G4LUT0_SCHMA Loading...

SSXT domain-containing protein

AlphaFold DB , UniProt , Accession G4LUT0, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 81 aa.

						>G4LUT0_SCHMA|G4LUT0
MSGAFAQNSSRYVIAHEATSAKRLLDENEHIIELVADLARKGRFRESVQLQAVLQRNLVYLVSLVDQNNLDSKQTVDTDTC
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	46	Very low	51.1	Low	244 Å²	244	138.6 Å²	138.6	100%	1.202	80%	0.802	S	S	*	*				0	98.5	0	-63.9	-165.2	-165.9	0	0	107.1	G3	M1-G3 PolarHBondContact O-N 2.75Å
2	S	47	Very low	50.9	Low	128 Å²	128	142.7 Å²	142.7	90%	0.895	80%	0.797	S	S	*	*			trans	-85.2	101.5	-175	-64	0	0	0	0	110.1	A4	S2-A4 PolarHBondContact O-N 2.64Å
3	G	50.4	Low	51.3	Low	71 Å²	71	137.8 Å²	137.8	73%	0.732	77%	0.773	S	S	*	*			trans	-89	87.1	168.1	0	0	0	0	0	109.9	M1 F5	M1-G3 PolarHBondContact O-N 2.75Å; G3-F5 PolarHBondContact O-N 3.14Å
4	A	54.9	Low	51.8	Low	99 Å²	99	133.4 Å²	133.4	82%	0.818	75%	0.745	S	S	*	*			trans	-83	82.6	168.2	0	0	0	0	0	109.1	S2	S2-A4 PolarHBondContact O-N 2.64Å
5	F	47.8	Very low	52.2	Low	210 Å²	210	128.3 Å²	128.3	92%	0.921	73%	0.726	S	S	*	*			trans	-105.7	77.3	167.6	-91	-84.9	0	0	0	109	G3	G3-F5 PolarHBondContact O-N 3.14Å
6	A	54.4	Low	52.7	Low	91 Å²	91	127.9 Å²	127.9	75%	0.752	72%	0.717	S	S	*	*			trans	-151.8	63.3	173.5	0	0	0	0	0	110.8
7	Q	55.1	Low	53.3	Low	178 Å²	178	122.7 Å²	122.7	83%	0.832	69%	0.685	S	S	*	*	S	Bend	trans	-156.1	1.3	170.8	-120.5	162.1	0	0	0	118.1
8	N	50.3	Low	54.1	Low	135 Å²	135	119.2 Å²	119.2	72%	0.722	67%	0.674	S	S	*	*	S	Bend	trans	-97.9	-20.7	-175.3	-154.9	42.9	0	0	0	115.6
9	S	53.4	Low	55	Low	99 Å²	99	117.3 Å²	117.3	69%	0.692	67%	0.666	S	S	*	*	H	α-helix	trans	-73.7	-37	-177.7	-51.6	0	0	0	0	112.7	Y12 V13	S9-Y12 PolarHBondContact O-N 3.32Å; S9-V13 WeakPolarHBondContact O-CG2 3.44Å; S9-V13 PolarHBondContact O-N 3.03Å
10	S	52.1	Low	56.3	Low	75 Å²	75	113.4 Å²	113.4	52%	0.524	65%	0.646	S	S	.	*	H	α-helix	trans	-66.8	-42.2	-174.5	-178.2	0	0	0	0	112.4	Y12 V13 I14	S10-Y12 VanDerWaalsContact C-N 3.34Å; S10-Y12 PolarHBondContact O-N 2.84Å; S10-V13 PolarHBondContact O-N 3.4Å; S10-I14 WeakPolarHBondContact O-CD1 3.36Å; S10-I14 WeakPolarHBondContact O-CG1 3.3Å; S10-I14 PolarHBondContact O-N 3.08Å
11	R	50.4	Low	57.7	Low	195 Å²	195	108.9 Å²	108.9	74%	0.736	62%	0.623	S	S	*	*	H	α-helix	trans	-66	-31.8	178.6	-85.2	-156.6	-87.3	179	-9.1	114.1	A15	R11-A15 WeakPolarHBondContact O-CB 3.29Å; R11-A15 PolarHBondContact O-N 3.09Å
12	Y	49.2	Very low	59.6	Low	187 Å²	187	103.8 Å²	103.8	73%	0.733	59%	0.594	S	S	*	*	H	α-helix	trans	-73.4	-38.7	178.4	-161.2	-91	0	0	0	111.7	S9 S10 H16	S9-Y12 PolarHBondContact O-N 3.32Å; S10-Y12 VanDerWaalsContact C-N 3.34Å; S10-Y12 PolarHBondContact O-N 2.84Å; Y12-H16 WeakPolarHBondContact O-CB 3.45Å; Y12-H16 PolarHBondContact O-N 3.44Å
13	V	55.4	Low	61.6	Low	80 Å²	80	106.5 Å²	106.5	49%	0.485	59%	0.585	S	S	.	*	H	α-helix	trans	-65.2	-46.7	175.9	176.9	0	0	0	0	110.6	S9 S10 A15 H16 E17	S9-V13 WeakPolarHBondContact O-CG2 3.44Å; S9-V13 PolarHBondContact O-N 3.03Å; S10-V13 PolarHBondContact O-N 3.4Å; V13-A15 VanDerWaalsContact C-N 3.33Å; V13-A15 PolarHBondContact O-N 3.04Å; V13-H16 PolarHBondContact O-N 2.65Å; V13-E17 HydrophobicContact CG1-CG 4.48Å; V13-E17 WeakPolarHBondContact O-CB 3.39Å; V13-E17 PolarHBondContact O-N 2.8Å
14	I	58.3	Low	63.4	Low	76 Å²	76	104.8 Å²	104.8	39%	0.39	56%	0.558	S	S	.	*	H	α-helix	trans	-62	-39.7	179.3	-62.3	162.8	0	0	0	111.5	S10 E17 A18	S10-I14 WeakPolarHBondContact O-CD1 3.36Å; S10-I14 WeakPolarHBondContact O-CG1 3.3Å; S10-I14 PolarHBondContact O-N 3.08Å; I14-E17 PolarHBondContact O-N 3.41Å; I14-A18 VanDerWaalsContact O-CB 3.31Å; I14-A18 WeakPolarHBondContact O-CB 3.32Å; I14-A18 PolarHBondContact O-N 3.43Å
15	A	58.2	Low	65.1	Low	56 Å²	56	104.6 Å²	104.6	46%	0.463	54%	0.543	S	S	.	.	H	α-helix	trans	-68.8	-39.3	177.4	0	0	0	0	0	112.7	R11 V13 T19	R11-A15 WeakPolarHBondContact O-CB 3.29Å; R11-A15 PolarHBondContact O-N 3.09Å; V13-A15 VanDerWaalsContact C-N 3.33Å; V13-A15 PolarHBondContact O-N 3.04Å; A15-T19 PolarHBondContact O-N 2.68Å; A15-T19 VanDerWaalsContact O-N 3.1Å; A15-T19 PolarHBondContact O-OG1 3.38Å
16	H	59.9	Low	67.2	Low	123 Å²	123	98.3 Å²	98.3	57%	0.569	52%	0.519	S	S	*	.	H	α-helix	trans	-67.1	-39.7	175.2	-174.8	-86.9	0	0	0	111.5	Y12 V13 T19 S20	Y12-H16 WeakPolarHBondContact O-CB 3.45Å; Y12-H16 PolarHBondContact O-N 3.44Å; V13-H16 PolarHBondContact O-N 2.65Å; H16-T19 PolarHBondContact O-N 3.02Å; H16-S20 PolarHBondContact O-N 3.26Å; H16-S20 PolarHBondContact O-OG 2.87Å
