SIM12_NOMLE Loading...

Small integral membrane protein 12

AlphaFold DB , UniProt , Accession G1S9B8, Species NOMLE (Nomascus leucogenys, Northern white-cheeked gibbon), Gene SMIM12, Length 92 aa.

						>SIM12_NOMLE|G1S9B8|SMIM12
MWPVFWTVVRTYAPYVTFPVAFVVGAVGYHLEWFIRGKDPQPVEEEKSISERREDRKLDELLGKDHTQVVSLKDKLEFAPKAVLNRNRPEKN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	83.1	Confident	89	Confident	197 Å²	197	115.3 Å²	115.3	97%	0.97	56%	0.564	S	S	*	*				0	-40.9	0	-60.2	-48	-141.4	0	0	113.6	V4 F5	M1-V4 PolarHBondContact O-N 2.77Å; M1-F5 PolarHBondContact O-N 3.01Å
2	W	86.7	Confident	89.1	Confident	197 Å²	197	117.1 Å²	117.1	75%	0.746	56%	0.562	S	S	*	*	H	α-helix	trans	-51.7	-46.2	176.9	-168.7	-110	0	0	0	116.7	V4 F5 W6	W2-V4 VanDerWaalsContact C-N 3.27Å; W2-V4 PolarHBondContact O-N 3.43Å; W2-F5 PolarHBondContact O-N 3.15Å; W2-W6 PolarHBondContact O-N 3.43Å; W2-W6 VanDerWaalsContact O-N 3.14Å
3	P	90.7	Very high	89.2	Confident	88 Å²	88	110.6 Å²	110.6	57%	0.571	54%	0.54	S	S	*	.	H	α-helix	trans	-64.2	-32.5	178.7	22.8	-33.5	0	0	0	112.7	W6 T7	P3-W6 PolarHBondContact O-N 3.18Å; P3-T7 WeakPolarHBondContact O-CG2 3.47Å; P3-T7 PolarHBondContact O-N 3.15Å; P3-T7 PolarHBondContact O-OG1 3.36Å
4	V	89.5	Confident	89.4	Confident	85 Å²	85	108 Å²	108	52%	0.515	54%	0.535	S	S	.	.	H	α-helix	trans	-68.2	-42.8	179.1	-178.5	0	0	0	0	110.9	M1 W2 W6 T7 V8	M1-V4 PolarHBondContact O-N 2.77Å; W2-V4 VanDerWaalsContact C-N 3.27Å; W2-V4 PolarHBondContact O-N 3.43Å; V4-W6 VanDerWaalsContact C-N 3.29Å; V4-W6 PolarHBondContact O-N 3.17Å; V4-T7 VanDerWaalsContact CA-OG1 3.31Å; V4-T7 WeakPolarHBondContact CA-OG1 3.31Å; V4-T7 PolarHBondContact O-N 3.36Å; V4-T7 PolarHBondContact O-OG1 3.12Å; V4-V8 VanDerWaalsContact O-CG2 3.31Å; V4-V8 WeakPolarHBondContact O-CG2 3.07Å; V4-V8 PolarHBondContact O-N 3.36Å
5	F	90.4	Very high	89.6	Confident	123 Å²	123	112.6 Å²	112.6	54%	0.539	55%	0.546	S	S	.	.	H	α-helix	trans	-58.5	-45.1	173.5	-179.3	-100.8	0	0	0	111	M1 W2 T7 V8 V9	M1-F5 PolarHBondContact O-N 3.01Å; W2-F5 PolarHBondContact O-N 3.15Å; F5-T7 PolarHBondContact O-N 3.48Å; F5-V8 PolarHBondContact O-N 3Å; F5-V9 HydrophobicContact CD1-CG2 4.16Å; F5-V9 HydrophobicContact CE1-CG2 3.76Å; F5-V9 HydrophobicContact CE2-CG2 4.29Å; F5-V9 HydrophobicContact CZ-CG2 3.83Å; F5-V9 WeakPolarHBondContact O-CG2 3.38Å; F5-V9 PolarHBondContact O-N 3.28Å
6	W	90.3	Very high	89.7	Confident	121 Å²	121	111.5 Å²	111.5	46%	0.458	55%	0.548	S	S	.	.	H	α-helix	trans	-66.4	-36.5	179.1	-168.1	-115	0	0	0	113.5	W2 P3 V4 R10	W2-W6 PolarHBondContact O-N 3.43Å; W2-W6 VanDerWaalsContact O-N 3.14Å; P3-W6 PolarHBondContact O-N 3.18Å; V4-W6 VanDerWaalsContact C-N 3.29Å; V4-W6 PolarHBondContact O-N 3.17Å; W6-R10 VanDerWaalsContact CD1-NH1 3.31Å; W6-R10 VanDerWaalsContact NE1-NH2 3.15Å; W6-R10 WeakPolarHBondContact O-CB 3.45Å; W6-R10 PolarHBondContact O-N 2.79Å
7	T	89.5	Confident	89.9	Confident	76 Å²	76	109.9 Å²	109.9	47%	0.466	55%	0.546	S	S	.	.	H	α-helix	trans	-64.2	-44.2	172.9	50.1	0	0	0	0	111.3	P3 V4 F5 R10 T11	P3-T7 WeakPolarHBondContact O-CG2 3.47Å; P3-T7 PolarHBondContact O-N 3.15Å; P3-T7 PolarHBondContact O-OG1 3.36Å; V4-T7 VanDerWaalsContact CA-OG1 3.31Å; V4-T7 WeakPolarHBondContact CA-OG1 3.31Å; V4-T7 PolarHBondContact O-N 3.36Å; V4-T7 PolarHBondContact O-OG1 3.12Å; F5-T7 PolarHBondContact O-N 3.48Å; T7-R10 PolarHBondContact O-N 3.28Å; T7-T11 WeakPolarHBondContact O-CB 3.34Å; T7-T11 PolarHBondContact O-N 3.36Å; T7-T11 PolarHBondContact O-OG1 3.43Å
8	V	89.7	Confident	90.2	Very high	70 Å²	70	111.8 Å²	111.8	42%	0.424	55%	0.551	S	S	.	*	H	α-helix	trans	-62.2	-48.2	178.1	171.6	0	0	0	0	110.4	V4 F5 R10 T11 Y12	V4-V8 VanDerWaalsContact O-CG2 3.31Å; V4-V8 WeakPolarHBondContact O-CG2 3.07Å; V4-V8 PolarHBondContact O-N 3.36Å; F5-V8 PolarHBondContact O-N 3Å; V8-R10 VanDerWaalsContact C-N 3.29Å; V8-R10 PolarHBondContact O-N 2.88Å; V8-T11 PolarHBondContact O-N 3.22Å; V8-Y12 HydrophobicContact CG1-CD2 3.71Å; V8-Y12 HydrophobicContact CG1-CE2 4.04Å; V8-Y12 VanDerWaalsContact O-CD2 3.29Å; V8-Y12 WeakPolarHBondContact O-CD2 3.47Å; V8-Y12 PolarHBondContact O-N 2.96Å
9	V	90.1	Very high	90.5	Very high	58 Å²	58	109.3 Å²	109.3	35%	0.352	54%	0.544	S	S	.	.	H	α-helix	trans	-57.3	-43.7	176.3	171.9	0	0	0	0	110.8	F5 A13	F5-V9 HydrophobicContact CD1-CG2 4.16Å; F5-V9 HydrophobicContact CE1-CG2 3.76Å; F5-V9 HydrophobicContact CE2-CG2 4.29Å; F5-V9 HydrophobicContact CZ-CG2 3.83Å; F5-V9 WeakPolarHBondContact O-CG2 3.38Å; F5-V9 PolarHBondContact O-N 3.28Å; V9-A13 VanDerWaalsContact O-CA 3.26Å; V9-A13 WeakPolarHBondContact O-CA 3.36Å; V9-A13 WeakPolarHBondContact O-CB 3.37Å; V9-A13 PolarHBondContact O-N 2.85Å
