-Q43 PolarHBondContact OE1-NE2 3.14Å; K40-Q43 PolarHBondContact O-N 3.24Å; A41-Q43 PolarHBondContact O-N 3.42Å; Q43-Q45 VanDerWaalsContact C-N 3.32Å; Q43-Q45 PolarHBondContact O-N 3.41Å; Q43-T46 WeakPolarHBondContact O-CB 3.39Å; Q43-T46 PolarHBondContact O-N 2.94Å; Q43-T46 VanDerWaalsContact O-N 3.15Å; Q43-V47 WeakPolarHBondContact O-CG2 3.48Å; Q43-V47 PolarHBondContact O-N 3.27Å
44	L	94.4	Very high	92.8	Very high	123 Å²	123	99.2 Å²	99.2	64%	0.644	52%	0.517	S	S	*	.	H	α-helix	trans	-58.5	-44	176.5	-78.6	171.9	0	0	0	111.8	K40 A41 T46 V47 E48	K40-L44 WeakPolarHBondContact O-CB 3.33Å; K40-L44 WeakPolarHBondContact O-CG 3.4Å; K40-L44 PolarHBondContact O-N 3.03Å; A41-L44 PolarHBondContact O-N 3.45Å; L44-T46 VanDerWaalsContact C-N 3.31Å; L44-T46 PolarHBondContact O-N 3.04Å; L44-V47 PolarHBondContact O-N 3.38Å; L44-E48 WeakPolarHBondContact O-CB 3.44Å; L44-E48 PolarHBondContact O-N 3.33Å
45	Q	95.1	Very high	93.3	Very high	131 Å²	131	101.2 Å²	101.2	61%	0.612	52%	0.518	S	S	*	.	H	α-helix	trans	-62.1	-40	176.6	-174.2	179.7	11.7	0	0	112.1	A41 S42 Q43 E48 T49	A41-Q45 PolarHBondContact O-N 2.93Å; S42-Q45 PolarHBondContact O-N 3.38Å; Q43-Q45 VanDerWaalsContact C-N 3.32Å; Q43-Q45 PolarHBondContact O-N 3.41Å; Q45-E48 PolarHBondContact O-N 3.27Å; Q45-T49 WeakPolarHBondContact O-CB 2.95Å; Q45-T49 PolarHBondContact O-N 3.42Å; Q45-T49 PolarHBondContact O-OG1 2.99Å
46	T	94.6	Very high	93.8	Very high	95 Å²	95	99 Å²	99	58%	0.583	51%	0.512	S	S	*	.	H	α-helix	trans	-65.5	-44.4	177.3	-57.5	0	0	0	0	110.9	S42 Q43 L44 T49 A50	S42-T46 PolarHBondContact O-N 3.47Å; S42-T46 PolarHBondContact O-OG1 2.86Å; Q43-T46 WeakPolarHBondContact O-CB 3.39Å; Q43-T46 PolarHBondContact O-N 2.94Å; Q43-T46 VanDerWaalsContact O-N 3.15Å; L44-T46 VanDerWaalsContact C-N 3.31Å; L44-T46 PolarHBondContact O-N 3.04Å; T46-T49 PolarHBondContact O-N 3.4Å; T46-A50 WeakPolarHBondContact O-CB 3.42Å; T46-A50 PolarHBondContact O-N 3.44Å
47	V	96.2	Very high	94.3	Very high	98 Å²	98	98.8 Å²	98.8	59%	0.594	51%	0.513	S	S	*	.	H	α-helix	trans	-62.5	-45.5	176.5	170.9	0	0	0	0	111.1	Q43 L44 T49 A50 F51	Q43-V47 WeakPolarHBondContact O-CG2 3.48Å; Q43-V47 PolarHBondContact O-N 3.27Å; L44-V47 PolarHBondContact O-N 3.38Å; V47-T49 VanDerWaalsContact C-N 3.33Å; V47-T49 PolarHBondContact O-N 2.95Å; V47-A50 PolarHBondContact O-N 3.41Å; V47-F51 VanDerWaalsContact O-CB 3.32Å; V47-F51 WeakPolarHBondContact O-CB 3.27Å; V47-F51 PolarHBondContact O-N 3.48Å
48	E	97.1	Very high	94.9	Very high	104 Å²	104	97.8 Å²	97.8	49%	0.486	51%	0.511	S	S	.	.	H	α-helix	trans	-63.6	-41.3	178.8	-168	-172.9	164.4	0	0	111.6	L44 Q45 F51 K52	L44-E48 WeakPolarHBondContact O-CB 3.44Å; L44-E48 PolarHBondContact O-N 3.33Å; Q45-E48 PolarHBondContact O-N 3.27Å; E48-F51 PolarHBondContact O-N 3.1Å; E48-K52 WeakPolarHBondContact O-CG 3.44Å; E48-K52 PolarHBondContact O-N 3.17Å; E48-K52 WeakPolarHBondContact OE1-CE 3.44Å; E48-K52 IonicContact OE1-NZ 2.68Å; E48-K52 PolarHBondContact OE1-NZ 2.9Å
49	T	97.4	Very high	95.5	Very high	85 Å²	85	99.6 Å²	99.6	52%	0.521	51%	0.512	S	S	.	.	H	α-helix	trans	-64.9	-44.8	177.1	-58	0	0	0	0	111.2	Q45 T46 V47 F51 K52 R53	Q45-T49 WeakPolarHBondContact O-CB 2.95Å; Q45-T49 PolarHBondContact O-N 3.42Å; Q45-T49 PolarHBondContact O-OG1 2.99Å; T46-T49 PolarHBondContact O-N 3.4Å; V47-T49 VanDerWaalsContact C-N 3.33Å; V47-T49 PolarHBondContact O-N 2.95Å; T49-F51 VanDerWaalsContact C-N 3.33Å; T49-F51 PolarHBondContact O-N 2.66Å; T49-K52 PolarHBondContact O-N 3Å; T49-R53 WeakPolarHBondContact O-CB 3.37Å; T49-R53 PolarHBondContact O-N 3.08Å
50	A	97.8	Very high	96	Very high	43 Å²	43	99.1 Å²	99.1	36%	0.355	51%	0.512	S	S	.	.	H	α-helix	trans	-61.8	-41.6	174.8	0	0	0	0	0	111.5	T46 V47 R53 N54	T46-A50 WeakPolarHBondContact O-CB 3.42Å; T46-A50 PolarHBondContact O-N 3.44Å; V47-A50 PolarHBondContact O-N 3.41Å; A50-R53 PolarHBondContact O-N 3.35Å; A50-N54 WeakPolarHBondContact O-CB 3.41Å; A50-N54 PolarHBondContact O-N 2.82Å; A50-N54 PolarHBondContact O-ND2 2.89Å; A50-N54 PolarHBondContact O-OD1 2.87Å
51	F	98	Very high	96.4	Very high	134 Å²	134	98.3 Å²	98.3	59%	0.588	51%	0.513	S	S	*	.	H	α-helix	trans	-60.5	-48.8	176.1	178.7	-95.8	0	0	0	111.9	V47 E48 T49 R53 N54 L55	V47-F51 VanDerWaalsContact O-CB 3.32Å; V47-F51 WeakPolarHBondContact O-CB 3.27Å; V47-F51 PolarHBondContact O-N 3.48Å; E48-F51 PolarHBondContact O-N 3.1Å; T49-F51 VanDerWaalsContact C-N 3.33Å; T49-F51 PolarHBondContact O-N 2.66Å; F51-R53 VanDerWaalsContact C-N 3.35Å; F51-R53 PolarHBondContact O-N 2.97Å; F51-N54 PolarHBondContact O-N 3.49Å; F51-L55 WeakPolarHBondContact O-CB 3.39Å; F51-L55 PolarHBondContact O-N 3.5Å
52	K	98	Very high	96.9	Very high	126 Å²	126	100.4 Å²	100.4	55%	0.548	52%	0.515	S	S	.	.	H	α-helix	trans	-60.1	-43.9	177.1	-73.7	175	-175.4	166.9	0	111.9	E48 T49 L55 S56	E48-K52 WeakPolarHBondContact O-CG 3.44Å; E48-K52 PolarHBondContact O-N 3.17Å; E48-K52 WeakPolarHBondContact OE1-CE 3.44Å; E48-K52 IonicContact OE1-NZ 2.68Å; E48-K52 PolarHBondContact OE1-NZ 2.9Å; T49-K52 PolarHBondContact O-N 3Å; K52-L55 PolarHBondContact O-N 3.46Å; K52-S56 PolarHBondContact O-N 2.94Å; K52-S56 VanDerWaalsContact O-N 3.08Å