17	E	63.7	Low	68.9	Low	39 Å²	39	98.7 Å²	98.7	18%	0.182	51%	0.505	C	S	.	.	H	α-helix	trans	-65.2	-45	173.9	-85.2	-174.1	154.4	0	0	112.2	V13 I14 T19 S20 A21 L64 N68	V13-E17 HydrophobicContact CG1-CG 4.48Å; V13-E17 WeakPolarHBondContact O-CB 3.39Å; V13-E17 PolarHBondContact O-N 2.8Å; I14-E17 PolarHBondContact O-N 3.41Å; E17-T19 VanDerWaalsContact C-N 3.27Å; E17-T19 PolarHBondContact O-N 3.45Å; E17-S20 CarbonylContact O-C 3.57Å; E17-S20 WeakPolarHBondContact O-CB 3.2Å; E17-S20 PolarHBondContact O-N 2.94Å; E17-S20 VanDerWaalsContact O-N 3.08Å; E17-A21 WeakPolarHBondContact O-CB 3.23Å; E17-A21 PolarHBondContact O-N 3.31Å; E17-L64 HydrophobicContact CB-CD2 4.04Å; E17-L64 HydrophobicContact CG-CD1 3.95Å; E17-L64 HydrophobicContact CG-CD2 4.29Å; E17-L64 HydrophobicContact CG-CG 4.37Å; E17-L64 WeakPolarHBondContact OE1-CD1 3.48Å; E17-N68 PolarHBondContact OE2-ND2 3.05Å; E17-N68 VanDerWaalsContact OE2-ND2 3.13Å
18	A	66.9	Low	70.6	Confident	59 Å²	59	90.5 Å²	90.5	49%	0.488	47%	0.467	S	S	.	.	H	α-helix	trans	-60.6	-37.8	176.5	0	0	0	0	0	112.1	I14 S20 A21 K22	I14-A18 VanDerWaalsContact O-CB 3.31Å; I14-A18 WeakPolarHBondContact O-CB 3.32Å; I14-A18 PolarHBondContact O-N 3.43Å; A18-S20 VanDerWaalsContact C-N 3.34Å; A18-A21 PolarHBondContact O-N 3.46Å; A18-K22 WeakPolarHBondContact O-CB 3.4Å; A18-K22 PolarHBondContact O-N 3.49Å
19	T	72	Confident	72.6	Confident	84 Å²	84	89.8 Å²	89.8	52%	0.515	46%	0.459	S	S	.	.	H	α-helix	trans	-66.3	-38.5	175.4	-51.1	0	0	0	0	111.4	A15 H16 E17 R23	A15-T19 PolarHBondContact O-N 2.68Å; A15-T19 VanDerWaalsContact O-N 3.1Å; A15-T19 PolarHBondContact O-OG1 3.38Å; H16-T19 PolarHBondContact O-N 3.02Å; E17-T19 VanDerWaalsContact C-N 3.27Å; E17-T19 PolarHBondContact O-N 3.45Å; T19-R23 PolarHBondContact O-N 2.91Å
20	S	80.6	Confident	74.5	Confident	39 Å²	39	90.9 Å²	90.9	27%	0.273	45%	0.454	S	S	.	.	H	α-helix	trans	-70.6	-40.9	177	-57	0	0	0	0	111.6	H16 E17 A18 K22 R23 L24	H16-S20 PolarHBondContact O-N 3.26Å; H16-S20 PolarHBondContact O-OG 2.87Å; E17-S20 CarbonylContact O-C 3.57Å; E17-S20 WeakPolarHBondContact O-CB 3.2Å; E17-S20 PolarHBondContact O-N 2.94Å; E17-S20 VanDerWaalsContact O-N 3.08Å; A18-S20 VanDerWaalsContact C-N 3.34Å; S20-K22 VanDerWaalsContact C-N 3.35Å; S20-K22 PolarHBondContact O-N 3.26Å; S20-R23 PolarHBondContact O-N 3.05Å; S20-L24 WeakPolarHBondContact O-CG 3.39Å; S20-L24 PolarHBondContact O-N 3.2Å; S20-L24 VanDerWaalsContact O-N 3.08Å
21	A	85.3	Confident	76.4	Confident	19 Å²	19	87.6 Å²	87.6	16%	0.157	43%	0.43	C	S	.	.	H	α-helix	trans	-62	-42.5	175.6	0	0	0	0	0	111.5	E17 A18 R23 L24 L25 L61 L64	E17-A21 WeakPolarHBondContact O-CB 3.23Å; E17-A21 PolarHBondContact O-N 3.31Å; A18-A21 PolarHBondContact O-N 3.46Å; A21-R23 PolarHBondContact O-N 3.33Å; A21-L24 PolarHBondContact O-N 3.34Å; A21-L25 WeakPolarHBondContact O-CG 3.21Å; A21-L25 PolarHBondContact O-N 3.45Å; A21-L61 HydrophobicContact CB-CD2 3.61Å; A21-L64 HydrophobicContact CB-CD2 4.11Å
22	K	86.6	Confident	78.4	Confident	136 Å²	136	82.8 Å²	82.8	59%	0.591	42%	0.418	S	S	*	.	H	α-helix	trans	-59.8	-46.5	175.9	-169.2	176.9	-177.8	178	0	112	A18 S20 L24 L25 D26	A18-K22 WeakPolarHBondContact O-CB 3.4Å; A18-K22 PolarHBondContact O-N 3.49Å; S20-K22 VanDerWaalsContact C-N 3.35Å; S20-K22 PolarHBondContact O-N 3.26Å; K22-L24 VanDerWaalsContact C-N 3.28Å; K22-L24 PolarHBondContact O-N 2.81Å; K22-L25 WeakPolarHBondContact O-CB 3.39Å; K22-L25 PolarHBondContact O-N 2.83Å; K22-L25 VanDerWaalsContact O-N 3.11Å; K22-D26 VanDerWaalsContact O-CG 3.32Å; K22-D26 PolarHBondContact O-N 3.31Å
23	R	88.1	Confident	80.5	Confident	186 Å²	186	79.1 Å²	79.1	70%	0.702	41%	0.408	S	S	*	.	H	α-helix	trans	-59.4	-39.1	175.9	-73	-174.7	179	-180	0.6	112.6	T19 S20 A21 L25 D26 E27	T19-R23 PolarHBondContact O-N 2.91Å; S20-R23 PolarHBondContact O-N 3.05Å; A21-R23 PolarHBondContact O-N 3.33Å; R23-L25 VanDerWaalsContact C-N 3.34Å; R23-D26 PolarHBondContact O-N 3.25Å; R23-E27 WeakPolarHBondContact O-CB 3.18Å; R23-E27 PolarHBondContact O-N 3.4Å
24	L	88.7	Confident	82.3	Confident	34 Å²	34	79.3 Å²	79.3	18%	0.178	41%	0.405	C	S	.	.	H	α-helix	trans	-67.4	-34.8	176.6	-71.5	167.7	0	0	0	112.4	S20 A21 K22 N28 N57 Y60 L61	S20-L24 WeakPolarHBondContact O-CG 3.39Å; S20-L24 PolarHBondContact O-N 3.2Å; S20-L24 VanDerWaalsContact O-N 3.08Å; A21-L24 PolarHBondContact O-N 3.34Å; K22-L24 VanDerWaalsContact C-N 3.28Å; K22-L24 PolarHBondContact O-N 2.81Å; L24-N28 WeakPolarHBondContact O-CB 3.49Å; L24-N28 PolarHBondContact O-N 3.49Å; L24-N28 PolarHBondContact O-ND2 3.16Å; L24-N28 PolarHBondContact O-OD1 2.98Å; L24-N57 HydrophobicContact CD2-CB 4.15Å; L24-Y60 HydrophobicContact CD1-CD1 3.33Å; L24-Y60 HydrophobicContact CD1-CE1 3.63Å; L24-L61 HydrophobicContact CB-CD1 4.22Å; L24-L61 HydrophobicContact CB-CD2 4.21Å; L24-L61 HydrophobicContact CB-CG 4.27Å; L24-L61 HydrophobicContact CD1-CD2 4.14Å; L24-L61 HydrophobicContact CD1-CG 4.29Å