10	R	88.8	Confident	90.8	Very high	165 Å²	165	108.2 Å²	108.2	62%	0.623	54%	0.543	S	S	*	.	H	α-helix	trans	-66	-39.9	176.5	-81.7	-175.5	168.9	147.8	-1.1	113.8	W6 T7 V8 P14	W6-R10 VanDerWaalsContact CD1-NH1 3.31Å; W6-R10 VanDerWaalsContact NE1-NH2 3.15Å; W6-R10 WeakPolarHBondContact O-CB 3.45Å; W6-R10 PolarHBondContact O-N 2.79Å; T7-R10 PolarHBondContact O-N 3.28Å; V8-R10 VanDerWaalsContact C-N 3.29Å; V8-R10 PolarHBondContact O-N 2.88Å; R10-P14 WeakPolarHBondContact O-CD 3.07Å
11	T	89.7	Confident	91.1	Very high	88 Å²	88	106 Å²	106	54%	0.54	54%	0.542	S	S	.	.	H	α-helix	trans	-67.3	-39.8	179.8	-58.7	0	0	0	0	111.4	T7 V8	T7-T11 WeakPolarHBondContact O-CB 3.34Å; T7-T11 PolarHBondContact O-N 3.36Å; T7-T11 PolarHBondContact O-OG1 3.43Å; V8-T11 PolarHBondContact O-N 3.22Å
12	Y	90.4	Very high	91.7	Very high	137 Å²	137	103.1 Å²	103.1	54%	0.537	52%	0.524	S	S	.	.	H	α-helix	trans	-95.2	-10.9	-178.3	-67	-74.1	0	0	0	114.3	V8 Y15 V16	V8-Y12 HydrophobicContact CG1-CD2 3.71Å; V8-Y12 HydrophobicContact CG1-CE2 4.04Å; V8-Y12 VanDerWaalsContact O-CD2 3.29Å; V8-Y12 WeakPolarHBondContact O-CD2 3.47Å; V8-Y12 PolarHBondContact O-N 2.96Å; Y12-Y15 HydrophobicContact CD1-CD2 4.21Å; Y12-Y15 WeakPolarHBondContact O-CB 3.44Å; Y12-Y15 PolarHBondContact O-N 3.32Å; Y12-V16 PolarHBondContact O-N 3.37Å
13	A	90.1	Very high	92.2	Very high	33 Å²	33	97.9 Å²	97.9	27%	0.273	51%	0.514	S	S	.	.	H	α-helix	trans	-50.6	-51.2	179.3	0	0	0	0	0	111.6	V9 Y15 V16 T17	V9-A13 VanDerWaalsContact O-CA 3.26Å; V9-A13 WeakPolarHBondContact O-CA 3.36Å; V9-A13 WeakPolarHBondContact O-CB 3.37Å; V9-A13 PolarHBondContact O-N 2.85Å; A13-Y15 VanDerWaalsContact C-N 3.26Å; A13-Y15 PolarHBondContact O-N 3.3Å; A13-V16 PolarHBondContact O-N 2.8Å; A13-T17 WeakPolarHBondContact O-CB 3.48Å; A13-T17 WeakPolarHBondContact O-CG2 3.47Å; A13-T17 PolarHBondContact O-N 2.86Å; A13-T17 PolarHBondContact O-OG1 2.69Å
14	P	92.6	Very high	92.5	Very high	74 Å²	74	98.4 Å²	98.4	48%	0.481	52%	0.515	S	S	.	.	H	α-helix	trans	-58.6	-36.5	179.8	-24.4	34.9	0	0	0	113.4	R10 V16 F18	R10-P14 WeakPolarHBondContact O-CD 3.07Å; P14-V16 VanDerWaalsContact C-N 3.25Å; P14-V16 PolarHBondContact O-N 3.36Å; P14-F18 WeakPolarHBondContact O-CB 3.08Å; P14-F18 PolarHBondContact O-N 2.91Å
15	Y	92.6	Very high	92.9	Very high	177 Å²	177	96.3 Å²	96.3	69%	0.694	51%	0.511	S	S	*	.	H	α-helix	trans	-69.5	-23.5	-180	-66	-81.8	0	0	0	113.3	Y12 A13 P19	Y12-Y15 HydrophobicContact CD1-CD2 4.21Å; Y12-Y15 WeakPolarHBondContact O-CB 3.44Å; Y12-Y15 PolarHBondContact O-N 3.32Å; A13-Y15 VanDerWaalsContact C-N 3.26Å; A13-Y15 PolarHBondContact O-N 3.3Å; Y15-P19 WeakPolarHBondContact O-CD 3.45Å; Y15-P19 WeakPolarHBondContact O-CG 3.38Å
16	V	90.5	Very high	93.2	Very high	95 Å²	95	92.1 Å²	92.1	58%	0.576	50%	0.499	S	S	*	.	H	α-helix	trans	-97.4	-45.3	177.5	-179.4	0	0	0	0	110.8	Y12 A13 P14 P19 V20	Y12-V16 PolarHBondContact O-N 3.37Å; A13-V16 PolarHBondContact O-N 2.8Å; P14-V16 VanDerWaalsContact C-N 3.25Å; P14-V16 PolarHBondContact O-N 3.36Å; V16-P19 WeakPolarHBondContact O-CD 3.3Å; V16-V20 WeakPolarHBondContact O-CG2 3.33Å; V16-V20 PolarHBondContact O-N 3.12Å
17	T	93.3	Very high	93.5	Very high	84 Å²	84	90.8 Å²	90.8	52%	0.515	50%	0.504	S	S	.	.	H	α-helix	trans	-72.8	-35.8	-175.9	61.4	0	0	0	0	112.2	A13 V20 A21	A13-T17 WeakPolarHBondContact O-CB 3.48Å; A13-T17 WeakPolarHBondContact O-CG2 3.47Å; A13-T17 PolarHBondContact O-N 2.86Å; A13-T17 PolarHBondContact O-OG1 2.69Å; T17-V20 PolarHBondContact O-N 3.31Å; T17-A21 WeakPolarHBondContact O-CB 3.13Å; T17-A21 PolarHBondContact O-N 3.47Å
18	F	94.9	Very high	93.7	Very high	144 Å²	144	88.8 Å²	88.8	63%	0.632	50%	0.498	S	S	*	.	H	α-helix	trans	-65.4	-50.5	-179.6	176.3	-97.2	0	0	0	112.4	P14 V20 A21 F22	P14-F18 WeakPolarHBondContact O-CB 3.08Å; P14-F18 PolarHBondContact O-N 2.91Å; F18-V20 VanDerWaalsContact C-N 3.31Å; F18-V20 PolarHBondContact O-N 3.03Å; F18-A21 PolarHBondContact O-N 3.47Å; F18-F22 VanDerWaalsContact O-CB 3.26Å; F18-F22 WeakPolarHBondContact O-CB 3.09Å; F18-F22 PolarHBondContact O-N 3.1Å
19	P	96.6	Very high	93.8	Very high	65 Å²	65	92.2 Å²	92.2	42%	0.422	50%	0.504	S	S	.	.	H	α-helix	trans	-59.7	-41.8	175.5	-25.8	36.2	0	0	0	112.7	Y15 V16 F22 V23	Y15-P19 WeakPolarHBondContact O-CD 3.45Å; Y15-P19 WeakPolarHBondContact O-CG 3.38Å; V16-P19 WeakPolarHBondContact O-CD 3.3Å; P19-F22 PolarHBondContact O-N 3.37Å; P19-V23 VanDerWaalsContact O-CG2 3.27Å; P19-V23 WeakPolarHBondContact O-CG2 3.49Å; P19-V23 PolarHBondContact O-N 2.9Å
20	V	96.4	Very high	93.9	Very high	87 Å²	87	95.1 Å²	95.1	53%	0.527	51%	0.514	S	S	.	.	H	α-helix	trans	-62.8	-48.6	177.7	172.9	0	0	0	0	110.7	V16 T17 F18 F22 V23 V24	V16-V20 WeakPolarHBondContact O-CG2 3.33Å; V16-V20 PolarHBondContact O-N 3.12Å; T17-V20 PolarHBondContact O-N 3.31Å; F18-V20 VanDerWaalsContact C-N 3.31Å; F18-V20 PolarHBondContact O-N 3.03Å; V20-F22 VanDerWaalsContact C-N 3.33Å; V20-F22 PolarHBondContact O-N 2.78Å; V20-V23 PolarHBondContact O-N 3.3Å; V20-V24 HydrophobicContact CG1-CG2 4.43Å; V20-V24 WeakPolarHBondContact O-CB 3.32Å; V20-V24 VanDerWaalsContact O-CG2 3.27Å; V20-V24 WeakPolarHBondContact O-CG2 3.19Å; V20-V24 PolarHBondContact O-N 3.13Å