53	R	98.1	Very high	97.2	Very high	173 Å²	173	100.4 Å²	100.4	65%	0.653	52%	0.518	S	S	*	.	H	α-helix	trans	-60.3	-49.5	175.2	174.9	-178.6	165.7	142.9	0.5	111.4	T49 A50 F51 L55 S56 L57	T49-R53 WeakPolarHBondContact O-CB 3.37Å; T49-R53 PolarHBondContact O-N 3.08Å; A50-R53 PolarHBondContact O-N 3.35Å; F51-R53 VanDerWaalsContact C-N 3.35Å; F51-R53 PolarHBondContact O-N 2.97Å; R53-L55 VanDerWaalsContact C-N 3.3Å; R53-L55 PolarHBondContact O-N 3.39Å; R53-S56 WeakPolarHBondContact O-CB 3.44Å; R53-S56 PolarHBondContact O-N 3.3Å; R53-L57 HydrophobicContact CG-CD1 4.02Å; R53-L57 HydrophobicContact CG-CG 4.46Å; R53-L57 WeakPolarHBondContact O-CG 3.41Å; R53-L57 PolarHBondContact O-N 2.88Å
54	N	98.3	Very high	97.3	Very high	88 Å²	88	98.4 Å²	98.4	47%	0.471	52%	0.518	S	S	.	.	H	α-helix	trans	-62.2	-39.7	-179	-71	-12.3	0	0	0	111.5	A50 F51 S56 L57 L58	A50-N54 WeakPolarHBondContact O-CB 3.41Å; A50-N54 PolarHBondContact O-N 2.82Å; A50-N54 PolarHBondContact O-ND2 2.89Å; A50-N54 PolarHBondContact O-OD1 2.87Å; F51-N54 PolarHBondContact O-N 3.49Å; N54-S56 VanDerWaalsContact C-N 3.34Å; N54-S56 PolarHBondContact O-N 3.34Å; N54-L57 PolarHBondContact O-N 3.35Å; N54-L58 WeakPolarHBondContact O-CG 3.47Å; N54-L58 PolarHBondContact O-N 2.76Å
55	L	98.4	Very high	97.4	Very high	79 Å²	79	97.5 Å²	97.5	41%	0.414	51%	0.51	S	S	.	.	H	α-helix	trans	-62.4	-40.7	175.2	-176.4	64.4	0	0	0	112.2	F51 K52 R53 K59	F51-L55 WeakPolarHBondContact O-CB 3.39Å; F51-L55 PolarHBondContact O-N 3.5Å; K52-L55 PolarHBondContact O-N 3.46Å; R53-L55 VanDerWaalsContact C-N 3.3Å; R53-L55 PolarHBondContact O-N 3.39Å; L55-K59 WeakPolarHBondContact O-CG 3.24Å; L55-K59 PolarHBondContact O-N 3.39Å
56	S	98.2	Very high	97.2	Very high	62 Å²	62	96.7 Å²	96.7	43%	0.434	51%	0.505	S	S	.	.	H	α-helix	trans	-64	-48	174.9	-165.4	0	0	0	0	111.4	K52 R53 N54 L58 K59 D60	K52-S56 PolarHBondContact O-N 2.94Å; K52-S56 VanDerWaalsContact O-N 3.08Å; R53-S56 WeakPolarHBondContact O-CB 3.44Å; R53-S56 PolarHBondContact O-N 3.3Å; N54-S56 VanDerWaalsContact C-N 3.34Å; N54-S56 PolarHBondContact O-N 3.34Å; S56-L58 VanDerWaalsContact C-N 3.29Å; S56-L58 PolarHBondContact O-N 2.96Å; S56-K59 WeakPolarHBondContact O-CB 3.48Å; S56-K59 PolarHBondContact O-N 2.99Å; S56-K59 VanDerWaalsContact O-N 3.1Å; S56-D60 VanDerWaalsContact O-CG 3.32Å; S56-D60 PolarHBondContact O-N 3.4Å
57	L	98.5	Very high	97.1	Very high	75 Å²	75	95 Å²	95	39%	0.393	50%	0.496	S	S	.	.	H	α-helix	trans	-59.5	-40.1	179.4	-70.8	172.4	0	0	0	112.2	R53 N54 K59 D60 I61	R53-L57 HydrophobicContact CG-CD1 4.02Å; R53-L57 HydrophobicContact CG-CG 4.46Å; R53-L57 WeakPolarHBondContact O-CG 3.41Å; R53-L57 PolarHBondContact O-N 2.88Å; N54-L57 PolarHBondContact O-N 3.35Å; L57-K59 VanDerWaalsContact C-N 3.34Å; L57-K59 PolarHBondContact O-N 3.44Å; L57-D60 PolarHBondContact O-N 2.86Å; L57-I61 WeakPolarHBondContact O-CB 3.41Å; L57-I61 VanDerWaalsContact O-CG1 3.24Å; L57-I61 WeakPolarHBondContact O-CG1 3.34Å; L57-I61 PolarHBondContact O-N 3.03Å
58	L	98.6	Very high	96.8	Very high	116 Å²	116	94.9 Å²	94.9	61%	0.607	49%	0.492	S	S	*	.	H	α-helix	trans	-61.5	-42.3	176.1	-77.5	169	0	0	0	112	N54 S56 I61 E62	N54-L58 WeakPolarHBondContact O-CG 3.47Å; N54-L58 PolarHBondContact O-N 2.76Å; S56-L58 VanDerWaalsContact C-N 3.29Å; S56-L58 PolarHBondContact O-N 2.96Å; L58-I61 PolarHBondContact O-N 2.93Å; L58-E62 WeakPolarHBondContact O-CB 3.35Å; L58-E62 PolarHBondContact O-N 3.48Å
59	K	98.3	Very high	96.3	Very high	127 Å²	127	94.5 Å²	94.5	55%	0.552	49%	0.491	S	S	*	.	H	α-helix	trans	-64.4	-41.4	176.3	-70.4	177.8	178.7	-176.2	0	112	L55 S56 L57 I61 E62 A63	L55-K59 WeakPolarHBondContact O-CG 3.24Å; L55-K59 PolarHBondContact O-N 3.39Å; S56-K59 WeakPolarHBondContact O-CB 3.48Å; S56-K59 PolarHBondContact O-N 2.99Å; S56-K59 VanDerWaalsContact O-N 3.1Å; L57-K59 VanDerWaalsContact C-N 3.34Å; L57-K59 PolarHBondContact O-N 3.44Å; K59-I61 VanDerWaalsContact C-N 3.35Å; K59-E62 PolarHBondContact O-N 3.04Å; K59-A63 WeakPolarHBondContact O-CB 3.36Å; K59-A63 PolarHBondContact O-N 2.94Å
60	D	98.3	Very high	95.5	Very high	95 Å²	95	95.5 Å²	95.5	51%	0.508	50%	0.496	S	S	.	.	H	α-helix	trans	-65.2	-40.6	178.7	-63.5	-25.9	0	0	0	111.2	S56 L57 A63 A64	S56-D60 VanDerWaalsContact O-CG 3.32Å; S56-D60 PolarHBondContact O-N 3.4Å; L57-D60 PolarHBondContact O-N 2.86Å; D60-A63 PolarHBondContact O-N 3.36Å; D60-A64 WeakPolarHBondContact O-CB 3.48Å; D60-A64 PolarHBondContact O-N 2.69Å