25	L	90.9	Very high	83.9	Confident	96 Å²	96	76.8 Å²	76.8	50%	0.503	39%	0.393	S	S	.	.	H	α-helix	trans	-67.3	-46.1	174.2	-70.6	171.3	0	0	0	111.5	A21 K22 R23 E27 N28 E29 L61	A21-L25 WeakPolarHBondContact O-CG 3.21Å; A21-L25 PolarHBondContact O-N 3.45Å; K22-L25 WeakPolarHBondContact O-CB 3.39Å; K22-L25 PolarHBondContact O-N 2.83Å; K22-L25 VanDerWaalsContact O-N 3.11Å; R23-L25 VanDerWaalsContact C-N 3.34Å; L25-E27 VanDerWaalsContact C-N 3.31Å; L25-E27 PolarHBondContact O-N 2.88Å; L25-N28 WeakPolarHBondContact O-CB 3.48Å; L25-N28 PolarHBondContact O-N 3.49Å; L25-N28 VanDerWaalsContact O-N 3.14Å; L25-E29 PolarHBondContact O-N 3.37Å; L25-L61 HydrophobicContact CD2-CD1 3.75Å; L25-L61 HydrophobicContact CG-CD1 4.14Å
26	D	90.7	Very high	85.5	Confident	77 Å²	77	76.4 Å²	76.4	41%	0.412	39%	0.39	S	S	.	.	H	α-helix	trans	-60.2	-43.1	176.7	-61.3	-19.5	0	0	0	110.6	K22 R23 N28 E29 H30	K22-D26 VanDerWaalsContact O-CG 3.32Å; K22-D26 PolarHBondContact O-N 3.31Å; R23-D26 PolarHBondContact O-N 3.25Å; D26-N28 PolarHBondContact O-N 3.2Å; D26-E29 PolarHBondContact O-N 2.95Å; D26-H30 PolarHBondContact O-N 3.4Å; D26-H30 VanDerWaalsContact O-N 3.16Å
27	E	90.6	Very high	87.1	Confident	99 Å²	99	72.9 Å²	72.9	46%	0.463	38%	0.375	S	S	.	.	H	α-helix	trans	-62.7	-41.4	174.7	-174	67	-155.4	0	0	111.7	R23 L25 E29 H30 I31	R23-E27 WeakPolarHBondContact O-CB 3.18Å; R23-E27 PolarHBondContact O-N 3.4Å; L25-E27 VanDerWaalsContact C-N 3.31Å; L25-E27 PolarHBondContact O-N 2.88Å; E27-E29 VanDerWaalsContact C-N 3.33Å; E27-E29 PolarHBondContact O-N 3.39Å; E27-H30 PolarHBondContact O-N 2.96Å; E27-I31 HydrophobicContact CG-CD1 3.84Å; E27-I31 HydrophobicContact CG-CG1 4.41Å; E27-I31 WeakPolarHBondContact O-CB 3.46Å; E27-I31 VanDerWaalsContact O-CG1 3.25Å; E27-I31 WeakPolarHBondContact O-CG1 3.27Å; E27-I31 PolarHBondContact O-N 2.92Å
28	N	91.2	Very high	88.3	Confident	7 Å²	7	71.3 Å²	71.3	4%	0.037	37%	0.368	C	S	.	.	H	α-helix	trans	-62.4	-40.7	177.4	-72.4	-11.8	0	0	0	111.9	L24 L25 D26 I31 I32 L54 N57	L24-N28 WeakPolarHBondContact O-CB 3.49Å; L24-N28 PolarHBondContact O-N 3.49Å; L24-N28 PolarHBondContact O-ND2 3.16Å; L24-N28 PolarHBondContact O-OD1 2.98Å; L25-N28 WeakPolarHBondContact O-CB 3.48Å; L25-N28 PolarHBondContact O-N 3.49Å; L25-N28 VanDerWaalsContact O-N 3.14Å; D26-N28 PolarHBondContact O-N 3.2Å; N28-I31 PolarHBondContact O-N 3.46Å; N28-I32 WeakPolarHBondContact O-CB 3.44Å; N28-I32 WeakPolarHBondContact O-CD1 3.29Å; N28-I32 WeakPolarHBondContact O-CG1 3.4Å; N28-I32 PolarHBondContact O-N 2.96Å; N28-L54 HydrophobicContact CB-CD1 3.51Å; N28-L54 VanDerWaalsContact CG-CD1 3.43Å; N28-L54 WeakPolarHBondContact OD1-CD1 3.44Å; N28-N57 WeakPolarHBondContact OD1-CB 3.28Å; N28-N57 PolarHBondContact OD1-ND2 3.4Å
29	E	92.5	Very high	89.3	Confident	119 Å²	119	70.4 Å²	70.4	56%	0.556	36%	0.361	S	S	*	.	H	α-helix	trans	-61.1	-50.2	177	-171.7	168.8	-163.7	0	0	110.8	L25 D26 E27 I31 I32 E33	L25-E29 PolarHBondContact O-N 3.37Å; D26-E29 PolarHBondContact O-N 2.95Å; E27-E29 VanDerWaalsContact C-N 3.33Å; E27-E29 PolarHBondContact O-N 3.39Å; E29-I31 PolarHBondContact O-N 3.41Å; E29-I32 PolarHBondContact O-N 3.22Å; E29-E33 WeakPolarHBondContact O-CG 3.34Å; E29-E33 PolarHBondContact O-N 3.11Å
30	H	92.2	Very high	90.2	Very high	123 Å²	123	75.8 Å²	75.8	57%	0.569	37%	0.372	S	S	*	.	H	α-helix	trans	-61.4	-40.8	175.9	-83	-46.5	0	0	0	113.5	D26 E27 I32 E33 L34	D26-H30 PolarHBondContact O-N 3.4Å; D26-H30 VanDerWaalsContact O-N 3.16Å; E27-H30 PolarHBondContact O-N 2.96Å; H30-I32 VanDerWaalsContact C-N 3.34Å; H30-I32 PolarHBondContact O-N 3.18Å; H30-E33 IonicContact ND1-OE2 3.67Å; H30-E33 PolarHBondContact O-N 2.96Å; H30-L34 VanDerWaalsContact O-CB 3.29Å; H30-L34 WeakPolarHBondContact O-CB 3.42Å; H30-L34 PolarHBondContact O-N 3.48Å