21	A	96.5	Very high	94	Very high	62 Å²	62	92.2 Å²	92.2	51%	0.512	51%	0.51	S	S	.	.	H	α-helix	trans	-63.9	-38.6	178.8	0	0	0	0	0	112	T17 F18 V24 G25	T17-A21 WeakPolarHBondContact O-CB 3.13Å; T17-A21 PolarHBondContact O-N 3.47Å; F18-A21 PolarHBondContact O-N 3.47Å; A21-V24 PolarHBondContact O-N 3.19Å; A21-G25 PolarHBondContact O-N 3.38Å
22	F	97.4	Very high	94	Very high	137 Å²	137	92.5 Å²	92.5	60%	0.601	51%	0.505	S	S	*	.	H	α-helix	trans	-63.1	-45.6	175.9	-178.3	-96.4	0	0	0	111.4	F18 P19 V20 G25 A26	F18-F22 VanDerWaalsContact O-CB 3.26Å; F18-F22 WeakPolarHBondContact O-CB 3.09Å; F18-F22 PolarHBondContact O-N 3.1Å; P19-F22 PolarHBondContact O-N 3.37Å; V20-F22 VanDerWaalsContact C-N 3.33Å; V20-F22 PolarHBondContact O-N 2.78Å; F22-G25 PolarHBondContact O-N 3.08Å; F22-A26 VanDerWaalsContact O-CB 3.28Å; F22-A26 WeakPolarHBondContact O-CB 3.41Å; F22-A26 PolarHBondContact O-N 3.37Å
23	V	97.3	Very high	93.7	Very high	87 Å²	87	93.3 Å²	93.3	53%	0.527	51%	0.508	S	S	.	.	H	α-helix	trans	-63.5	-47.4	176.7	172.3	0	0	0	0	110.8	P19 V20 G25 A26 V27	P19-V23 VanDerWaalsContact O-CG2 3.27Å; P19-V23 WeakPolarHBondContact O-CG2 3.49Å; P19-V23 PolarHBondContact O-N 2.9Å; V20-V23 PolarHBondContact O-N 3.3Å; V23-G25 VanDerWaalsContact C-N 3.32Å; V23-G25 PolarHBondContact O-N 3.11Å; V23-A26 PolarHBondContact O-N 3.02Å; V23-V27 HydrophobicContact CG1-CG2 4.39Å; V23-V27 WeakPolarHBondContact O-CB 3.37Å; V23-V27 VanDerWaalsContact O-CG2 3.27Å; V23-V27 WeakPolarHBondContact O-CG2 3.44Å; V23-V27 PolarHBondContact O-N 3.24Å
24	V	97.1	Very high	93.6	Very high	98 Å²	98	99.5 Å²	99.5	59%	0.594	53%	0.529	S	S	*	.	H	α-helix	trans	-61.1	-42.7	177.6	172.3	0	0	0	0	111	V20 A21 G28	V20-V24 HydrophobicContact CG1-CG2 4.43Å; V20-V24 WeakPolarHBondContact O-CB 3.32Å; V20-V24 VanDerWaalsContact O-CG2 3.27Å; V20-V24 WeakPolarHBondContact O-CG2 3.19Å; V20-V24 PolarHBondContact O-N 3.13Å; A21-V24 PolarHBondContact O-N 3.19Å; V24-G28 PolarHBondContact O-N 3.21Å
25	G	96.8	Very high	93.4	Very high	42 Å²	42	102.1 Å²	102.1	43%	0.433	54%	0.537	S	S	.	.	H	α-helix	trans	-65.4	-43.3	177.2	0	0	0	0	0	112.7	A21 F22 V23 G28 Y29	A21-G25 PolarHBondContact O-N 3.38Å; F22-G25 PolarHBondContact O-N 3.08Å; V23-G25 VanDerWaalsContact C-N 3.32Å; V23-G25 PolarHBondContact O-N 3.11Å; G25-G28 PolarHBondContact O-N 2.97Å; G25-Y29 VanDerWaalsContact O-CB 3.26Å; G25-Y29 WeakPolarHBondContact O-CB 3.19Å; G25-Y29 PolarHBondContact O-N 3.04Å
26	A	96.4	Very high	92.6	Very high	35 Å²	35	98.4 Å²	98.4	29%	0.289	52%	0.522	S	S	.	.	H	α-helix	trans	-64.4	-46.4	176.7	0	0	0	0	0	111.5	F22 V23 G28 Y29 H30	F22-A26 VanDerWaalsContact O-CB 3.28Å; F22-A26 WeakPolarHBondContact O-CB 3.41Å; F22-A26 PolarHBondContact O-N 3.37Å; V23-A26 PolarHBondContact O-N 3.02Å; A26-G28 PolarHBondContact O-N 3.08Å; A26-Y29 PolarHBondContact O-N 2.83Å; A26-H30 PolarHBondContact O-CD2 2.79Å; A26-H30 PolarHBondContact O-N 3.35Å
27	V	96.2	Very high	91.7	Very high	92 Å²	92	95.4 Å²	95.4	56%	0.558	51%	0.51	S	S	*	.	H	α-helix	trans	-61.8	-44.6	175.7	172.5	0	0	0	0	110.7	V23 H30 L31	V23-V27 HydrophobicContact CG1-CG2 4.39Å; V23-V27 WeakPolarHBondContact O-CB 3.37Å; V23-V27 VanDerWaalsContact O-CG2 3.27Å; V23-V27 WeakPolarHBondContact O-CG2 3.44Å; V23-V27 PolarHBondContact O-N 3.24Å; V27-H30 PolarHBondContact O-N 3.05Å; V27-L31 WeakPolarHBondContact O-CB 3.49Å; V27-L31 PolarHBondContact O-N 2.9Å
28	G	95.2	Very high	90.4	Very high	34 Å²	34	100.8 Å²	100.8	35%	0.351	53%	0.526	S	S	.	.	H	α-helix	trans	-61	-44.5	176.5	0	0	0	0	0	112.6	V24 G25 A26 L31 E32	V24-G28 PolarHBondContact O-N 3.21Å; G25-G28 PolarHBondContact O-N 2.97Å; A26-G28 PolarHBondContact O-N 3.08Å; G28-L31 PolarHBondContact O-N 2.63Å; G28-E32 VanDerWaalsContact O-CB 3.31Å; G28-E32 WeakPolarHBondContact O-CB 3.39Å; G28-E32 PolarHBondContact O-N 3.4Å
29	Y	91.1	Very high	88.7	Confident	142 Å²	142	99.8 Å²	99.8	56%	0.557	53%	0.528	S	S	*	.	H	α-helix	trans	-63.1	-43.1	177	179.8	-98.4	0	0	0	112.1	G25 A26 E32 W33	G25-Y29 VanDerWaalsContact O-CB 3.26Å; G25-Y29 WeakPolarHBondContact O-CB 3.19Å; G25-Y29 PolarHBondContact O-N 3.04Å; A26-Y29 PolarHBondContact O-N 2.83Å; Y29-E32 PolarHBondContact O-N 3.18Å; Y29-W33 VanDerWaalsContact O-CB 3.26Å; Y29-W33 WeakPolarHBondContact O-CB 3.47Å; Y29-W33 PolarHBondContact O-N 3.19Å
30	H	91.7	Very high	86.8	Confident	120 Å²	120	101.5 Å²	101.5	56%	0.556	54%	0.539	S	S	*	.	H	α-helix	trans	-67.5	-39.8	176.7	-78.5	-62.2	0	0	0	112.5	A26 V27 W33 F34	A26-H30 PolarHBondContact O-CD2 2.79Å; A26-H30 PolarHBondContact O-N 3.35Å; V27-H30 PolarHBondContact O-N 3.05Å; H30-W33 PolarHBondContact O-N 2.93Å; H30-F34 WeakPolarHBondContact O-CB 2.78Å; H30-F34 PolarHBondContact O-N 2.58Å