61	I	98.1	Very high	94.6	Very high	108 Å²	108	102.2 Å²	102.2	55%	0.554	51%	0.513	S	S	*	.	H	α-helix	trans	-63.4	-46.7	175	-70.6	165.5	0	0	0	110.8	L57 L58 K59 A63 A64 E65	L57-I61 WeakPolarHBondContact O-CB 3.41Å; L57-I61 VanDerWaalsContact O-CG1 3.24Å; L57-I61 WeakPolarHBondContact O-CG1 3.34Å; L57-I61 PolarHBondContact O-N 3.03Å; L58-I61 PolarHBondContact O-N 2.93Å; K59-I61 VanDerWaalsContact C-N 3.35Å; I61-A63 VanDerWaalsContact C-N 3.31Å; I61-A63 PolarHBondContact O-N 3.49Å; I61-A64 PolarHBondContact O-N 2.94Å; I61-E65 WeakPolarHBondContact O-CB 3.48Å; I61-E65 PolarHBondContact O-N 3.42Å
62	E	97.8	Very high	93.4	Very high	93 Å²	93	101.5 Å²	101.5	44%	0.435	51%	0.514	S	S	.	.	H	α-helix	trans	-61.4	-40.7	178.1	-171.5	-170.6	166.7	0	0	111.6	L58 K59 E65 K66	L58-E62 WeakPolarHBondContact O-CB 3.35Å; L58-E62 PolarHBondContact O-N 3.48Å; K59-E62 PolarHBondContact O-N 3.04Å; E62-E65 PolarHBondContact O-N 3.38Å; E62-K66 WeakPolarHBondContact O-CG 3.45Å; E62-K66 PolarHBondContact O-N 3.46Å; E62-K66 WeakPolarHBondContact OE1-CE 3.33Å; E62-K66 IonicContact OE1-NZ 2.66Å; E62-K66 PolarHBondContact OE1-NZ 3.04Å
63	A	97.1	Very high	91.9	Very high	59 Å²	59	102.5 Å²	102.5	49%	0.488	52%	0.52	S	S	.	.	H	α-helix	trans	-64.6	-43.4	175.8	0	0	0	0	0	111.9	K59 D60 I61 K66 S67	K59-A63 WeakPolarHBondContact O-CB 3.36Å; K59-A63 PolarHBondContact O-N 2.94Å; D60-A63 PolarHBondContact O-N 3.36Å; I61-A63 VanDerWaalsContact C-N 3.31Å; I61-A63 PolarHBondContact O-N 3.49Å; A63-K66 PolarHBondContact O-N 3Å; A63-S67 PolarHBondContact O-N 2.68Å
64	A	96.1	Very high	90.5	Very high	53 Å²	53	98.7 Å²	98.7	44%	0.438	52%	0.517	S	S	.	.	H	α-helix	trans	-63	-41.7	175.8	0	0	0	0	0	111.7	D60 I61 S67 L68	D60-A64 WeakPolarHBondContact O-CB 3.48Å; D60-A64 PolarHBondContact O-N 2.69Å; I61-A64 PolarHBondContact O-N 2.94Å; A64-S67 PolarHBondContact O-N 3.18Å; A64-L68 WeakPolarHBondContact O-CG 3.47Å; A64-L68 PolarHBondContact O-N 3.03Å
65	E	94.9	Very high	89.2	Confident	104 Å²	104	101.6 Å²	101.6	49%	0.486	53%	0.532	S	S	.	.	H	α-helix	trans	-59.7	-49.8	176.3	-175.4	-176.5	-171.1	0	0	111.4	I61 E62 S67 L68 Q69	I61-E65 WeakPolarHBondContact O-CB 3.48Å; I61-E65 PolarHBondContact O-N 3.42Å; E62-E65 PolarHBondContact O-N 3.38Å; E65-S67 VanDerWaalsContact C-N 3.28Å; E65-S67 PolarHBondContact O-N 3.41Å; E65-L68 PolarHBondContact O-N 3.42Å; E65-Q69 HydrophobicContact CG-CG 4.45Å; E65-Q69 WeakPolarHBondContact O-CG 3.32Å; E65-Q69 PolarHBondContact O-N 3.15Å; E65-Q69 PolarHBondContact OE1-NE2 3.36Å
66	K	92.3	Very high	88.1	Confident	114 Å²	114	101 Å²	101	50%	0.496	53%	0.533	S	S	.	.	H	α-helix	trans	-59.6	-39.9	176.7	-71.4	174.3	-174.7	168.5	0	112	E62 A63 L68 Q69 T70	E62-K66 WeakPolarHBondContact O-CG 3.45Å; E62-K66 PolarHBondContact O-N 3.46Å; E62-K66 WeakPolarHBondContact OE1-CE 3.33Å; E62-K66 IonicContact OE1-NZ 2.66Å; E62-K66 PolarHBondContact OE1-NZ 3.04Å; A63-K66 PolarHBondContact O-N 3Å; K66-L68 VanDerWaalsContact C-N 3.33Å; K66-L68 PolarHBondContact O-N 3.49Å; K66-Q69 PolarHBondContact O-N 3.08Å; K66-T70 WeakPolarHBondContact O-CG2 3.47Å; K66-T70 PolarHBondContact O-N 3Å; K66-T70 VanDerWaalsContact O-N 3.14Å; K66-T70 PolarHBondContact O-OG1 3.22Å; K66-T70 VanDerWaalsContact O-OG1 3.14Å
67	S	91.6	Very high	87.3	Confident	58 Å²	58	107 Å²	107	41%	0.406	55%	0.546	S	S	.	.	H	α-helix	trans	-65	-35.8	175.2	-171.9	0	0	0	0	112.6	A63 A64 E65 T70 R71	A63-S67 PolarHBondContact O-N 2.68Å; A64-S67 PolarHBondContact O-N 3.18Å; E65-S67 VanDerWaalsContact C-N 3.28Å; E65-S67 PolarHBondContact O-N 3.41Å; S67-T70 PolarHBondContact O-OG1 3.46Å; S67-R71 WeakPolarHBondContact O-CG 3.34Å; S67-R71 PolarHBondContact O-N 3.48Å
68	L	89.1	Confident	86.6	Confident	97 Å²	97	108.1 Å²	108.1	51%	0.508	56%	0.558	S	S	.	*	H	α-helix	trans	-73.5	-42.8	175.7	-73.2	173.5	0	0	0	112	A64 E65 K66 T70 R71 I72	A64-L68 WeakPolarHBondContact O-CG 3.47Å; A64-L68 PolarHBondContact O-N 3.03Å; E65-L68 PolarHBondContact O-N 3.42Å; K66-L68 VanDerWaalsContact C-N 3.33Å; K66-L68 PolarHBondContact O-N 3.49Å; L68-T70 VanDerWaalsContact C-N 3.29Å; L68-T70 PolarHBondContact O-N 2.91Å; L68-R71 CarbonylContact O-C 3.52Å; L68-R71 WeakPolarHBondContact O-CA 3.42Å; L68-R71 WeakPolarHBondContact O-CB 3.33Å; L68-R71 PolarHBondContact O-N 2.95Å; L68-I72 HydrophobicContact CB-CD1 4.22Å; L68-I72 WeakPolarHBondContact O-CB 3.35Å; L68-I72 VanDerWaalsContact O-CG1 3.29Å; L68-I72 WeakPolarHBondContact O-CG1 3.39Å; L68-I72 PolarHBondContact O-N 3.36Å
69	Q	86.9	Confident	86.1	Confident	96 Å²	96	108.4 Å²	108.4	45%	0.449	56%	0.556	S	S	.	*	H	α-helix	trans	-56.9	-43.8	176.9	-73.8	176.6	-0.6	0	0	111.6	E65 K66 R71 I72 H73	E65-Q69 HydrophobicContact CG-CG 4.45Å; E65-Q69 WeakPolarHBondContact O-CG 3.32Å; E65-Q69 PolarHBondContact O-N 3.15Å; E65-Q69 PolarHBondContact OE1-NE2 3.36Å; K66-Q69 PolarHBondContact O-N 3.08Å; Q69-R71 PolarHBondContact O-N 3.14Å; Q69-I72 PolarHBondContact O-N 3.33Å; Q69-H73 PolarHBondContact O-N 2.99Å