31	I	92	Very high	90.7	Very high	5 Å²	5	80.4 Å²	80.4	3%	0.026	39%	0.387	C	S	.	.	H	α-helix	trans	-62.2	-43.7	176.5	-74	171.1	0	0	0	110.6	E27 N28 E29 E33 L34 V35 L50 V53 L54	E27-I31 HydrophobicContact CG-CD1 3.84Å; E27-I31 HydrophobicContact CG-CG1 4.41Å; E27-I31 WeakPolarHBondContact O-CB 3.46Å; E27-I31 VanDerWaalsContact O-CG1 3.25Å; E27-I31 WeakPolarHBondContact O-CG1 3.27Å; E27-I31 PolarHBondContact O-N 2.92Å; N28-I31 PolarHBondContact O-N 3.46Å; E29-I31 PolarHBondContact O-N 3.41Å; I31-E33 PolarHBondContact O-N 3.43Å; I31-L34 PolarHBondContact O-N 3.14Å; I31-V35 HydrophobicContact CG2-CG2 4.07Å; I31-V35 VanDerWaalsContact O-CB 3.27Å; I31-V35 WeakPolarHBondContact O-CB 3.03Å; I31-V35 WeakPolarHBondContact O-CG2 3.49Å; I31-V35 PolarHBondContact O-N 3.2Å; I31-L50 HydrophobicContact CG1-CD2 4.4Å; I31-L50 HydrophobicContact CG2-CB 3.98Å; I31-L50 WeakPolarHBondContact CG2-O 3.47Å; I31-V53 HydrophobicContact CD1-CB 4.12Å; I31-V53 HydrophobicContact CD1-CG1 3.65Å; I31-L54 HydrophobicContact CG2-CB 3.86Å; I31-L54 HydrophobicContact CG2-CD2 4.49Å
32	I	93.4	Very high	90.8	Very high	95 Å²	95	81.4 Å²	81.4	49%	0.487	40%	0.399	S	S	.	.	H	α-helix	trans	-61.2	-46	179.2	-71.4	163.2	0	0	0	110.5	N28 E29 H30 V35 A36 L54	N28-I32 WeakPolarHBondContact O-CB 3.44Å; N28-I32 WeakPolarHBondContact O-CD1 3.29Å; N28-I32 WeakPolarHBondContact O-CG1 3.4Å; N28-I32 PolarHBondContact O-N 2.96Å; E29-I32 PolarHBondContact O-N 3.22Å; H30-I32 VanDerWaalsContact C-N 3.34Å; H30-I32 PolarHBondContact O-N 3.18Å; I32-V35 PolarHBondContact O-N 3.34Å; I32-A36 PolarHBondContact O-N 2.95Å; I32-L54 HydrophobicContact CD1-CD1 4.3Å; I32-L54 HydrophobicContact CD1-CD2 4.29Å; I32-L54 HydrophobicContact CG1-CD1 4.2Å; I32-L54 HydrophobicContact CG1-CD2 3.66Å
33	E	94.1	Very high	90.9	Very high	110 Å²	110	80.7 Å²	80.7	51%	0.514	39%	0.393	S	S	.	.	H	α-helix	trans	-59.2	-49.2	175.7	-69.7	-178.3	159.5	0	0	111.4	E29 H30 I31 V35 A36 D37	E29-E33 WeakPolarHBondContact O-CG 3.34Å; E29-E33 PolarHBondContact O-N 3.11Å; H30-E33 IonicContact ND1-OE2 3.67Å; H30-E33 PolarHBondContact O-N 2.96Å; I31-E33 PolarHBondContact O-N 3.43Å; E33-V35 PolarHBondContact O-N 3.32Å; E33-A36 PolarHBondContact O-N 2.9Å; E33-D37 WeakPolarHBondContact O-CB 3.46Å; E33-D37 PolarHBondContact O-N 3.15Å
34	L	92.1	Very high	90.8	Very high	84 Å²	84	78.2 Å²	78.2	44%	0.44	39%	0.388	S	S	.	.	H	α-helix	trans	-65.2	-39.6	-177.9	-171.9	62.6	0	0	0	111.8	H30 I31 D37 L38 L50	H30-L34 VanDerWaalsContact O-CB 3.29Å; H30-L34 WeakPolarHBondContact O-CB 3.42Å; H30-L34 PolarHBondContact O-N 3.48Å; I31-L34 PolarHBondContact O-N 3.14Å; L34-D37 WeakPolarHBondContact O-CB 3.38Å; L34-D37 PolarHBondContact O-N 3.19Å; L34-L38 HydrophobicContact CG-CD1 4.03Å; L34-L38 HydrophobicContact CG-CG 4.42Å; L34-L38 WeakPolarHBondContact O-CB 3.42Å; L34-L38 WeakPolarHBondContact O-CG 3.37Å; L34-L38 PolarHBondContact O-N 2.96Å; L34-L50 HydrophobicContact CB-CD1 4.18Å; L34-L50 HydrophobicContact CD2-CD1 3.49Å; L34-L50 VanDerWaalsContact CD2-CD1 3.49Å; L34-L50 HydrophobicContact CD2-CD2 4.35Å; L34-L50 HydrophobicContact CG-CD1 3.7Å
35	V	91.9	Very high	90.7	Very high	22 Å²	22	87.1 Å²	87.1	13%	0.133	42%	0.419	C	S	.	.	H	α-helix	trans	-60.5	-47.4	174.4	160.6	0	0	0	0	110.7	I31 I32 E33 D37 L38 A39 S47 L50	I31-V35 HydrophobicContact CG2-CG2 4.07Å; I31-V35 VanDerWaalsContact O-CB 3.27Å; I31-V35 WeakPolarHBondContact O-CB 3.03Å; I31-V35 WeakPolarHBondContact O-CG2 3.49Å; I31-V35 PolarHBondContact O-N 3.2Å; I32-V35 PolarHBondContact O-N 3.34Å; E33-V35 PolarHBondContact O-N 3.32Å; V35-D37 VanDerWaalsContact C-N 3.27Å; V35-D37 PolarHBondContact O-N 3.4Å; V35-L38 PolarHBondContact O-N 2.93Å; V35-A39 WeakPolarHBondContact O-CB 3.41Å; V35-A39 PolarHBondContact O-N 2.98Å; V35-S47 WeakPolarHBondContact CG1-OG 3.25Å; V35-L50 HydrophobicContact CG2-CB 3.51Å; V35-L50 HydrophobicContact CG2-CD1 4.13Å
36	A	91.6	Very high	90.5	Very high	48 Å²	48	85.9 Å²	85.9	40%	0.397	41%	0.41	S	S	.	.	H	α-helix	trans	-60.6	-40.2	176.4	0	0	0	0	0	111.3	I32 E33 R40	I32-A36 PolarHBondContact O-N 2.95Å; E33-A36 PolarHBondContact O-N 2.9Å; A36-R40 WeakPolarHBondContact O-CG 3.39Å; A36-R40 PolarHBondContact O-N 3.46Å
37	D	93	Very high	90.3	Very high	49 Å²	49	82.7 Å²	82.7	26%	0.262	39%	0.394	S	S	.	.	H	α-helix	trans	-64.3	-45.2	177	-123	40.6	0	0	0	113.1	E33 L34 V35 R40 K41	E33-D37 WeakPolarHBondContact O-CB 3.46Å; E33-D37 PolarHBondContact O-N 3.15Å; L34-D37 WeakPolarHBondContact O-CB 3.38Å; L34-D37 PolarHBondContact O-N 3.19Å; V35-D37 VanDerWaalsContact C-N 3.27Å; V35-D37 PolarHBondContact O-N 3.4Å; D37-R40 PolarHBondContact O-N 3.43Å; D37-R40 IonicContact OD1-CZ 3.56Å; D37-R40 IonicContact OD1-NE 3.71Å; D37-R40 IonicContact OD1-NH2 2.64Å; D37-R40 PolarHBondContact OD1-NH2 3Å; D37-K41 WeakPolarHBondContact O-CD 3.43Å; D37-K41 VanDerWaalsContact O-CG 3.3Å; D37-K41 WeakPolarHBondContact O-CG 3.48Å; D37-K41 PolarHBondContact O-N 3.03Å; D37-K41 VanDerWaalsContact O-N 3.09Å; D37-K41 IonicContact OD2-NZ 2.75Å; D37-K41 PolarHBondContact OD2-NZ 3.47Å