31	L	92.5	Very high	84.8	Confident	104 Å²	104	103.6 Å²	103.6	55%	0.545	54%	0.543	S	S	.	.	H	α-helix	trans	-65.8	-44.4	175.8	-173.2	70	0	0	0	111.1	V27 G28 F34 I35	V27-L31 WeakPolarHBondContact O-CB 3.49Å; V27-L31 PolarHBondContact O-N 2.9Å; G28-L31 PolarHBondContact O-N 2.63Å; L31-F34 PolarHBondContact O-N 3.36Å; L31-I35 HydrophobicContact CD1-CD1 4.17Å; L31-I35 HydrophobicContact CD2-CD1 4.42Å; L31-I35 HydrophobicContact CG-CD1 3.84Å; L31-I35 VanDerWaalsContact O-CG1 3.31Å; L31-I35 WeakPolarHBondContact O-CG1 3.24Å; L31-I35 PolarHBondContact O-N 2.79Å
32	E	87.6	Confident	82.6	Confident	93 Å²	93	105.1 Å²	105.1	44%	0.435	55%	0.548	S	S	.	.	H	α-helix	trans	-60.6	-45.9	174.7	-174	-175	169.1	0	0	110.6	G28 Y29 F34 I35 R36	G28-E32 VanDerWaalsContact O-CB 3.31Å; G28-E32 WeakPolarHBondContact O-CB 3.39Å; G28-E32 PolarHBondContact O-N 3.4Å; Y29-E32 PolarHBondContact O-N 3.18Å; E32-F34 VanDerWaalsContact C-N 3.29Å; E32-F34 PolarHBondContact O-N 3.02Å; E32-I35 PolarHBondContact O-N 2.85Å; E32-R36 WeakPolarHBondContact O-CA 3.44Å; E32-R36 WeakPolarHBondContact O-CB 3.5Å; E32-R36 PolarHBondContact O-N 2.59Å; E32-R36 IonicContact OE1-CZ 3.65Å; E32-R36 IonicContact OE1-NE 3.54Å; E32-R36 IonicContact OE1-NH1 3.15Å; E32-R36 PolarHBondContact OE1-NH1 3.23Å; E32-R36 IonicContact OE1-NH2 2.63Å
33	W	86.1	Confident	80.4	Confident	155 Å²	155	104.7 Å²	104.7	59%	0.587	56%	0.556	S	S	*	*	H	α-helix	trans	-61.1	-37.9	177.1	-176.5	77.5	0	0	0	112.4	Y29 H30 G37	Y29-W33 VanDerWaalsContact O-CB 3.26Å; Y29-W33 WeakPolarHBondContact O-CB 3.47Å; Y29-W33 PolarHBondContact O-N 3.19Å; H30-W33 PolarHBondContact O-N 2.93Å; W33-G37 PolarHBondContact O-N 2.81Å
34	F	88	Confident	78.2	Confident	163 Å²	163	106.2 Å²	106.2	72%	0.715	56%	0.557	S	S	*	*	H	α-helix	trans	-69.5	-42.6	177	-168.8	-95.4	0	0	0	112.5	H30 L31 E32	H30-F34 WeakPolarHBondContact O-CB 2.78Å; H30-F34 PolarHBondContact O-N 2.58Å; L31-F34 PolarHBondContact O-N 3.36Å; E32-F34 VanDerWaalsContact C-N 3.29Å; E32-F34 PolarHBondContact O-N 3.02Å
35	I	86.9	Confident	76.3	Confident	129 Å²	129	109.2 Å²	109.2	66%	0.662	56%	0.564	S	S	*	*	H	α-helix	trans	-75.5	-44.3	-179.5	-64.3	167.8	0	0	0	111.6	L31 E32 G37	L31-I35 HydrophobicContact CD1-CD1 4.17Å; L31-I35 HydrophobicContact CD2-CD1 4.42Å; L31-I35 HydrophobicContact CG-CD1 3.84Å; L31-I35 VanDerWaalsContact O-CG1 3.31Å; L31-I35 WeakPolarHBondContact O-CG1 3.24Å; L31-I35 PolarHBondContact O-N 2.79Å; E32-I35 PolarHBondContact O-N 2.85Å; I35-G37 PolarHBondContact O-N 2.97Å
36	R	75.7	Confident	74.4	Confident	99 Å²	99	115.4 Å²	115.4	37%	0.374	58%	0.582	S	S	.	*	H	α-helix	trans	-60.6	-23.3	175.7	-175.2	150.7	66.5	-174.4	8.1	111.1	E32	E32-R36 WeakPolarHBondContact O-CA 3.44Å; E32-R36 WeakPolarHBondContact O-CB 3.5Å; E32-R36 PolarHBondContact O-N 2.59Å; E32-R36 IonicContact OE1-CZ 3.65Å; E32-R36 IonicContact OE1-NE 3.54Å; E32-R36 IonicContact OE1-NH1 3.15Å; E32-R36 PolarHBondContact OE1-NH1 3.23Å; E32-R36 IonicContact OE1-NH2 2.63Å
37	G	72.5	Confident	72.8	Confident	31 Å²	31	117.3 Å²	117.3	32%	0.32	58%	0.584	S	S	.	*	T	Hydrogen-bonded Turn	trans	66.1	-176.9	-179.5	0	0	0	0	0	111.3	W33 I35 D39	W33-G37 PolarHBondContact O-N 2.81Å; I35-G37 PolarHBondContact O-N 2.97Å; G37-D39 PolarHBondContact O-N 2.78Å
38	K	66.4	Low	71.9	Confident	198 Å²	198	114.9 Å²	114.9	86%	0.861	57%	0.571	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.6	19.5	172.2	58.6	161	71	161.7	0	112.9	P40	K38-P40 VanDerWaalsContact C-N 3.34Å; K38-P40 WeakPolarHBondContact O-CD 3.39Å
39	D	58.1	Low	71.2	Confident	123 Å²	123	119 Å²	119	66%	0.658	58%	0.583	S	S	*	*			trans	-79.5	93	159.3	-76.2	-58.2	0	0	0	104.3	G37 Q41	G37-D39 PolarHBondContact O-N 2.78Å; D39-Q41 VanDerWaalsContact C-N 3.35Å; D39-Q41 PolarHBondContact O-N 2.73Å
40	P	56	Low	70.8	Confident	101 Å²	101	115.3 Å²	115.3	66%	0.656	58%	0.579	S	S	*	*			trans	-51.4	121.8	154.9	28.5	-32.3	0	0	0	102.7	K38 P42	K38-P40 VanDerWaalsContact C-N 3.34Å; K38-P40 WeakPolarHBondContact O-CD 3.39Å; P40-P42 VanDerWaalsContact C-N 3.31Å; P40-P42 VanDerWaalsContact O-CD 3.24Å; P40-P42 WeakPolarHBondContact O-CD 3.5Å
41	Q	54.3	Low	70.5	Confident	131 Å²	131	113.7 Å²	113.7	61%	0.612	57%	0.572	S	S	*	*			trans	-40.5	121.2	140.2	-95	179.8	-17.1	0	0	103.3	D39 V43	D39-Q41 VanDerWaalsContact C-N 3.35Å; D39-Q41 PolarHBondContact O-N 2.73Å; Q41-V43 PolarHBondContact O-N 2.87Å
42	P	50.7	Low	70	Confident	94 Å²	94	115 Å²	115	61%	0.61	57%	0.569	S	S	*	*			trans	-60	96.8	170.1	-2.9	14.2	0	0	0	103.1	P40 E44	P40-P42 VanDerWaalsContact C-N 3.31Å; P40-P42 VanDerWaalsContact O-CD 3.24Å; P40-P42 WeakPolarHBondContact O-CD 3.5Å; P42-E44 HydrophobicContact CB-CB 3.83Å; P42-E44 HydrophobicContact CB-CG 3.58Å; P42-E44 PolarHBondContact O-N 2.79Å