70	T	80.3	Confident	85.6	Confident	105 Å²	105	106 Å²	106	64%	0.644	55%	0.552	S	S	*	*	H	α-helix	trans	-63.7	-27.9	174.8	51.9	0	0	0	0	113.4	K66 S67 L68	K66-T70 WeakPolarHBondContact O-CG2 3.47Å; K66-T70 PolarHBondContact O-N 3Å; K66-T70 VanDerWaalsContact O-N 3.14Å; K66-T70 PolarHBondContact O-OG1 3.22Å; K66-T70 VanDerWaalsContact O-OG1 3.14Å; S67-T70 PolarHBondContact O-OG1 3.46Å; L68-T70 VanDerWaalsContact C-N 3.29Å; L68-T70 PolarHBondContact O-N 2.91Å
71	R	79.1	Confident	85.2	Confident	185 Å²	185	104.1 Å²	104.1	70%	0.698	54%	0.544	S	S	*	.	H	α-helix	trans	-85.2	-31.5	176	-72.9	178.4	-180	-146.7	1.6	114.2	S67 L68 Q69 P74	S67-R71 WeakPolarHBondContact O-CG 3.34Å; S67-R71 PolarHBondContact O-N 3.48Å; L68-R71 CarbonylContact O-C 3.52Å; L68-R71 WeakPolarHBondContact O-CA 3.42Å; L68-R71 WeakPolarHBondContact O-CB 3.33Å; L68-R71 PolarHBondContact O-N 2.95Å; Q69-R71 PolarHBondContact O-N 3.14Å; R71-P74 VanDerWaalsContact O-CD 3.27Å; R71-P74 WeakPolarHBondContact O-CD 3.42Å
72	I	73.6	Confident	84.9	Confident	119 Å²	119	102 Å²	102	61%	0.61	54%	0.538	S	S	*	.	H	α-helix	trans	-82.1	-25.8	-177.2	-68.8	167.5	0	0	0	111.4	L68 Q69 P74	L68-I72 HydrophobicContact CB-CD1 4.22Å; L68-I72 WeakPolarHBondContact O-CB 3.35Å; L68-I72 VanDerWaalsContact O-CG1 3.29Å; L68-I72 WeakPolarHBondContact O-CG1 3.39Å; L68-I72 PolarHBondContact O-N 3.36Å; Q69-I72 PolarHBondContact O-N 3.33Å; I72-P74 WeakPolarHBondContact O-CD 3.38Å
73	H	65.6	Low	84.8	Confident	147 Å²	147	103 Å²	103	68%	0.681	55%	0.546	S	S	*	.	S	Bend	trans	-102.5	58.5	166.9	-61.2	-61.9	0	0	0	111.6	Q69 L75	Q69-H73 PolarHBondContact O-N 2.99Å; H73-L75 PolarHBondContact O-N 3.35Å
74	P	70	Confident	84.6	Confident	92 Å²	92	105.1 Å²	105.1	60%	0.597	55%	0.546	S	S	*	.	P	Polyproline II helix	trans	-65.6	118.1	168.7	29.5	-25	0	0	0	105.8	R71 I72 P76	R71-P74 VanDerWaalsContact O-CD 3.27Å; R71-P74 WeakPolarHBondContact O-CD 3.42Å; I72-P74 WeakPolarHBondContact O-CD 3.38Å; P74-P76 VanDerWaalsContact O-N 3.16Å
75	L	70.3	Confident	84.6	Confident	150 Å²	150	106.9 Å²	106.9	79%	0.785	55%	0.551	S	S	*	*	P	Polyproline II helix	trans	-49.2	126.9	167.4	-170.9	73.1	0	0	0	106.5	H73 R77	H73-L75 PolarHBondContact O-N 3.35Å; L75-R77 PolarHBondContact O-N 3.28Å
76	P	76.1	Confident	84.6	Confident	65 Å²	65	110.5 Å²	110.5	42%	0.422	56%	0.561	S	S	.	*	P	Polyproline II helix	trans	-50.2	138.6	178.1	15.4	-27.5	0	0	0	108.9	P74 V81	P74-P76 VanDerWaalsContact O-N 3.16Å; P76-V81 HydrophobicContact CB-CG2 3.85Å; P76-V81 HydrophobicContact CG-CG2 3.64Å
77	R	80.1	Confident	84.8	Confident	189 Å²	189	111.8 Å²	111.8	71%	0.713	56%	0.563	S	S	*	*	P	Polyproline II helix	trans	-52.4	140.6	-177.6	-68.2	-170.3	177.8	-145.2	1.3	109.2	L75 E79 V80 V81	L75-R77 PolarHBondContact O-N 3.28Å; R77-E79 WeakPolarHBondContact CB-OE2 3.48Å; R77-E79 PolarHBondContact O-N 3.03Å; R77-V80 HydrophobicContact CB-CG2 4.21Å; R77-V80 WeakPolarHBondContact O-CA 3.44Å; R77-V80 WeakPolarHBondContact O-CB 3.2Å; R77-V80 PolarHBondContact O-N 3.28Å; R77-V81 PolarHBondContact O-N 3.36Å; R77-V81 VanDerWaalsContact O-N 3.15Å
78	P	83.8	Confident	85	Confident	99 Å²	99	115.9 Å²	115.9	64%	0.643	57%	0.57	S	S	*	*	H	α-helix	trans	-51.9	-33	-176.5	-27.9	35.2	0	0	0	113.7	V81 S82	P78-V81 PolarHBondContact O-N 3.44Å; P78-S82 WeakPolarHBondContact O-CB 3.44Å; P78-S82 PolarHBondContact O-N 3Å
79	E	88.7	Confident	85.3	Confident	121 Å²	121	113.9 Å²	113.9	57%	0.565	57%	0.568	S	S	*	*	H	α-helix	trans	-64.6	-39.9	176.1	-57.2	79.6	-173.3	0	0	112.1	R77 S82 L83	R77-E79 WeakPolarHBondContact CB-OE2 3.48Å; R77-E79 PolarHBondContact O-N 3.03Å; E79-S82 PolarHBondContact O-N 3Å; E79-L83 WeakPolarHBondContact O-CB 3.37Å; E79-L83 VanDerWaalsContact O-CG 3.29Å; E79-L83 WeakPolarHBondContact O-CG 3.47Å; E79-L83 PolarHBondContact O-N 3.39Å
80	V	88	Confident	85.7	Confident	77 Å²	77	111.6 Å²	111.6	47%	0.467	56%	0.562	S	S	.	*	H	α-helix	trans	-68.2	-42.1	177.5	179.3	0	0	0	0	110.3	R77 L83 E84	R77-V80 HydrophobicContact CB-CG2 4.21Å; R77-V80 WeakPolarHBondContact O-CA 3.44Å; R77-V80 WeakPolarHBondContact O-CB 3.2Å; R77-V80 PolarHBondContact O-N 3.28Å; V80-L83 PolarHBondContact O-N 3.47Å; V80-E84 WeakPolarHBondContact O-CB 3.35Å; V80-E84 PolarHBondContact O-N 2.95Å
81	V	89.2	Confident	86.3	Confident	56 Å²	56	108.3 Å²	108.3	34%	0.339	54%	0.542	S	S	.	.	H	α-helix	trans	-64.2	-42.2	176.7	-179.3	0	0	0	0	111.2	P76 R77 P78 E84 T85	P76-V81 HydrophobicContact CB-CG2 3.85Å; P76-V81 HydrophobicContact CG-CG2 3.64Å; R77-V81 PolarHBondContact O-N 3.36Å; R77-V81 VanDerWaalsContact O-N 3.15Å; P78-V81 PolarHBondContact O-N 3.44Å; V81-E84 PolarHBondContact O-N 2.99Å; V81-T85 WeakPolarHBondContact O-CB 3.26Å; V81-T85 PolarHBondContact O-N 3.49Å; V81-T85 PolarHBondContact O-OG1 3Å
82	S	92.6	Very high	87.1	Confident	62 Å²	62	106.7 Å²	106.7	43%	0.434	54%	0.542	S	S	.	.	H	α-helix	trans	-62.2	-44.2	175.9	-177.8	0	0	0	0	111.7	P78 E79 T85 R86	P78-S82 WeakPolarHBondContact O-CB 3.44Å; P78-S82 PolarHBondContact O-N 3Å; E79-S82 PolarHBondContact O-N 3Å; S82-T85 PolarHBondContact O-N 3.23Å; S82-R86 WeakPolarHBondContact O-CB 3.21Å; S82-R86 PolarHBondContact O-N 3.47Å