38	L	90.3	Very high	90.2	Very high	6 Å²	6	82.5 Å²	82.5	3%	0.031	40%	0.399	C	S	.	.	H	α-helix	trans	-68	-39.1	178.3	-71.1	168.6	0	0	0	111.6	L34 V35 K41 G42 R43 E46 L50	L34-L38 HydrophobicContact CG-CD1 4.03Å; L34-L38 HydrophobicContact CG-CG 4.42Å; L34-L38 WeakPolarHBondContact O-CB 3.42Å; L34-L38 WeakPolarHBondContact O-CG 3.37Å; L34-L38 PolarHBondContact O-N 2.96Å; V35-L38 PolarHBondContact O-N 2.93Å; L38-K41 CarbonylContact O-C 3.43Å; L38-K41 PolarHBondContact O-N 3.27Å; L38-K41 VanDerWaalsContact O-N 3.14Å; L38-G42 PolarHBondContact O-N 3.31Å; L38-R43 HydrophobicContact CB-CB 4.12Å; L38-R43 HydrophobicContact CD2-CB 3.74Å; L38-R43 HydrophobicContact CD2-CG 4.28Å; L38-R43 PolarHBondContact O-N 3.21Å; L38-E46 HydrophobicContact CD1-CB 3.76Å; L38-E46 HydrophobicContact CD2-CB 4.43Å; L38-L50 HydrophobicContact CD1-CD1 3.44Å; L38-L50 VanDerWaalsContact CD1-CD1 3.44Å
39	A	87	Confident	90.1	Very high	41 Å²	41	88.6 Å²	88.6	34%	0.339	43%	0.428	S	S	.	.	H	α-helix	trans	-61.3	-44.5	174.5	0	0	0	0	0	111.2	V35 K41 G42	V35-A39 WeakPolarHBondContact O-CB 3.41Å; V35-A39 PolarHBondContact O-N 2.98Å; A39-K41 PolarHBondContact O-N 3.48Å; A39-G42 PolarHBondContact O-N 2.76Å; A39-G42 VanDerWaalsContact O-N 3.08Å
40	R	90.6	Very high	90.1	Very high	196 Å²	196	84.8 Å²	84.8	74%	0.74	41%	0.411	S	S	*	.	H	α-helix	trans	-59.9	-33.9	173.3	-73.9	-170.6	-67.2	-152.4	2.2	112.9	A36 D37 G42	A36-R40 WeakPolarHBondContact O-CG 3.39Å; A36-R40 PolarHBondContact O-N 3.46Å; D37-R40 PolarHBondContact O-N 3.43Å; D37-R40 IonicContact OD1-CZ 3.56Å; D37-R40 IonicContact OD1-NE 3.71Å; D37-R40 IonicContact OD1-NH2 2.64Å; D37-R40 PolarHBondContact OD1-NH2 3Å; R40-G42 VanDerWaalsContact C-N 3.33Å
41	K	91	Very high	89.9	Confident	136 Å²	136	83.4 Å²	83.4	59%	0.591	41%	0.405	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.7	-1	178	-67.9	164.4	-177.1	159.3	0	113.5	D37 L38 A39 R43	D37-K41 WeakPolarHBondContact O-CD 3.43Å; D37-K41 VanDerWaalsContact O-CG 3.3Å; D37-K41 WeakPolarHBondContact O-CG 3.48Å; D37-K41 PolarHBondContact O-N 3.03Å; D37-K41 VanDerWaalsContact O-N 3.09Å; D37-K41 IonicContact OD2-NZ 2.75Å; D37-K41 PolarHBondContact OD2-NZ 3.47Å; L38-K41 CarbonylContact O-C 3.43Å; L38-K41 PolarHBondContact O-N 3.27Å; L38-K41 VanDerWaalsContact O-N 3.14Å; A39-K41 PolarHBondContact O-N 3.48Å; K41-R43 VanDerWaalsContact C-N 3.29Å; K41-R43 HydrophobicContact CB-CG 4.44Å; K41-R43 PolarHBondContact O-N 3.32Å
42	G	88.8	Confident	89.9	Confident	40 Å²	40	85.8 Å²	85.8	41%	0.412	43%	0.425	S	S	.	.	T	Hydrogen-bonded Turn	trans	73.4	12.4	-176.9	0	0	0	0	0	115.1	L38 A39 R40 F44	L38-G42 PolarHBondContact O-N 3.31Å; A39-G42 PolarHBondContact O-N 2.76Å; A39-G42 VanDerWaalsContact O-N 3.08Å; R40-G42 VanDerWaalsContact C-N 3.33Å; G42-F44 VanDerWaalsContact C-N 3.26Å; G42-F44 VanDerWaalsContact O-CD2 3.23Å; G42-F44 WeakPolarHBondContact O-CD2 3.38Å; G42-F44 PolarHBondContact O-N 3.49Å
43	R	87.7	Confident	89.8	Confident	122 Å²	122	84.3 Å²	84.3	46%	0.46	42%	0.421	S	S	.	.			trans	-85.5	59.8	-179.5	-68.1	179	71.9	-175.9	18.1	111.7	L38 K41 R45 E46 S47	L38-R43 HydrophobicContact CB-CB 4.12Å; L38-R43 HydrophobicContact CD2-CB 3.74Å; L38-R43 HydrophobicContact CD2-CG 4.28Å; L38-R43 PolarHBondContact O-N 3.21Å; K41-R43 VanDerWaalsContact C-N 3.29Å; K41-R43 HydrophobicContact CB-CG 4.44Å; K41-R43 PolarHBondContact O-N 3.32Å; R43-R45 VanDerWaalsContact C-N 3.31Å; R43-R45 PolarHBondContact O-N 2.96Å; R43-E46 IonicContact CZ-OE1 3Å; R43-E46 IonicContact CZ-OE2 2.98Å; R43-E46 IonicContact NE-OE1 2.8Å; R43-E46 PolarHBondContact NE-OE1 3.15Å; R43-E46 IonicContact NE-OE2 3.44Å; R43-E46 PolarHBondContact NE-OE2 3.1Å; R43-E46 IonicContact NH1-OE2 3.55Å; R43-E46 IonicContact NH2-OE1 2.65Å; R43-E46 PolarHBondContact NH2-OE1 3.39Å; R43-E46 IonicContact NH2-OE2 2.68Å; R43-E46 PolarHBondContact NH2-OE2 3.48Å; R43-E46 PolarHBondContact O-N 3.08Å; R43-S47 PolarHBondContact O-N 3.2Å
44	F	85.9	Confident	89.6	Confident	134 Å²	134	80.2 Å²	80.2	59%	0.588	40%	0.402	S	S	*	.	H	α-helix	trans	-62	-31.7	-172.6	-58.1	-68.3	0	0	0	114.3	G42 S47 V48	G42-F44 VanDerWaalsContact C-N 3.26Å; G42-F44 VanDerWaalsContact O-CD2 3.23Å; G42-F44 WeakPolarHBondContact O-CD2 3.38Å; G42-F44 PolarHBondContact O-N 3.49Å; F44-S47 WeakPolarHBondContact O-CB 3.33Å; F44-S47 PolarHBondContact O-N 3.42Å; F44-V48 VanDerWaalsContact O-CG2 3.28Å; F44-V48 WeakPolarHBondContact O-CG2 3.46Å; F44-V48 PolarHBondContact O-N 2.91Å