43	V	51.9	Low	70	Confident	127 Å²	127	117.6 Å²	117.6	77%	0.77	58%	0.575	S	S	*	*				-60.8	55.6	122.9	-159.6	0	0	0	0	105.2	Q41 E45	Q41-V43 PolarHBondContact O-N 2.87Å; V43-E45 PolarHBondContact O-N 3.32Å
44	E	52	Low	70.1	Confident	120 Å²	120	115.7 Å²	115.7	56%	0.561	57%	0.573	S	S	*	*				-48.1	86.6	125.2	-82.3	-177.1	-170.2	0	0	102	P42 E46	P42-E44 HydrophobicContact CB-CB 3.83Å; P42-E44 HydrophobicContact CB-CG 3.58Å; P42-E44 PolarHBondContact O-N 2.79Å; E44-E46 WeakPolarHBondContact O-CA 3.29Å; E44-E46 PolarHBondContact O-N 2.93Å
45	E	55.4	Low	70.2	Confident	160 Å²	160	110.6 Å²	110.6	75%	0.748	55%	0.553	S	S	*	*				-3.5	97	126.1	-64.4	177.8	168.8	0	0	106	V43 K47	V43-E45 PolarHBondContact O-N 3.32Å; E45-K47 WeakPolarHBondContact O-CA 3.31Å; E45-K47 PolarHBondContact O-N 3.26Å
46	E	57.3	Low	70.2	Confident	172 Å²	172	111.7 Å²	111.7	80%	0.804	55%	0.549	S	S	*	.			trans	-50.1	99.1	-171.1	-65.2	176.5	150.5	0	0	105.3	E44 S48	E44-E46 WeakPolarHBondContact O-CA 3.29Å; E44-E46 PolarHBondContact O-N 2.93Å; E46-S48 PolarHBondContact O-N 2.85Å
47	K	64.2	Low	70.8	Confident	76 Å²	76	113.2 Å²	113.2	33%	0.33	56%	0.558	S	S	.	*			trans	-51.8	118.8	-177.7	-87.1	-171.1	174.1	-179	0	103.2	E45 I49 E51 R52 D55	E45-K47 WeakPolarHBondContact O-CA 3.31Å; E45-K47 PolarHBondContact O-N 3.26Å; K47-I49 PolarHBondContact O-N 2.94Å; K47-E51 WeakPolarHBondContact CA-OE2 3.02Å; K47-E51 HydrophobicContact CB-CB 3.94Å; K47-E51 HydrophobicContact CD-CB 4.45Å; K47-E51 HydrophobicContact CG-CB 4.26Å; K47-R52 HydrophobicContact CB-CG 3.61Å; K47-R52 PolarHBondContact O-NH1 2.95Å; K47-D55 WeakPolarHBondContact CD-OD2 3.41Å; K47-D55 WeakPolarHBondContact CE-OD2 3.26Å; K47-D55 IonicContact NZ-OD1 3.86Å; K47-D55 IonicContact NZ-OD2 3.95Å; K47-D55 PolarHBondContact NZ-OD2 2.75Å
48	S	76.8	Confident	71.5	Confident	40 Å²	40	116.4 Å²	116.4	28%	0.28	57%	0.567	S	S	.	*			trans	-50.3	146.6	-174.8	58.9	0	0	0	0	106.3	E46 S50 E51 R52	E46-S48 PolarHBondContact O-N 2.85Å; S48-S50 VanDerWaalsContact CB-OG 3.29Å; S48-S50 WeakPolarHBondContact CB-OG 3.34Å; S48-S50 CarbonylContact O-C 3.46Å; S48-S50 PolarHBondContact O-N 3.44Å; S48-S50 PolarHBondContact OG-OG 3.38Å; S48-E51 PolarHBondContact O-N 2.82Å; S48-E51 VanDerWaalsContact OG-CD 3.3Å; S48-E51 WeakPolarHBondContact OG-CG 3.31Å; S48-E51 PolarHBondContact OG-N 3.49Å; S48-E51 PolarHBondContact OG-OE1 2.7Å; S48-R52 PolarHBondContact O-N 2.91Å
49	I	79.2	Confident	72.5	Confident	120 Å²	120	112.3 Å²	112.3	62%	0.615	56%	0.555	S	S	*	*	H	α-helix	trans	-51.7	-28.1	-178.7	-63.7	174.2	0	0	0	110.4	K47 R53	K47-I49 PolarHBondContact O-N 2.94Å; I49-R53 WeakPolarHBondContact O-CD 3.27Å; I49-R53 WeakPolarHBondContact O-CG 3.43Å; I49-R53 PolarHBondContact O-N 3.5Å
50	S	83.9	Confident	73.8	Confident	66 Å²	66	111.1 Å²	111.1	46%	0.462	55%	0.545	S	S	.	.	H	α-helix	trans	-58.2	-58.8	165.6	27.6	0	0	0	0	114.4	S48 R52 R53 E54	S48-S50 VanDerWaalsContact CB-OG 3.29Å; S48-S50 WeakPolarHBondContact CB-OG 3.34Å; S48-S50 CarbonylContact O-C 3.46Å; S48-S50 PolarHBondContact O-N 3.44Å; S48-S50 PolarHBondContact OG-OG 3.38Å; S50-R52 VanDerWaalsContact C-N 3.32Å; S50-R52 PolarHBondContact O-N 3.39Å; S50-R53 CarbonylContact O-C 3.4Å; S50-R53 WeakPolarHBondContact O-CA 3.26Å; S50-R53 WeakPolarHBondContact O-CB 3.27Å; S50-R53 PolarHBondContact O-N 3.07Å; S50-E54 PolarHBondContact O-N 2.81Å
51	E	84.2	Confident	74.9	Confident	86 Å²	86	110.3 Å²	110.3	40%	0.402	54%	0.535	S	S	.	.	H	α-helix	trans	-56.3	-44.4	179	-79	156.7	-123	0	0	111.9	K47 S48 R53 E54 D55	K47-E51 WeakPolarHBondContact CA-OE2 3.02Å; K47-E51 HydrophobicContact CB-CB 3.94Å; K47-E51 HydrophobicContact CD-CB 4.45Å; K47-E51 HydrophobicContact CG-CB 4.26Å; S48-E51 PolarHBondContact O-N 2.82Å; S48-E51 VanDerWaalsContact OG-CD 3.3Å; S48-E51 WeakPolarHBondContact OG-CG 3.31Å; S48-E51 PolarHBondContact OG-N 3.49Å; S48-E51 PolarHBondContact OG-OE1 2.7Å; E51-R53 PolarHBondContact O-N 3.36Å; E51-E54 PolarHBondContact O-N 3.36Å; E51-D55 PolarHBondContact O-N 2.85Å
52	R	83.1	Confident	76.1	Confident	130 Å²	130	111 Å²	111	49%	0.491	54%	0.542	S	S	.	.	H	α-helix	trans	-60.4	-33.4	175.6	-72	-168.4	177.3	120.3	-7.9	112.9	K47 S48 S50 R56	K47-R52 HydrophobicContact CB-CG 3.61Å; K47-R52 PolarHBondContact O-NH1 2.95Å; S48-R52 PolarHBondContact O-N 2.91Å; S50-R52 VanDerWaalsContact C-N 3.32Å; S50-R52 PolarHBondContact O-N 3.39Å; R52-R56 PolarHBondContact O-N 3.34Å
53	R	88.3	Confident	77.3	Confident	148 Å²	148	109.9 Å²	109.9	56%	0.558	55%	0.548	S	S	*	.	H	α-helix	trans	-74.3	-34.8	175.5	-74.6	171.6	-172.6	-136.7	5.2	111.7	I49 S50 E51 K57	I49-R53 WeakPolarHBondContact O-CD 3.27Å; I49-R53 WeakPolarHBondContact O-CG 3.43Å; I49-R53 PolarHBondContact O-N 3.5Å; S50-R53 CarbonylContact O-C 3.4Å; S50-R53 WeakPolarHBondContact O-CA 3.26Å; S50-R53 WeakPolarHBondContact O-CB 3.27Å; S50-R53 PolarHBondContact O-N 3.07Å; E51-R53 PolarHBondContact O-N 3.36Å; R53-K57 WeakPolarHBondContact O-CG 3.26Å; R53-K57 PolarHBondContact O-N 3.44Å