83	L	94.6	Very high	88.1	Confident	116 Å²	116	106.2 Å²	106.2	61%	0.607	54%	0.537	S	S	*	.	H	α-helix	trans	-63.4	-45.5	175.4	-77	170.6	0	0	0	112.2	E79 V80 T85 R86 Y87	E79-L83 WeakPolarHBondContact O-CB 3.37Å; E79-L83 VanDerWaalsContact O-CG 3.29Å; E79-L83 WeakPolarHBondContact O-CG 3.47Å; E79-L83 PolarHBondContact O-N 3.39Å; V80-L83 PolarHBondContact O-N 3.47Å; L83-T85 VanDerWaalsContact C-N 3.35Å; L83-T85 PolarHBondContact O-N 3.38Å; L83-R86 PolarHBondContact O-N 3.03Å; L83-Y87 VanDerWaalsContact O-CB 3.31Å; L83-Y87 WeakPolarHBondContact O-CB 3.45Å; L83-Y87 PolarHBondContact O-N 3.21Å
84	E	94.1	Very high	89.3	Confident	102 Å²	102	101.1 Å²	101.1	48%	0.477	51%	0.512	S	S	.	.	H	α-helix	trans	-60.4	-45.7	177.4	179	172.3	-166.7	0	0	111.1	V80 V81 R86 Y87 W88	V80-E84 WeakPolarHBondContact O-CB 3.35Å; V80-E84 PolarHBondContact O-N 2.95Å; V81-E84 PolarHBondContact O-N 2.99Å; E84-R86 VanDerWaalsContact C-N 3.34Å; E84-R86 PolarHBondContact O-N 3.4Å; E84-Y87 PolarHBondContact O-N 2.94Å; E84-W88 PolarHBondContact O-N 3.07Å
85	T	94.9	Very high	90.5	Very high	90 Å²	90	101.5 Å²	101.5	55%	0.552	51%	0.508	S	S	*	.	H	α-helix	trans	-59.4	-46.4	177	-54.7	0	0	0	0	111	V81 S82 L83 W88 A89	V81-T85 WeakPolarHBondContact O-CB 3.26Å; V81-T85 PolarHBondContact O-N 3.49Å; V81-T85 PolarHBondContact O-OG1 3Å; S82-T85 PolarHBondContact O-N 3.23Å; L83-T85 VanDerWaalsContact C-N 3.35Å; L83-T85 PolarHBondContact O-N 3.38Å; T85-W88 PolarHBondContact O-N 2.97Å; T85-A89 WeakPolarHBondContact O-CB 3.32Å; T85-A89 PolarHBondContact O-N 3.38Å
86	R	95.5	Very high	91.6	Very high	180 Å²	180	97.1 Å²	97.1	68%	0.679	49%	0.489	S	S	*	.	H	α-helix	trans	-67.3	-38.3	179.2	-169.2	177	-60.1	-169.5	0.5	112.2	S82 L83 E84 S90	S82-R86 WeakPolarHBondContact O-CB 3.21Å; S82-R86 PolarHBondContact O-N 3.47Å; L83-R86 PolarHBondContact O-N 3.03Å; E84-R86 VanDerWaalsContact C-N 3.34Å; E84-R86 PolarHBondContact O-N 3.4Å; R86-S90 WeakPolarHBondContact O-CB 3.41Å; R86-S90 PolarHBondContact O-N 3.5Å
87	Y	95.8	Very high	92.3	Very high	141 Å²	141	97.6 Å²	97.6	55%	0.553	48%	0.484	S	S	*	.	H	α-helix	trans	-61.2	-51.2	175.6	170.9	-96.2	0	0	0	110.7	L83 E84 A89 S90 V91	L83-Y87 VanDerWaalsContact O-CB 3.31Å; L83-Y87 WeakPolarHBondContact O-CB 3.45Å; L83-Y87 PolarHBondContact O-N 3.21Å; E84-Y87 PolarHBondContact O-N 2.94Å; Y87-A89 PolarHBondContact O-N 3.05Å; Y87-S90 WeakPolarHBondContact O-CB 3.48Å; Y87-S90 PolarHBondContact O-N 2.91Å; Y87-V91 HydrophobicContact CD1-CG2 4.19Å; Y87-V91 HydrophobicContact CD2-CG2 4.4Å; Y87-V91 HydrophobicContact CE1-CG2 3.72Å; Y87-V91 HydrophobicContact CE2-CG2 3.96Å; Y87-V91 WeakPolarHBondContact O-CG2 3.3Å; Y87-V91 PolarHBondContact O-N 2.89Å
88	W	96.2	Very high	92.9	Very high	145 Å²	145	93 Å²	93	55%	0.549	47%	0.467	S	S	.	.	H	α-helix	trans	-64.8	-38.3	179.5	-73.6	119.2	0	0	0	112.8	E84 T85 S90 V91 E92	E84-W88 PolarHBondContact O-N 3.07Å; T85-W88 PolarHBondContact O-N 2.97Å; W88-S90 VanDerWaalsContact C-N 3.33Å; W88-S90 PolarHBondContact O-N 3.32Å; W88-V91 HydrophobicContact CE3-CB 4.31Å; W88-V91 HydrophobicContact CE3-CG1 4.26Å; W88-V91 HydrophobicContact CZ3-CG1 4.36Å; W88-V91 PolarHBondContact O-N 3.02Å; W88-E92 WeakPolarHBondContact O-CB 3.37Å; W88-E92 PolarHBondContact O-N 3.32Å
89	A	96.3	Very high	93.4	Very high	55 Å²	55	93.8 Å²	93.8	46%	0.455	46%	0.462	S	S	.	.	H	α-helix	trans	-60.5	-42.9	172.8	0	0	0	0	0	112	T85 Y87 E92 E93	T85-A89 WeakPolarHBondContact O-CB 3.32Å; T85-A89 PolarHBondContact O-N 3.38Å; Y87-A89 PolarHBondContact O-N 3.05Å; A89-E92 PolarHBondContact O-N 3.11Å; A89-E93 WeakPolarHBondContact O-CB 3.24Å; A89-E93 PolarHBondContact O-N 3.43Å
90	S	94.8	Very high	93.5	Very high	48 Å²	48	93.1 Å²	93.1	34%	0.336	46%	0.459	S	S	.	.	H	α-helix	trans	-62.6	-47.2	174	174.7	0	0	0	0	111.2	R86 Y87 W88 E92 E93 Y94	R86-S90 WeakPolarHBondContact O-CB 3.41Å; R86-S90 PolarHBondContact O-N 3.5Å; Y87-S90 WeakPolarHBondContact O-CB 3.48Å; Y87-S90 PolarHBondContact O-N 2.91Å; W88-S90 VanDerWaalsContact C-N 3.33Å; W88-S90 PolarHBondContact O-N 3.32Å; S90-E92 VanDerWaalsContact C-N 3.3Å; S90-E92 PolarHBondContact O-N 3.46Å; S90-E93 WeakPolarHBondContact O-CB 3.32Å; S90-E93 PolarHBondContact O-N 2.97Å; S90-Y94 WeakPolarHBondContact O-CD2 3.49Å; S90-Y94 PolarHBondContact O-N 2.85Å; S90-Y94 WeakPolarHBondContact OG-CD2 3.46Å
91	V	94.2	Very high	93.7	Very high	35 Å²	35	92.8 Å²	92.8	21%	0.212	45%	0.451	C	S	.	.	H	α-helix	trans	-55.6	-46.3	176.7	168.8	0	0	0	0	111.2	Y87 W88 E93 Y94 I95	Y87-V91 HydrophobicContact CD1-CG2 4.19Å; Y87-V91 HydrophobicContact CD2-CG2 4.4Å; Y87-V91 HydrophobicContact CE1-CG2 3.72Å; Y87-V91 HydrophobicContact CE2-CG2 3.96Å; Y87-V91 WeakPolarHBondContact O-CG2 3.3Å; Y87-V91 PolarHBondContact O-N 2.89Å; W88-V91 HydrophobicContact CE3-CB 4.31Å; W88-V91 HydrophobicContact CE3-CG1 4.26Å; W88-V91 HydrophobicContact CZ3-CG1 4.36Å; W88-V91 PolarHBondContact O-N 3.02Å; V91-E93 VanDerWaalsContact C-N 3.3Å; V91-E93 PolarHBondContact O-N 3.36Å; V91-Y94 PolarHBondContact O-N 2.92Å; V91-I95 HydrophobicContact CG1-CD1 3.46Å; V91-I95 VanDerWaalsContact CG1-CD1 3.46Å; V91-I95 HydrophobicContact CG1-CG1 4.02Å; V91-I95 WeakPolarHBondContact O-CB 3.42Å; V91-I95 WeakPolarHBondContact O-CG1 3.41Å; V91-I95 PolarHBondContact O-N 3.07Å