45	R	86.7	Confident	89.7	Confident	220 Å²	220	82.2 Å²	82.2	83%	0.83	41%	0.409	S	S	*	.	H	α-helix	trans	-63.7	-44.2	179.3	-70.9	-176.2	99.5	-171.9	7.5	112.6	R43 V48 Q49	R43-R45 VanDerWaalsContact C-N 3.31Å; R43-R45 PolarHBondContact O-N 2.96Å; R45-V48 PolarHBondContact O-N 3.28Å; R45-Q49 PolarHBondContact O-N 3.28Å
46	E	86.4	Confident	89.7	Confident	70 Å²	70	90.5 Å²	90.5	33%	0.327	44%	0.438	S	S	.	.	H	α-helix	trans	-72.1	-37.5	178.5	-74.7	164.7	-110.7	0	0	111.3	L38 R43 V48 Q49 L50	L38-E46 HydrophobicContact CD1-CB 3.76Å; L38-E46 HydrophobicContact CD2-CB 4.43Å; R43-E46 IonicContact CZ-OE1 3Å; R43-E46 IonicContact CZ-OE2 2.98Å; R43-E46 IonicContact NE-OE1 2.8Å; R43-E46 PolarHBondContact NE-OE1 3.15Å; R43-E46 IonicContact NE-OE2 3.44Å; R43-E46 PolarHBondContact NE-OE2 3.1Å; R43-E46 IonicContact NH1-OE2 3.55Å; R43-E46 IonicContact NH2-OE1 2.65Å; R43-E46 PolarHBondContact NH2-OE1 3.39Å; R43-E46 IonicContact NH2-OE2 2.68Å; R43-E46 PolarHBondContact NH2-OE2 3.48Å; R43-E46 PolarHBondContact O-N 3.08Å; E46-V48 VanDerWaalsContact C-N 3.29Å; E46-V48 PolarHBondContact O-N 3Å; E46-Q49 PolarHBondContact O-N 3.45Å; E46-L50 WeakPolarHBondContact O-CB 3.32Å; E46-L50 WeakPolarHBondContact O-CG 3.44Å; E46-L50 PolarHBondContact O-N 3.01Å
47	S	86.8	Confident	89.6	Confident	11 Å²	11	89.1 Å²	89.1	8%	0.077	42%	0.424	C	S	.	.	H	α-helix	trans	-54.1	-46	170.8	177.9	0	0	0	0	111.5	V35 R43 F44 L50 Q51	V35-S47 WeakPolarHBondContact CG1-OG 3.25Å; R43-S47 PolarHBondContact O-N 3.2Å; F44-S47 WeakPolarHBondContact O-CB 3.33Å; F44-S47 PolarHBondContact O-N 3.42Å; S47-L50 PolarHBondContact O-N 2.98Å; S47-Q51 VanDerWaalsContact O-CB 3.29Å; S47-Q51 WeakPolarHBondContact O-CB 3.48Å; S47-Q51 PolarHBondContact O-N 3.44Å
48	V	89	Confident	89.5	Confident	94 Å²	94	90.9 Å²	90.9	57%	0.57	43%	0.433	S	S	*	.	H	α-helix	trans	-65.6	-40.4	179.5	170.9	0	0	0	0	111.8	F44 R45 E46 Q51 A52	F44-V48 VanDerWaalsContact O-CG2 3.28Å; F44-V48 WeakPolarHBondContact O-CG2 3.46Å; F44-V48 PolarHBondContact O-N 2.91Å; R45-V48 PolarHBondContact O-N 3.28Å; E46-V48 VanDerWaalsContact C-N 3.29Å; E46-V48 PolarHBondContact O-N 3Å; V48-Q51 PolarHBondContact O-N 2.91Å; V48-A52 PolarHBondContact O-N 2.8Å
49	Q	90.2	Very high	89.6	Confident	136 Å²	136	95.1 Å²	95.1	64%	0.636	46%	0.459	S	S	*	.	H	α-helix	trans	-62.7	-46.7	177.2	-74.1	179	-19.6	0	0	111.8	R45 E46 Q51 A52 V53	R45-Q49 PolarHBondContact O-N 3.28Å; E46-Q49 PolarHBondContact O-N 3.45Å; Q49-Q51 VanDerWaalsContact C-N 3.28Å; Q49-Q51 PolarHBondContact O-N 3.44Å; Q49-A52 WeakPolarHBondContact O-CB 3.34Å; Q49-A52 PolarHBondContact O-N 3.35Å; Q49-V53 PolarHBondContact O-N 3.1Å
50	L	90.5	Very high	89.7	Confident	39 Å²	39	98.6 Å²	98.6	20%	0.204	46%	0.464	C	S	.	.	H	α-helix	trans	-63.4	-37.2	176.6	-73	175	0	0	0	111.8	I31 L34 V35 L38 E46 S47 A52 V53 L54	I31-L50 HydrophobicContact CG1-CD2 4.4Å; I31-L50 HydrophobicContact CG2-CB 3.98Å; I31-L50 WeakPolarHBondContact CG2-O 3.47Å; L34-L50 HydrophobicContact CB-CD1 4.18Å; L34-L50 HydrophobicContact CD2-CD1 3.49Å; L34-L50 VanDerWaalsContact CD2-CD1 3.49Å; L34-L50 HydrophobicContact CD2-CD2 4.35Å; L34-L50 HydrophobicContact CG-CD1 3.7Å; V35-L50 HydrophobicContact CG2-CB 3.51Å; V35-L50 HydrophobicContact CG2-CD1 4.13Å; L38-L50 HydrophobicContact CD1-CD1 3.44Å; L38-L50 VanDerWaalsContact CD1-CD1 3.44Å; E46-L50 WeakPolarHBondContact O-CB 3.32Å; E46-L50 WeakPolarHBondContact O-CG 3.44Å; E46-L50 PolarHBondContact O-N 3.01Å; S47-L50 PolarHBondContact O-N 2.98Å; L50-A52 VanDerWaalsContact C-N 3.3Å; L50-A52 PolarHBondContact O-N 3.37Å; L50-V53 WeakPolarHBondContact O-CB 3.31Å; L50-V53 PolarHBondContact O-N 2.89Å; L50-V53 VanDerWaalsContact O-N 3.15Å; L50-L54 PolarHBondContact O-N 3.44Å
51	Q	90	Very high	89.5	Confident	93 Å²	93	90.3 Å²	90.3	44%	0.435	43%	0.434	S	S	.	.	H	α-helix	trans	-65.8	-32.9	176.6	-159.9	155.6	18.4	0	0	112.6	S47 V48 Q49 L54 Q55	S47-Q51 VanDerWaalsContact O-CB 3.29Å; S47-Q51 WeakPolarHBondContact O-CB 3.48Å; S47-Q51 PolarHBondContact O-N 3.44Å; V48-Q51 PolarHBondContact O-N 2.91Å; Q49-Q51 VanDerWaalsContact C-N 3.28Å; Q49-Q51 PolarHBondContact O-N 3.44Å; Q51-L54 PolarHBondContact O-N 3.33Å; Q51-Q55 WeakPolarHBondContact O-CG 3.47Å; Q51-Q55 PolarHBondContact O-N 3.47Å
52	A	91.4	Very high	89.4	Confident	55 Å²	55	87.9 Å²	87.9	46%	0.455	43%	0.431	S	S	.	.	H	α-helix	trans	-67.2	-38	171.8	0	0	0	0	0	112.3	V48 Q49 L50 Q55 R56	V48-A52 PolarHBondContact O-N 2.8Å; Q49-A52 WeakPolarHBondContact O-CB 3.34Å; Q49-A52 PolarHBondContact O-N 3.35Å; L50-A52 VanDerWaalsContact C-N 3.3Å; L50-A52 PolarHBondContact O-N 3.37Å; A52-Q55 PolarHBondContact O-N 3.21Å; A52-R56 PolarHBondContact O-N 3.05Å; A52-R56 VanDerWaalsContact O-N 3.1Å