54	E	88.2	Confident	78.3	Confident	116 Å²	116	109.5 Å²	109.5	54%	0.542	54%	0.536	S	S	.	.	H	α-helix	trans	-68.4	-45.5	175.9	-71.1	-178.9	178.9	0	0	110.8	S50 E51 R56 K57 L58	S50-E54 PolarHBondContact O-N 2.81Å; E51-E54 PolarHBondContact O-N 3.36Å; E54-R56 VanDerWaalsContact C-N 3.32Å; E54-R56 PolarHBondContact O-N 2.82Å; E54-K57 CarbonylContact O-C 3.59Å; E54-K57 WeakPolarHBondContact O-CA 3.28Å; E54-K57 WeakPolarHBondContact O-CB 3.27Å; E54-K57 PolarHBondContact O-N 3.4Å; E54-K57 VanDerWaalsContact O-N 3.08Å; E54-L58 WeakPolarHBondContact O-CG 3.12Å; E54-L58 PolarHBondContact O-N 2.8Å
55	D	88.7	Confident	79.3	Confident	55 Å²	55	109.8 Å²	109.8	29%	0.294	54%	0.541	S	S	.	.	H	α-helix	trans	-55.8	-47.4	173	-69.7	-30.7	0	0	0	111.4	K47 E51 K57 L58 D59	K47-D55 WeakPolarHBondContact CD-OD2 3.41Å; K47-D55 WeakPolarHBondContact CE-OD2 3.26Å; K47-D55 IonicContact NZ-OD1 3.86Å; K47-D55 IonicContact NZ-OD2 3.95Å; K47-D55 PolarHBondContact NZ-OD2 2.75Å; E51-D55 PolarHBondContact O-N 2.85Å; D55-K57 VanDerWaalsContact C-N 3.31Å; D55-K57 PolarHBondContact O-N 3.4Å; D55-L58 WeakPolarHBondContact O-CB 3.49Å; D55-L58 PolarHBondContact O-N 2.9Å; D55-L58 VanDerWaalsContact O-N 3.08Å; D55-D59 PolarHBondContact O-N 3.48Å
56	R	88.1	Confident	79.7	Confident	152 Å²	152	107.3 Å²	107.3	57%	0.574	53%	0.529	S	S	*	.	H	α-helix	trans	-61.9	-39.7	177.1	-170.5	178.6	68.6	-163.1	-0.4	112.1	R52 E54 L58 E60	R52-R56 PolarHBondContact O-N 3.34Å; E54-R56 VanDerWaalsContact C-N 3.32Å; E54-R56 PolarHBondContact O-N 2.82Å; R56-L58 VanDerWaalsContact C-N 3.34Å; R56-E60 IonicContact NE-OE1 2.7Å; R56-E60 WeakPolarHBondContact O-CB 3.19Å; R56-E60 VanDerWaalsContact O-CG 3.3Å; R56-E60 WeakPolarHBondContact O-CG 3.03Å; R56-E60 PolarHBondContact O-N 2.96Å
57	K	88.2	Confident	80.2	Confident	131 Å²	131	105 Å²	105	57%	0.57	53%	0.527	S	S	*	.	H	α-helix	trans	-63.9	-41.8	173.9	-76.6	174.9	-177.6	178.2	0	110.7	R53 E54 D55 E60 L61	R53-K57 WeakPolarHBondContact O-CG 3.26Å; R53-K57 PolarHBondContact O-N 3.44Å; E54-K57 CarbonylContact O-C 3.59Å; E54-K57 WeakPolarHBondContact O-CA 3.28Å; E54-K57 WeakPolarHBondContact O-CB 3.27Å; E54-K57 PolarHBondContact O-N 3.4Å; E54-K57 VanDerWaalsContact O-N 3.08Å; D55-K57 VanDerWaalsContact C-N 3.31Å; D55-K57 PolarHBondContact O-N 3.4Å; K57-E60 PolarHBondContact O-N 3.46Å; K57-L61 WeakPolarHBondContact O-CB 3.2Å; K57-L61 WeakPolarHBondContact O-CG 3.14Å; K57-L61 PolarHBondContact O-N 2.81Å
58	L	87.4	Confident	80.3	Confident	99 Å²	99	109.3 Å²	109.3	52%	0.518	55%	0.549	S	S	.	.	H	α-helix	trans	-63.4	-43.8	178.6	-71.6	170.8	0	0	0	111.5	E54 D55 R56 E60 L61 L62	E54-L58 WeakPolarHBondContact O-CG 3.12Å; E54-L58 PolarHBondContact O-N 2.8Å; D55-L58 WeakPolarHBondContact O-CB 3.49Å; D55-L58 PolarHBondContact O-N 2.9Å; D55-L58 VanDerWaalsContact O-N 3.08Å; R56-L58 VanDerWaalsContact C-N 3.34Å; L58-E60 VanDerWaalsContact C-N 3.34Å; L58-E60 PolarHBondContact O-N 3.41Å; L58-L61 HydrophobicContact CD2-CD1 4.49Å; L58-L61 CarbonylContact O-C 3.55Å; L58-L61 PolarHBondContact O-N 2.79Å; L58-L61 VanDerWaalsContact O-N 3.12Å; L58-L62 WeakPolarHBondContact O-CG 3.35Å; L58-L62 PolarHBondContact O-N 3.31Å
59	D	86.9	Confident	79.8	Confident	111 Å²	111	112.9 Å²	112.9	59%	0.594	57%	0.568	S	S	*	*	H	α-helix	trans	-59.5	-44.7	173.4	-74.2	-17.8	0	0	0	111.7	D55 L61 L62 G63	D55-D59 PolarHBondContact O-N 3.48Å; D59-L61 VanDerWaalsContact C-N 3.26Å; D59-L61 PolarHBondContact O-N 2.92Å; D59-L62 PolarHBondContact O-N 3.33Å; D59-G63 PolarHBondContact O-N 3.46Å
60	E	84.1	Confident	79.1	Confident	99 Å²	99	111.6 Å²	111.6	46%	0.463	57%	0.566	S	S	.	*	H	α-helix	trans	-64.1	-29.5	175.6	-74.2	176.7	-151.6	0	0	113.2	R56 K57 L58 K64	R56-E60 IonicContact NE-OE1 2.7Å; R56-E60 WeakPolarHBondContact O-CB 3.19Å; R56-E60 VanDerWaalsContact O-CG 3.3Å; R56-E60 WeakPolarHBondContact O-CG 3.03Å; R56-E60 PolarHBondContact O-N 2.96Å; K57-E60 PolarHBondContact O-N 3.46Å; L58-E60 VanDerWaalsContact C-N 3.34Å; L58-E60 PolarHBondContact O-N 3.41Å; E60-K64 WeakPolarHBondContact O-CD 3.49Å; E60-K64 WeakPolarHBondContact O-CG 3.41Å
61	L	80.9	Confident	78.4	Confident	83 Å²	83	111.1 Å²	111.1	44%	0.435	56%	0.563	S	S	.	*	H	α-helix	trans	-80.1	-39	176.5	-67.7	166.9	0	0	0	111.3	K57 L58 D59 G63 K64 H66	K57-L61 WeakPolarHBondContact O-CB 3.2Å; K57-L61 WeakPolarHBondContact O-CG 3.14Å; K57-L61 PolarHBondContact O-N 2.81Å; L58-L61 HydrophobicContact CD2-CD1 4.49Å; L58-L61 CarbonylContact O-C 3.55Å; L58-L61 PolarHBondContact O-N 2.79Å; L58-L61 VanDerWaalsContact O-N 3.12Å; D59-L61 VanDerWaalsContact C-N 3.26Å; D59-L61 PolarHBondContact O-N 2.92Å; L61-G63 PolarHBondContact O-N 3.37Å; L61-K64 PolarHBondContact O-N 3.38Å; L61-H66 WeakPolarHBondContact CD2-NE2 2.99Å