92	E	95.2	Very high	93.8	Very high	152 Å²	152	96.3 Å²	96.3	71%	0.71	47%	0.468	S	S	*	.	H	α-helix	trans	-63.8	-35	178	-167.4	166.4	-157.8	0	0	112.5	W88 A89 S90 P96	W88-E92 WeakPolarHBondContact O-CB 3.37Å; W88-E92 PolarHBondContact O-N 3.32Å; A89-E92 PolarHBondContact O-N 3.11Å; S90-E92 VanDerWaalsContact C-N 3.3Å; S90-E92 PolarHBondContact O-N 3.46Å; E92-P96 WeakPolarHBondContact O-CD 3.32Å
93	E	93.7	Very high	93.9	Very high	109 Å²	109	98.2 Å²	98.2	51%	0.509	47%	0.472	S	S	.	.	H	α-helix	trans	-69.8	-39.5	175.1	-163.3	-160.4	140.2	0	0	113	A89 S90 V91 K97	A89-E93 WeakPolarHBondContact O-CB 3.24Å; A89-E93 PolarHBondContact O-N 3.43Å; S90-E93 WeakPolarHBondContact O-CB 3.32Å; S90-E93 PolarHBondContact O-N 2.97Å; V91-E93 VanDerWaalsContact C-N 3.3Å; V91-E93 PolarHBondContact O-N 3.36Å; E93-K97 IonicContact OE1-NZ 2.74Å; E93-K97 PolarHBondContact OE1-NZ 3.2Å
94	Y	92.3	Very high	93.7	Very high	40 Å²	40	95.9 Å²	95.9	16%	0.157	48%	0.477	C	S	.	.	H	α-helix	trans	-89.6	-24.9	-173.4	-77.5	-77.8	0	0	0	113.9	S90 V91 K97 W98 F110 E113	S90-Y94 WeakPolarHBondContact O-CD2 3.49Å; S90-Y94 PolarHBondContact O-N 2.85Å; S90-Y94 WeakPolarHBondContact OG-CD2 3.46Å; V91-Y94 PolarHBondContact O-N 2.92Å; Y94-K97 HydrophobicContact CD1-CD 3.75Å; Y94-K97 HydrophobicContact CE1-CD 4.03Å; Y94-K97 WeakPolarHBondContact O-CB 3.34Å; Y94-K97 PolarHBondContact O-N 2.87Å; Y94-K97 VanDerWaalsContact O-N 3.09Å; Y94-W98 VanDerWaalsContact O-CD1 3.3Å; Y94-W98 PolarHBondContact O-N 3.05Å; Y94-F110 HydrophobicContact CD1-CZ 4.37Å; Y94-F110 HydrophobicContact CE1-CE1 4.35Å; Y94-E113 PolarHBondContact OH-OE1 3.49Å; Y94-E113 VanDerWaalsContact OH-OE1 3.08Å
95	I	94.1	Very high	93.6	Very high	99 Å²	99	100.7 Å²	100.7	51%	0.508	49%	0.491	S	S	.	.	H	α-helix	trans	-51.1	-49.1	177.7	-82.6	167.5	0	0	0	111.9	V91 K97 W98 E99	V91-I95 HydrophobicContact CG1-CD1 3.46Å; V91-I95 VanDerWaalsContact CG1-CD1 3.46Å; V91-I95 HydrophobicContact CG1-CG1 4.02Å; V91-I95 WeakPolarHBondContact O-CB 3.42Å; V91-I95 WeakPolarHBondContact O-CG1 3.41Å; V91-I95 PolarHBondContact O-N 3.07Å; I95-K97 VanDerWaalsContact C-N 3.33Å; I95-K97 PolarHBondContact O-N 3.4Å; I95-W98 PolarHBondContact O-N 3.4Å; I95-E99 WeakPolarHBondContact O-CB 3.45Å; I95-E99 PolarHBondContact O-N 3.47Å
96	P	93.4	Very high	93.2	Very high	58 Å²	58	97.8 Å²	97.8	38%	0.377	48%	0.475	S	S	.	.	H	α-helix	trans	-63.3	-36.6	179	-24.2	34.4	0	0	0	113.4	E92 E99 Q100	E92-P96 WeakPolarHBondContact O-CD 3.32Å; P96-E99 PolarHBondContact O-N 2.96Å; P96-Q100 WeakPolarHBondContact O-CG 3.49Å; P96-Q100 PolarHBondContact O-N 2.98Å; P96-Q100 VanDerWaalsContact O-N 3.08Å
97	K	91.8	Very high	92.8	Very high	76 Å²	76	94.4 Å²	94.4	33%	0.33	48%	0.477	S	S	.	.	H	α-helix	trans	-65.1	-43.4	178.2	-56.5	177.3	-167.4	168	0	110.3	E93 Y94 I95 F101 P109	E93-K97 IonicContact OE1-NZ 2.74Å; E93-K97 PolarHBondContact OE1-NZ 3.2Å; Y94-K97 HydrophobicContact CD1-CD 3.75Å; Y94-K97 HydrophobicContact CE1-CD 4.03Å; Y94-K97 WeakPolarHBondContact O-CB 3.34Å; Y94-K97 PolarHBondContact O-N 2.87Å; Y94-K97 VanDerWaalsContact O-N 3.09Å; I95-K97 VanDerWaalsContact C-N 3.33Å; I95-K97 PolarHBondContact O-N 3.4Å; K97-F101 PolarHBondContact O-N 3.4Å; K97-P109 HydrophobicContact CB-CB 4.27Å; K97-P109 HydrophobicContact CB-CG 4.49Å
98	W	92.3	Very high	92.3	Very high	91 Å²	91	93.1 Å²	93.1	35%	0.345	47%	0.472	S	S	.	.	H	α-helix	trans	-65.5	-42.7	174.6	-83.7	109.3	0	0	0	112.8	Y94 I95 Q100 F101 L102 Y108 P109 F110	Y94-W98 VanDerWaalsContact O-CD1 3.3Å; Y94-W98 PolarHBondContact O-N 3.05Å; I95-W98 PolarHBondContact O-N 3.4Å; W98-Q100 VanDerWaalsContact C-N 3.35Å; W98-Q100 PolarHBondContact O-N 2.86Å; W98-F101 HydrophobicContact CE3-CD1 4.09Å; W98-F101 HydrophobicContact CZ3-CD1 4.14Å; W98-F101 HydrophobicContact CZ3-CE1 4.33Å; W98-F101 PolarHBondContact O-N 3.1Å; W98-L102 WeakPolarHBondContact O-CB 3.47Å; W98-L102 VanDerWaalsContact O-CG 3.26Å; W98-L102 WeakPolarHBondContact O-CG 3.36Å; W98-L102 PolarHBondContact O-N 3.38Å; W98-Y108 HydrophobicContact CH2-CE2 4.01Å; W98-Y108 HydrophobicContact CZ3-CE2 4.27Å; W98-P109 HydrophobicContact CD2-CG 4.15Å; W98-P109 HydrophobicContact CE3-CG 4.25Å; W98-P109 HydrophobicContact CG-CG 4.43Å; W98-F110 AromaticContact CE2-CE2 3.5Å; W98-F110 VanDerWaalsContact CE2-CE2 3.5Å; W98-F110 HydrophobicContact CH2-CE2 4.1Å; W98-F110 HydrophobicContact CZ2-CD2 4.05Å; W98-F110 AromaticContact CZ2-CE2 3.23Å; W98-F110 HydrophobicContact CZ2-CE2 3.23Å; W98-F110 HydrophobicContact CZ2-CZ 4.08Å; W98-F110 AromaticContact NE1-CE2 3.54Å; W98-F110 AromaticContact NE1-CZ 3.74Å