53	V	90.4	Very high	89.3	Confident	65 Å²	65	88.2 Å²	88.2	39%	0.394	43%	0.427	S	S	.	.	H	α-helix	trans	-64.7	-45.9	173.9	179.3	0	0	0	0	110.6	I31 Q49 L50 Q55 R56 N57	I31-V53 HydrophobicContact CD1-CB 4.12Å; I31-V53 HydrophobicContact CD1-CG1 3.65Å; Q49-V53 PolarHBondContact O-N 3.1Å; L50-V53 WeakPolarHBondContact O-CB 3.31Å; L50-V53 PolarHBondContact O-N 2.89Å; L50-V53 VanDerWaalsContact O-N 3.15Å; V53-Q55 VanDerWaalsContact C-N 3.33Å; V53-Q55 PolarHBondContact O-N 3.05Å; V53-R56 WeakPolarHBondContact O-CB 3.3Å; V53-R56 PolarHBondContact O-N 3.08Å; V53-R56 VanDerWaalsContact O-N 3.15Å; V53-N57 PolarHBondContact O-N 2.84Å
54	L	91.2	Very high	89.2	Confident	24 Å²	24	83 Å²	83	13%	0.126	41%	0.408	C	S	.	.	H	α-helix	trans	-56.3	-46.4	175.9	180	61.6	0	0	0	111.9	N28 I31 I32 L50 Q51 R56 N57 L58	N28-L54 HydrophobicContact CB-CD1 3.51Å; N28-L54 VanDerWaalsContact CG-CD1 3.43Å; N28-L54 WeakPolarHBondContact OD1-CD1 3.44Å; I31-L54 HydrophobicContact CG2-CB 3.86Å; I31-L54 HydrophobicContact CG2-CD2 4.49Å; I32-L54 HydrophobicContact CD1-CD1 4.3Å; I32-L54 HydrophobicContact CD1-CD2 4.29Å; I32-L54 HydrophobicContact CG1-CD1 4.2Å; I32-L54 HydrophobicContact CG1-CD2 3.66Å; L50-L54 PolarHBondContact O-N 3.44Å; Q51-L54 PolarHBondContact O-N 3.33Å; L54-R56 VanDerWaalsContact C-N 3.34Å; L54-R56 PolarHBondContact O-N 2.83Å; L54-N57 PolarHBondContact O-N 3.2Å; L54-L58 HydrophobicContact CD1-CD1 4.41Å; L54-L58 HydrophobicContact CD1-CG 4.48Å; L54-L58 HydrophobicContact CG-CD1 4.23Å; L54-L58 WeakPolarHBondContact O-CG 3.48Å; L54-L58 PolarHBondContact O-N 3.35Å
55	Q	92.4	Very high	89.1	Confident	126 Å²	126	80.4 Å²	80.4	59%	0.589	40%	0.403	S	S	*	.	H	α-helix	trans	-60.3	-43.5	177.2	-78.2	-179.4	-21.6	0	0	112	Q51 A52 V53 N57 L58 V59	Q51-Q55 WeakPolarHBondContact O-CG 3.47Å; Q51-Q55 PolarHBondContact O-N 3.47Å; A52-Q55 PolarHBondContact O-N 3.21Å; V53-Q55 VanDerWaalsContact C-N 3.33Å; V53-Q55 PolarHBondContact O-N 3.05Å; Q55-N57 VanDerWaalsContact C-N 3.33Å; Q55-N57 PolarHBondContact O-N 2.93Å; Q55-L58 PolarHBondContact O-N 3.49Å; Q55-V59 VanDerWaalsContact O-CG2 3.32Å; Q55-V59 WeakPolarHBondContact O-CG2 3.43Å; Q55-V59 PolarHBondContact O-N 3.44Å
56	R	92.1	Very high	88.8	Confident	195 Å²	195	74.1 Å²	74.1	74%	0.736	39%	0.386	S	S	*	.	H	α-helix	trans	-60.4	-44.7	177.3	-177.5	-178.7	177.9	174.2	-0.3	111.6	A52 V53 L54 V59 Y60	A52-R56 PolarHBondContact O-N 3.05Å; A52-R56 VanDerWaalsContact O-N 3.1Å; V53-R56 WeakPolarHBondContact O-CB 3.3Å; V53-R56 PolarHBondContact O-N 3.08Å; V53-R56 VanDerWaalsContact O-N 3.15Å; L54-R56 VanDerWaalsContact C-N 3.34Å; L54-R56 PolarHBondContact O-N 2.83Å; R56-V59 PolarHBondContact O-N 2.95Å; R56-Y60 WeakPolarHBondContact O-CB 3.46Å; R56-Y60 PolarHBondContact O-N 2.78Å
57	N	89.9	Confident	88.4	Confident	19 Å²	19	75.7 Å²	75.7	10%	0.102	39%	0.393	C	S	.	.	H	α-helix	trans	-63.9	-42.5	179.9	-70.9	-3	0	0	0	111.5	L24 N28 V53 L54 Q55 Y60 L61	L24-N57 HydrophobicContact CD2-CB 4.15Å; N28-N57 WeakPolarHBondContact OD1-CB 3.28Å; N28-N57 PolarHBondContact OD1-ND2 3.4Å; V53-N57 PolarHBondContact O-N 2.84Å; L54-N57 PolarHBondContact O-N 3.2Å; Q55-N57 VanDerWaalsContact C-N 3.33Å; Q55-N57 PolarHBondContact O-N 2.93Å; N57-Y60 PolarHBondContact O-N 3.26Å; N57-L61 WeakPolarHBondContact O-CB 3.43Å; N57-L61 WeakPolarHBondContact O-CG 3.38Å; N57-L61 PolarHBondContact O-N 2.89Å
58	L	91.2	Very high	87.9	Confident	86 Å²	86	77.2 Å²	77.2	45%	0.45	40%	0.4	S	S	.	.	H	α-helix	trans	-63.1	-45.7	176.6	-71.2	172.8	0	0	0	112.1	L54 Q55 Y60 L61 V62	L54-L58 HydrophobicContact CD1-CD1 4.41Å; L54-L58 HydrophobicContact CD1-CG 4.48Å; L54-L58 HydrophobicContact CG-CD1 4.23Å; L54-L58 WeakPolarHBondContact O-CG 3.48Å; L54-L58 PolarHBondContact O-N 3.35Å; Q55-L58 PolarHBondContact O-N 3.49Å; L58-Y60 VanDerWaalsContact C-N 3.31Å; L58-Y60 PolarHBondContact O-N 3.22Å; L58-L61 PolarHBondContact O-N 2.91Å; L58-V62 WeakPolarHBondContact O-CG2 3.43Å; L58-V62 PolarHBondContact O-N 3.49Å
59	V	91.8	Very high	87	Confident	95 Å²	95	77.2 Å²	77.2	58%	0.576	40%	0.397	S	S	*	.	H	α-helix	trans	-63	-39.8	177.4	173.4	0	0	0	0	111.2	Q55 R56 V62 S63	Q55-V59 VanDerWaalsContact O-CG2 3.32Å; Q55-V59 WeakPolarHBondContact O-CG2 3.43Å; Q55-V59 PolarHBondContact O-N 3.44Å; R56-V59 PolarHBondContact O-N 2.95Å; V59-V62 PolarHBondContact O-N 2.79Å; V59-S63 WeakPolarHBondContact O-CB 3.48Å; V59-S63 PolarHBondContact O-N 3.05Å; V59-S63 PolarHBondContact O-OG 2.79Å