62	L	79.2	Confident	77.4	Confident	146 Å²	146	114.3 Å²	114.3	76%	0.764	58%	0.581	S	S	*	*	H	α-helix	trans	-59.1	-33.5	175.2	-78.4	166.6	0	0	0	111.9	L58 D59 K64	L58-L62 WeakPolarHBondContact O-CG 3.35Å; L58-L62 PolarHBondContact O-N 3.31Å; D59-L62 PolarHBondContact O-N 3.33Å; L62-K64 VanDerWaalsContact C-N 3.31Å
63	G	75.8	Confident	76.4	Confident	71 Å²	71	116.6 Å²	116.6	73%	0.732	60%	0.595	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.7	-6.7	174.6	0	0	0	0	0	115.3	D59 L61	D59-G63 PolarHBondContact O-N 3.46Å; L61-G63 PolarHBondContact O-N 3.37Å
64	K	73.2	Confident	75.2	Confident	118 Å²	118	113.9 Å²	113.9	51%	0.513	59%	0.591	S	S	.	*	S	Bend	trans	-115.9	111.5	-177	-72.6	171.8	-171.7	158.9	0	110.1	E60 L61 L62 H66	E60-K64 WeakPolarHBondContact O-CD 3.49Å; E60-K64 WeakPolarHBondContact O-CG 3.41Å; L61-K64 PolarHBondContact O-N 3.38Å; L62-K64 VanDerWaalsContact C-N 3.31Å; K64-H66 PolarHBondContact O-CD2 2.76Å; K64-H66 VanDerWaalsContact O-CD2 3.28Å; K64-H66 PolarHBondContact O-N 2.97Å
65	D	71.5	Confident	73.8	Confident	126 Å²	126	115.1 Å²	115.1	67%	0.674	60%	0.595	S	S	*	*			trans	-64.7	96.1	169.7	-80	-29.2	0	0	0	110.5	T67	D65-T67 PolarHBondContact O-N 3.06Å
66	H	64.3	Low	72.3	Confident	109 Å²	109	119.1 Å²	119.1	51%	0.505	62%	0.616	S	S	.	*	T	Hydrogen-bonded Turn	trans	-72.9	2.4	175.8	-62.8	-58.8	0	0	0	113.8	L61 K64 Q68 V69	L61-H66 WeakPolarHBondContact CD2-NE2 2.99Å; K64-H66 PolarHBondContact O-CD2 2.76Å; K64-H66 VanDerWaalsContact O-CD2 3.28Å; K64-H66 PolarHBondContact O-N 2.97Å; H66-Q68 VanDerWaalsContact C-N 3.32Å; H66-V69 WeakPolarHBondContact O-CG2 3.48Å
67	T	68	Low	71	Confident	124 Å²	124	120 Å²	120	76%	0.761	63%	0.626	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.6	-18.9	176	55.2	0	0	0	0	112.3	D65 V69	D65-T67 PolarHBondContact O-N 3.06Å; T67-V69 PolarHBondContact O-N 3.23Å; T67-V69 VanDerWaalsContact O-N 3.15Å
68	Q	67	Low	69.4	Low	166 Å²	166	122.2 Å²	122.2	78%	0.776	64%	0.636	S	S	*	*			trans	-89.2	51	176.9	-61.5	-170.3	9.8	0	0	112.2	H66	H66-Q68 VanDerWaalsContact C-N 3.32Å
69	V	66.5	Low	68.3	Low	115 Å²	115	120.1 Å²	120.1	70%	0.697	63%	0.633	S	S	*	*	P	Polyproline II helix	trans	-81.5	120.7	169.8	-140.2	0	0	0	0	108.3	H66 T67 S71	H66-V69 WeakPolarHBondContact O-CG2 3.48Å; T67-V69 PolarHBondContact O-N 3.23Å; T67-V69 VanDerWaalsContact O-N 3.15Å; V69-S71 PolarHBondContact O-N 2.9Å
70	V	64.6	Low	67	Low	93 Å²	93	120.4 Å²	120.4	56%	0.564	64%	0.641	S	S	*	*	P	Polyproline II helix	trans	-55.7	132.5	169.9	178.7	0	0	0	0	108.4	L72 D74	V70-L72 PolarHBondContact O-N 3.04Å; V70-D74 HydrophobicContact CG1-CB 3.9Å
71	S	67.8	Low	66.1	Low	56 Å²	56	124.8 Å²	124.8	39%	0.392	66%	0.659	S	S	.	*	P	Polyproline II helix	trans	-56.9	138.2	-173.5	96.1	0	0	0	0	110	V69 K73 D74	V69-S71 PolarHBondContact O-N 2.9Å; S71-K73 PolarHBondContact O-N 3.26Å; S71-K73 PolarHBondContact OG-N 3.35Å; S71-D74 WeakPolarHBondContact CB-OD2 3.43Å; S71-D74 PolarHBondContact O-N 2.97Å; S71-D74 PolarHBondContact OG-OD2 3.35Å
72	L	63.8	Low	65.6	Low	152 Å²	152	123.7 Å²	123.7	80%	0.796	66%	0.662	S	S	*	*	H	α-helix	trans	-58.6	-19.3	179.3	-81.8	103.3	0	0	0	113	V70 L76	V70-L72 PolarHBondContact O-N 3.04Å; L72-L76 PolarHBondContact O-N 3.18Å
73	K	62.3	Low	65	Low	178 Å²	178	121.4 Å²	121.4	77%	0.774	65%	0.654	S	S	*	*	H	α-helix	trans	-65.4	-40.9	175.5	-66.7	-172.2	178	-175	0	111.3	S71 K75 L76	S71-K73 PolarHBondContact O-N 3.26Å; S71-K73 PolarHBondContact OG-N 3.35Å; K73-K75 VanDerWaalsContact C-N 3.31Å; K73-K75 PolarHBondContact O-N 2.74Å; K73-L76 WeakPolarHBondContact O-CB 3.26Å; K73-L76 PolarHBondContact O-N 2.91Å; K73-L76 VanDerWaalsContact O-N 3.15Å
74	D	62.5	Low	64.6	Low	91 Å²	91	124.1 Å²	124.1	49%	0.487	65%	0.651	S	S	.	*	H	α-helix	trans	-70.8	-30	-177.8	-50.8	-44.8	0	0	0	111.6	V70 S71	V70-D74 HydrophobicContact CG1-CB 3.9Å; S71-D74 WeakPolarHBondContact CB-OD2 3.43Å; S71-D74 PolarHBondContact O-N 2.97Å; S71-D74 PolarHBondContact OG-OD2 3.35Å
75	K	58.8	Low	64.2	Low	143 Å²	143	121.6 Å²	121.6	62%	0.622	64%	0.643	S	S	*	*	H	α-helix	trans	-74.8	-19.5	173.2	-87.2	-179.5	-175.9	-84.4	0	113.7	K73 E77 F78 A79	K73-K75 VanDerWaalsContact C-N 3.31Å; K73-K75 PolarHBondContact O-N 2.74Å; K75-E77 PolarHBondContact O-N 3.23Å; K75-F78 CarbonylContact O-C 3.59Å; K75-F78 PolarHBondContact O-N 2.92Å; K75-A79 WeakPolarHBondContact O-CA 3.35Å; K75-A79 VanDerWaalsContact O-CB 3.31Å; K75-A79 WeakPolarHBondContact O-CB 3.47Å; K75-A79 PolarHBondContact O-N 2.92Å
76	L	57.8	Low	64.2	Low	139 Å²	139	124.9 Å²	124.9	73%	0.728	65%	0.646	S	S	*	*	H	α-helix	trans	-66.1	-31.6	-177.6	-151.9	81	0	0	0	111.6	L72 K73 F78	L72-L76 PolarHBondContact O-N 3.18Å; K73-L76 WeakPolarHBondContact O-CB 3.26Å; K73-L76 PolarHBondContact O-N 2.91Å; K73-L76 VanDerWaalsContact O-N 3.15Å; L76-F78 VanDerWaalsContact C-N 3.28Å; L76-F78 PolarHBondContact O-N 2.86Å