99	E	93.7	Very high	91.5	Very high	116 Å²	116	87.3 Å²	87.3	54%	0.542	45%	0.453	S	S	.	.	H	α-helix	trans	-58.2	-47.2	177.5	-175.3	179.9	-169.1	0	0	111.2	I95 P96 F101 L102 L103	I95-E99 WeakPolarHBondContact O-CB 3.45Å; I95-E99 PolarHBondContact O-N 3.47Å; P96-E99 PolarHBondContact O-N 2.96Å; E99-F101 PolarHBondContact O-N 2.95Å; E99-L102 PolarHBondContact O-N 3.4Å; E99-L103 HydrophobicContact CG-CD1 3.97Å; E99-L103 WeakPolarHBondContact O-CB 3.33Å; E99-L103 WeakPolarHBondContact O-CG 3.45Å; E99-L103 PolarHBondContact O-N 3.25Å
100	Q	91.8	Very high	90.4	Very high	108 Å²	108	88 Å²	88	51%	0.505	45%	0.446	S	S	.	.	H	α-helix	trans	-62.8	-40	178.1	-69.5	179.6	4.8	0	0	112.9	P96 W98 G104 R105 A106	P96-Q100 WeakPolarHBondContact O-CG 3.49Å; P96-Q100 PolarHBondContact O-N 2.98Å; P96-Q100 VanDerWaalsContact O-N 3.08Å; W98-Q100 VanDerWaalsContact C-N 3.35Å; W98-Q100 PolarHBondContact O-N 2.86Å; Q100-G104 PolarHBondContact O-N 3.41Å; Q100-R105 WeakPolarHBondContact O-CA 3.45Å; Q100-R105 WeakPolarHBondContact O-CB 3.46Å; Q100-R105 PolarHBondContact O-N 3.26Å; Q100-A106 HydrophobicContact CB-CB 3.73Å; Q100-A106 PolarHBondContact O-N 3.35Å
101	F	91.9	Very high	88.8	Confident	69 Å²	69	88.6 Å²	88.6	30%	0.303	45%	0.454	S	S	.	.	H	α-helix	trans	-65.1	-48.7	175.9	170.2	-105.9	0	0	0	111.9	K97 W98 E99 L103 G104 A106 Y108 P109	K97-F101 PolarHBondContact O-N 3.4Å; W98-F101 HydrophobicContact CE3-CD1 4.09Å; W98-F101 HydrophobicContact CZ3-CD1 4.14Å; W98-F101 HydrophobicContact CZ3-CE1 4.33Å; W98-F101 PolarHBondContact O-N 3.1Å; E99-F101 PolarHBondContact O-N 2.95Å; F101-L103 PolarHBondContact O-N 3.23Å; F101-G104 WeakPolarHBondContact O-CA 3.4Å; F101-G104 PolarHBondContact O-N 2.97Å; F101-A106 WeakPolarHBondContact CD2-O 3.25Å; F101-Y108 HydrophobicContact CE1-CD2 4.1Å; F101-Y108 HydrophobicContact CE2-CD2 4.23Å; F101-Y108 AromaticContact CZ-CD2 3.9Å; F101-Y108 HydrophobicContact CZ-CD2 3.9Å; F101-P109 HydrophobicContact CB-CG 3.96Å; F101-P109 HydrophobicContact CG-CG 4.35Å
102	L	91.3	Very high	86.8	Confident	131 Å²	131	91.2 Å²	91.2	69%	0.686	47%	0.469	S	S	*	.	H	α-helix	trans	-63.6	-28.1	-179.4	-69.1	173.7	0	0	0	112.5	W98 E99 G104	W98-L102 WeakPolarHBondContact O-CB 3.47Å; W98-L102 VanDerWaalsContact O-CG 3.26Å; W98-L102 WeakPolarHBondContact O-CG 3.36Å; W98-L102 PolarHBondContact O-N 3.38Å; E99-L102 PolarHBondContact O-N 3.4Å; L102-G104 VanDerWaalsContact C-N 3.25Å; L102-G104 PolarHBondContact O-N 3.27Å
103	L	94.6	Very high	84.9	Confident	101 Å²	101	88.8 Å²	88.8	53%	0.529	46%	0.458	S	S	.	.	T	Hydrogen-bonded Turn	trans	-81.7	2	172.9	-66.4	173.8	0	0	0	113.8	E99 F101 R105	E99-L103 HydrophobicContact CG-CD1 3.97Å; E99-L103 WeakPolarHBondContact O-CB 3.33Å; E99-L103 WeakPolarHBondContact O-CG 3.45Å; E99-L103 PolarHBondContact O-N 3.25Å; F101-L103 PolarHBondContact O-N 3.23Å; L103-R105 HydrophobicContact CB-CG 4.09Å; L103-R105 PolarHBondContact O-N 3.1Å
104	G	90.8	Very high	82.7	Confident	68 Å²	68	89.9 Å²	89.9	70%	0.701	47%	0.467	S	S	*	.	T	Hydrogen-bonded Turn	trans	70.3	16.5	-178.6	0	0	0	0	0	114.3	Q100 F101 L102	Q100-G104 PolarHBondContact O-N 3.41Å; F101-G104 WeakPolarHBondContact O-CA 3.4Å; F101-G104 PolarHBondContact O-N 2.97Å; L102-G104 VanDerWaalsContact C-N 3.25Å; L102-G104 PolarHBondContact O-N 3.27Å
105	R	90.4	Very high	80.6	Confident	203 Å²	203	94.8 Å²	94.8	77%	0.766	49%	0.492	S	S	*	.	S	Bend	trans	-94.8	-13.4	-176.8	-58.9	-176.6	-175.3	-170.5	2.3	113.3	Q100 L103	Q100-R105 WeakPolarHBondContact O-CA 3.45Å; Q100-R105 WeakPolarHBondContact O-CB 3.46Å; Q100-R105 PolarHBondContact O-N 3.26Å; L103-R105 HydrophobicContact CB-CG 4.09Å; L103-R105 PolarHBondContact O-N 3.1Å
106	A	87.7	Confident	78.2	Confident	28 Å²	28	94.5 Å²	94.5	23%	0.231	49%	0.491	C	S	.	.	S	Bend	trans	-140.5	157.1	-178.7	0	0	0	0	0	111.5	Q100 F101	Q100-A106 HydrophobicContact CB-CB 3.73Å; Q100-A106 PolarHBondContact O-N 3.35Å; F101-A106 WeakPolarHBondContact CD2-O 3.25Å
107	P	85.5	Confident	75.9	Confident	109 Å²	109	99.1 Å²	99.1	71%	0.708	51%	0.508	S	S	*	.			trans	-71.9	172.2	171.1	31	-34.8	0	0	0	112.2
108	Y	85.4	Confident	73.5	Confident	115 Å²	115	98.5 Å²	98.5	45%	0.451	52%	0.517	S	S	.	.			trans	-57.6	126.1	-176.1	-178.3	-114	0	0	0	112.4	W98 F101 F110 A111	W98-Y108 HydrophobicContact CH2-CE2 4.01Å; W98-Y108 HydrophobicContact CZ3-CE2 4.27Å; F101-Y108 HydrophobicContact CE1-CD2 4.1Å; F101-Y108 HydrophobicContact CE2-CD2 4.23Å; F101-Y108 AromaticContact CZ-CD2 3.9Å; F101-Y108 HydrophobicContact CZ-CD2 3.9Å; Y108-F110 VanDerWaalsContact C-N 3.32Å; Y108-F110 HydrophobicContact CD1-CB 4.27Å; Y108-F110 HydrophobicContact CE1-CB 3.65Å; Y108-F110 HydrophobicContact CE1-CD2 4.12Å; Y108-F110 HydrophobicContact CE1-CG 4.38Å; Y108-F110 HydrophobicContact CE2-CD2 4.37Å; Y108-F110 AromaticContact CZ-CD2 3.82Å; Y108-F110 PolarHBondContact O-N 3.47Å; Y108-A111 HydrophobicContact CD1-CB 4.18Å; Y108-A111 PolarHBondContact O-N 3.1Å