77	E	59.5	Low	64.6	Low	169 Å²	169	126.2 Å²	126.2	79%	0.79	66%	0.656	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.4	-30.6	176.3	-62.8	-170	169.4	0	0	112.5	K75	K75-E77 PolarHBondContact O-N 3.23Å
78	F	56.5	Low	64.8	Low	179 Å²	179	127.7 Å²	127.7	79%	0.785	65%	0.648	S	S	*	*	T	Hydrogen-bonded Turn	trans	-109.4	3.4	-179.1	-73.3	-83.4	0	0	0	114	K75 L76 P80	K75-F78 CarbonylContact O-C 3.59Å; K75-F78 PolarHBondContact O-N 2.92Å; L76-F78 VanDerWaalsContact C-N 3.28Å; L76-F78 PolarHBondContact O-N 2.86Å; F78-P80 WeakPolarHBondContact O-CD 3.29Å
79	A	62.4	Low	64.9	Low	54 Å²	54	125.1 Å²	125.1	45%	0.446	65%	0.646	S	S	.	*			trans	-70.2	117.9	179.7	0	0	0	0	0	108.5	K75 K81	K75-A79 WeakPolarHBondContact O-CA 3.35Å; K75-A79 VanDerWaalsContact O-CB 3.31Å; K75-A79 WeakPolarHBondContact O-CB 3.47Å; K75-A79 PolarHBondContact O-N 2.92Å; A79-K81 PolarHBondContact O-N 3.27Å
80	P	60	Low	65.1	Low	118 Å²	118	128.2 Å²	128.2	77%	0.766	65%	0.653	S	S	*	*			trans	-56.4	135.5	175	23.3	-31.7	0	0	0	108.2	F78 A82	F78-P80 WeakPolarHBondContact O-CD 3.29Å; P80-A82 PolarHBondContact O-N 3.48Å
81	K	65.8	Low	65.1	Low	191 Å²	191	133.6 Å²	133.6	83%	0.83	67%	0.669	S	S	*	*			trans	-41.4	109.9	-178.7	-76.8	-177.4	177.1	-178.5	0	108.8	A79 V83	A79-K81 PolarHBondContact O-N 3.27Å; K81-V83 PolarHBondContact O-N 3.42Å
82	A	69.6	Low	64	Low	60 Å²	60	142.1 Å²	142.1	50%	0.496	71%	0.71	S	S	.	*			trans	-52.4	140.1	178.5	0	0	0	0	0	108.3	P80 L84 N85	P80-A82 PolarHBondContact O-N 3.48Å; A82-L84 PolarHBondContact O-N 3.32Å; A82-N85 WeakPolarHBondContact O-CB 3.31Å; A82-N85 PolarHBondContact O-N 3.14Å
83	V	68.1	Low	64	Low	98 Å²	98	141.6 Å²	141.6	59%	0.594	71%	0.705	S	S	*	*	G	3₁₀ helix	trans	-53.3	-23.9	-179.9	178.4	0	0	0	0	111.5	K81 N85 R86	K81-V83 PolarHBondContact O-N 3.42Å; V83-N85 VanDerWaalsContact C-N 3.34Å; V83-N85 PolarHBondContact O-N 3.29Å; V83-R86 WeakPolarHBondContact O-CD 3.39Å; V83-R86 WeakPolarHBondContact O-CG 3.46Å; V83-R86 PolarHBondContact O-NE 2.89Å; V83-R86 VanDerWaalsContact O-NE 3.1Å
84	L	66.6	Low	64.1	Low	128 Å²	128	139.7 Å²	139.7	67%	0.67	70%	0.702	S	S	*	*	G	3₁₀ helix	trans	-68.1	-24.1	174	-167.7	65.3	0	0	0	114.7	A82 R86	A82-L84 PolarHBondContact O-N 3.32Å; L84-R86 PolarHBondContact O-N 3.33Å
85	N	65.8	Low	64.2	Low	65 Å²	65	142.4 Å²	142.4	35%	0.348	71%	0.714	S	S	.	*	G	3₁₀ helix	trans	-69	-17.6	179.4	-98.3	-27.8	0	0	0	113.6	A82 V83 N87 R88	A82-N85 WeakPolarHBondContact O-CB 3.31Å; A82-N85 PolarHBondContact O-N 3.14Å; V83-N85 VanDerWaalsContact C-N 3.34Å; V83-N85 PolarHBondContact O-N 3.29Å; N85-N87 PolarHBondContact O-N 3Å; N85-N87 VanDerWaalsContact O-N 3.11Å; N85-R88 PolarHBondContact O-N 3.32Å; N85-R88 VanDerWaalsContact O-N 3.13Å; N85-R88 WeakPolarHBondContact OD1-CD 3.31Å; N85-R88 PolarHBondContact OD1-NH1 2.73Å
86	R	70	Confident	64.5	Low	195 Å²	195	142.4 Å²	142.4	74%	0.736	72%	0.719	S	S	*	*	G	3₁₀ helix	trans	-60.7	-20.3	179.3	71.3	-164.2	165.6	175.8	-4.6	114.2	V83 L84	V83-R86 WeakPolarHBondContact O-CD 3.39Å; V83-R86 WeakPolarHBondContact O-CG 3.46Å; V83-R86 PolarHBondContact O-NE 2.89Å; V83-R86 VanDerWaalsContact O-NE 3.1Å; L84-R86 PolarHBondContact O-N 3.33Å
87	N	74.2	Confident	65	Low	136 Å²	136	142.6 Å²	142.6	73%	0.727	72%	0.718	S	S	*	*	G	3₁₀ helix	trans	-100.7	2.2	-179.3	-73.9	5	0	0	0	113.5	N85	N85-N87 PolarHBondContact O-N 3Å; N85-N87 VanDerWaalsContact O-N 3.11Å
88	R	72	Confident	65.3	Low	155 Å²	155	140.8 Å²	140.8	59%	0.585	71%	0.714	S	S	*	*	S	Bend	trans	-82.9	125.4	175.8	-74	-168.3	171	107	0	108.5	N85 E90	N85-R88 PolarHBondContact O-N 3.32Å; N85-R88 VanDerWaalsContact O-N 3.13Å; N85-R88 WeakPolarHBondContact OD1-CD 3.31Å; N85-R88 PolarHBondContact OD1-NH1 2.73Å; R88-E90 PolarHBondContact O-N 3.31Å
89	P	68.9	Low	66	Low	113 Å²	113	138.1 Å²	138.1	73%	0.734	71%	0.709	S	S	*	*	P	Polyproline II helix	trans	-61.3	129.7	174.7	25.4	-32.1	0	0	0	108.9	K91	P89-K91 PolarHBondContact O-N 3.27Å; P89-K91 VanDerWaalsContact O-N 3.12Å
90	E	69.5	Low	66.2	Low	179 Å²	179	144.5 Å²	144.5	84%	0.836	73%	0.729	S	S	*	*	P	Polyproline II helix	trans	-56	118.3	170.4	17.6	-76.9	146.8	0	0	108.5	R88 N92	R88-E90 PolarHBondContact O-N 3.31Å; E90-N92 PolarHBondContact O-N 3.18Å
91	K	65.2	Low	66.7	Low	207 Å²	207	146.8 Å²	146.8	90%	0.9	73%	0.726	S	S	*	*	P	Polyproline II helix	trans	-76.5	116.1	174.5	-161.3	179.1	-178.2	-174.1	0	106.9	P89	P89-K91 PolarHBondContact O-N 3.27Å; P89-K91 VanDerWaalsContact O-N 3.12Å
92	N	45.2	Very low	66.8	Low	234 Å²	234	142.7 Å²	142.7	100%	1.251	72%	0.716	S	S	*	*			trans	-46.5	0	172.2	-73.3	-33.9	0	0	0	112.5	E90	E90-N92 PolarHBondContact O-N 3.18Å

Retrieved 92 of 92 residues in 143.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).