109	P	79.6	Confident	71.1	Confident	23 Å²	23	100.9 Å²	100.9	15%	0.149	53%	0.532	C	S	.	.	T	Hydrogen-bonded Turn	trans	-61.1	-29.1	-168.9	-27	34.8	0	0	0	116	K97 W98 F101	K97-P109 HydrophobicContact CB-CB 4.27Å; K97-P109 HydrophobicContact CB-CG 4.49Å; W98-P109 HydrophobicContact CD2-CG 4.15Å; W98-P109 HydrophobicContact CE3-CG 4.25Å; W98-P109 HydrophobicContact CG-CG 4.43Å; F101-P109 HydrophobicContact CB-CG 3.96Å; F101-P109 HydrophobicContact CG-CG 4.35Å
110	F	74.5	Confident	68.7	Low	69 Å²	69	100.4 Å²	100.4	30%	0.303	53%	0.533	S	S	.	.	T	Hydrogen-bonded Turn	trans	-97.4	4	-176.4	-58.7	-87.6	0	0	0	113.9	Y94 W98 Y108 V112	Y94-F110 HydrophobicContact CD1-CZ 4.37Å; Y94-F110 HydrophobicContact CE1-CE1 4.35Å; W98-F110 AromaticContact CE2-CE2 3.5Å; W98-F110 VanDerWaalsContact CE2-CE2 3.5Å; W98-F110 HydrophobicContact CH2-CE2 4.1Å; W98-F110 HydrophobicContact CZ2-CD2 4.05Å; W98-F110 AromaticContact CZ2-CE2 3.23Å; W98-F110 HydrophobicContact CZ2-CE2 3.23Å; W98-F110 HydrophobicContact CZ2-CZ 4.08Å; W98-F110 AromaticContact NE1-CE2 3.54Å; W98-F110 AromaticContact NE1-CZ 3.74Å; Y108-F110 VanDerWaalsContact C-N 3.32Å; Y108-F110 HydrophobicContact CD1-CB 4.27Å; Y108-F110 HydrophobicContact CE1-CB 3.65Å; Y108-F110 HydrophobicContact CE1-CD2 4.12Å; Y108-F110 HydrophobicContact CE1-CG 4.38Å; Y108-F110 HydrophobicContact CE2-CD2 4.37Å; Y108-F110 AromaticContact CZ-CD2 3.82Å; Y108-F110 PolarHBondContact O-N 3.47Å; F110-V112 PolarHBondContact O-N 3.31Å
111	A	59.7	Low	66.4	Low	61 Å²	61	100.4 Å²	100.4	50%	0.504	54%	0.541	S	S	.	.	S	Bend	trans	-73.1	-14.8	-178.1	0	0	0	0	0	113.5	Y108	Y108-A111 HydrophobicContact CD1-CB 4.18Å; Y108-A111 PolarHBondContact O-N 3.1Å
112	V	53.4	Low	64.2	Low	90 Å²	90	103.9 Å²	103.9	55%	0.545	56%	0.561	S	S	.	*	S	Bend	trans	-101	-14.8	-166.7	-173.4	0	0	0	0	113.9	F110	F110-V112 PolarHBondContact O-N 3.31Å
113	E	54.1	Low	62	Low	100 Å²	100	105.6 Å²	105.6	47%	0.467	57%	0.565	S	S	.	*	G	3₁₀ helix	trans	-78.1	-23.9	-177.2	-72.6	175.9	159.2	0	0	113.6	Y94 Q115	Y94-E113 PolarHBondContact OH-OE1 3.49Å; Y94-E113 VanDerWaalsContact OH-OE1 3.08Å; E113-Q115 PolarHBondContact O-N 2.85Å; E113-Q115 VanDerWaalsContact O-N 3.17Å
114	N	48.5	Very low	59.8	Low	132 Å²	132	107.7 Å²	107.7	71%	0.706	58%	0.577	S	S	*	*	G	3₁₀ helix	trans	-77	1.3	-176	-66.4	-46.8	0	0	0	115.3
115	Q	47.9	Very low	57.5	Low	144 Å²	144	113.2 Å²	113.2	67%	0.673	58%	0.584	S	S	*	*	G	3₁₀ helix	trans	-103.8	-23.2	177.8	-70.8	-177.6	-10.5	0	0	113.3	E113	E113-Q115 PolarHBondContact O-N 2.85Å; E113-Q115 VanDerWaalsContact O-N 3.17Å
116	N	44.3	Very low	55	Low	92 Å²	92	111.9 Å²	111.9	49%	0.492	62%	0.617	S	S	.	*	H	α-helix	trans	-96.8	-17.1	-171.7	-57.9	-24.8	0	0	0	113.9	N120	N116-N120 PolarHBondContact O-ND2 3.01Å
117	E	44.2	Very low	53.3	Low	156 Å²	156	116.1 Å²	116.1	73%	0.729	64%	0.637	S	S	*	*	H	α-helix	trans	-79.7	-29.4	172	-74.7	-169.8	159.7	0	0	112.6	T121	E117-T121 PolarHBondContact O-OG1 3.11Å
118	A	42.6	Very low	51.6	Low	63 Å²	63	116.5 Å²	116.5	52%	0.521	63%	0.633	S	S	.	*	H	α-helix	trans	-72.3	-29.1	179.4	0	0	0	0	0	113.1
119	E	40.8	Very low	49.8	Very low	140 Å²	140	116.6 Å²	116.6	65%	0.654	64%	0.643	S	S	*	*	H	α-helix	trans	-84.7	-29.1	-180	-70.5	-173.3	163.1	0	0	113.5	T121 I122	E119-T121 VanDerWaalsContact C-N 3.32Å; E119-T121 PolarHBondContact O-N 3.34Å; E119-I122 PolarHBondContact O-N 2.94Å
120	N	44.2	Very low	48	Very low	107 Å²	107	122.1 Å²	122.1	57%	0.572	67%	0.672	S	S	*	*	H	α-helix	trans	-78	-12.5	-178.7	-78.5	-54.7	0	0	0	114.3	N116	N116-N120 PolarHBondContact O-ND2 3.01Å
121	T	42.3	Very low	46.3	Very low	108 Å²	108	125.4 Å²	125.4	66%	0.663	70%	0.695	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.6	-21.1	176.2	-52.1	0	0	0	0	112.1	E117 E119	E117-T121 PolarHBondContact O-OG1 3.11Å; E119-T121 VanDerWaalsContact C-N 3.32Å; E119-T121 PolarHBondContact O-N 3.34Å
122	I	47.3	Very low	45.5	Very low	141 Å²	141	129.7 Å²	129.7	72%	0.723	71%	0.708	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.2	-18	-174.3	-59.3	177.3	0	0	0	112.5	E119	E119-I122 PolarHBondContact O-N 2.94Å
123	Q	44.3	Very low	44.9	Very low	167 Å²	167	132.5 Å²	132.5	78%	0.78	72%	0.719	S	S	*	*	S	Bend	trans	-92.3	-4.8	-177.3	-68.4	-168.9	-8.6	0	0	115.5
124	N	47.4	Very low	44.2	Very low	145 Å²	145	135 Å²	135	78%	0.775	74%	0.739	S	S	*	*	S	Bend	trans	-101.2	9.1	-177.9	-72.1	-33.1	0	0	0	114.6
125	E	43.3	Very low	43.8	Very low	184 Å²	184	135.3 Å²	135.3	86%	0.86	74%	0.741	S	S	*	*			trans	-125.6	80.6	171.8	-71.4	-173.2	167.1	0	0	110.6
126	A	37.3	Very low	43.4	Very low	176 Å²	176	134.5 Å²	134.5	100%	1.455	75%	0.748	S	S	*	*			trans	-158	0	159.1	0	0	0	0	0	111

Retrieved 126 of 126 residues in 32.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).