60	Y	89.5	Confident	85.7	Confident	115 Å²	115	76.3 Å²	76.3	45%	0.451	40%	0.396	S	S	.	.	H	α-helix	trans	-64.9	-43.6	175.7	-179.1	-99.4	0	0	0	111.9	L24 R56 N57 L58 V62 S63 L64	L24-Y60 HydrophobicContact CD1-CD1 3.33Å; L24-Y60 HydrophobicContact CD1-CE1 3.63Å; R56-Y60 WeakPolarHBondContact O-CB 3.46Å; R56-Y60 PolarHBondContact O-N 2.78Å; N57-Y60 PolarHBondContact O-N 3.26Å; L58-Y60 VanDerWaalsContact C-N 3.31Å; L58-Y60 PolarHBondContact O-N 3.22Å; Y60-V62 PolarHBondContact O-N 3.18Å; Y60-S63 WeakPolarHBondContact O-CB 3.21Å; Y60-S63 PolarHBondContact O-N 3.28Å; Y60-L64 HydrophobicContact CE1-CD1 4.31Å; Y60-L64 WeakPolarHBondContact O-CB 3.4Å; Y60-L64 PolarHBondContact O-N 3.35Å
61	L	87.6	Confident	84.2	Confident	21 Å²	21	79.7 Å²	79.7	11%	0.11	41%	0.414	C	S	.	.	H	α-helix	trans	-60.8	-44.2	175.1	-75.8	170.2	0	0	0	111.9	A21 L24 L25 N57 L58 S63 L64 V65	A21-L61 HydrophobicContact CB-CD2 3.61Å; L24-L61 HydrophobicContact CB-CD1 4.22Å; L24-L61 HydrophobicContact CB-CD2 4.21Å; L24-L61 HydrophobicContact CB-CG 4.27Å; L24-L61 HydrophobicContact CD1-CD2 4.14Å; L24-L61 HydrophobicContact CD1-CG 4.29Å; L25-L61 HydrophobicContact CD2-CD1 3.75Å; L25-L61 HydrophobicContact CG-CD1 4.14Å; N57-L61 WeakPolarHBondContact O-CB 3.43Å; N57-L61 WeakPolarHBondContact O-CG 3.38Å; N57-L61 PolarHBondContact O-N 2.89Å; L58-L61 PolarHBondContact O-N 2.91Å; L61-S63 VanDerWaalsContact C-N 3.33Å; L61-S63 PolarHBondContact O-N 3.34Å; L61-L64 WeakPolarHBondContact O-CB 3.21Å; L61-L64 PolarHBondContact O-N 3.13Å; L61-V65 VanDerWaalsContact O-CG2 3.3Å; L61-V65 WeakPolarHBondContact O-CG2 3.13Å; L61-V65 PolarHBondContact O-N 2.73Å
62	V	88.2	Confident	82.6	Confident	85 Å²	85	79 Å²	79	52%	0.515	42%	0.42	S	S	.	.	H	α-helix	trans	-60	-45.6	174.6	171.6	0	0	0	0	110.4	L58 V59 Y60 L64 V65 D66	L58-V62 WeakPolarHBondContact O-CG2 3.43Å; L58-V62 PolarHBondContact O-N 3.49Å; V59-V62 PolarHBondContact O-N 2.79Å; Y60-V62 PolarHBondContact O-N 3.18Å; V62-L64 VanDerWaalsContact C-N 3.29Å; V62-L64 PolarHBondContact O-N 3.17Å; V62-V65 PolarHBondContact O-N 2.85Å; V62-D66 WeakPolarHBondContact O-CB 3.41Å; V62-D66 PolarHBondContact O-N 3.36Å
63	S	87.3	Confident	80.7	Confident	48 Å²	48	83.8 Å²	83.8	34%	0.336	43%	0.431	S	S	.	.	H	α-helix	trans	-61	-39.2	177.9	-55.4	0	0	0	0	112.2	V59 Y60 L61 D66 Q67	V59-S63 WeakPolarHBondContact O-CB 3.48Å; V59-S63 PolarHBondContact O-N 3.05Å; V59-S63 PolarHBondContact O-OG 2.79Å; Y60-S63 WeakPolarHBondContact O-CB 3.21Å; Y60-S63 PolarHBondContact O-N 3.28Å; L61-S63 VanDerWaalsContact C-N 3.33Å; L61-S63 PolarHBondContact O-N 3.34Å; S63-D66 PolarHBondContact O-N 3.4Å; S63-Q67 WeakPolarHBondContact O-CB 3.45Å; S63-Q67 WeakPolarHBondContact O-CG 3.44Å; S63-Q67 PolarHBondContact O-N 3.49Å
64	L	84.1	Confident	78.7	Confident	11 Å²	11	88.4 Å²	88.4	6%	0.058	45%	0.448	C	S	.	.	H	α-helix	trans	-65.2	-44.4	176.9	-151.9	76.2	0	0	0	111.3	E17 A21 Y60 L61 V62 Q67 N68	E17-L64 HydrophobicContact CB-CD2 4.04Å; E17-L64 HydrophobicContact CG-CD1 3.95Å; E17-L64 HydrophobicContact CG-CD2 4.29Å; E17-L64 HydrophobicContact CG-CG 4.37Å; E17-L64 WeakPolarHBondContact OE1-CD1 3.48Å; A21-L64 HydrophobicContact CB-CD2 4.11Å; Y60-L64 HydrophobicContact CE1-CD1 4.31Å; Y60-L64 WeakPolarHBondContact O-CB 3.4Å; Y60-L64 PolarHBondContact O-N 3.35Å; L61-L64 WeakPolarHBondContact O-CB 3.21Å; L61-L64 PolarHBondContact O-N 3.13Å; V62-L64 VanDerWaalsContact C-N 3.29Å; V62-L64 PolarHBondContact O-N 3.17Å; L64-Q67 PolarHBondContact O-N 3.38Å; L64-N68 WeakPolarHBondContact O-CB 3.22Å; L64-N68 PolarHBondContact O-N 3.08Å; L64-N68 PolarHBondContact O-ND2 3.21Å
65	V	83.5	Confident	76.8	Confident	80 Å²	80	92.4 Å²	92.4	49%	0.485	47%	0.474	S	S	.	.	H	α-helix	trans	-65.2	-42.8	177.2	170	0	0	0	0	110.1	L61 V62 N68 N69	L61-V65 VanDerWaalsContact O-CG2 3.3Å; L61-V65 WeakPolarHBondContact O-CG2 3.13Å; L61-V65 PolarHBondContact O-N 2.73Å; V62-V65 PolarHBondContact O-N 2.85Å; V65-N68 PolarHBondContact O-N 3.38Å; V65-N69 WeakPolarHBondContact CG1-ND2 3.41Å; V65-N69 WeakPolarHBondContact O-CB 3.38Å; V65-N69 PolarHBondContact O-N 3.35Å; V65-N69 PolarHBondContact O-ND2 3.07Å
66	D	81.9	Confident	75.2	Confident	88 Å²	88	91.6 Å²	91.6	47%	0.471	48%	0.477	S	S	.	.	H	α-helix	trans	-62.2	-45.4	176.5	-75.5	-19	0	0	0	111.1	V62 S63 N68 N69 L70	V62-D66 WeakPolarHBondContact O-CB 3.41Å; V62-D66 PolarHBondContact O-N 3.36Å; S63-D66 PolarHBondContact O-N 3.4Å; D66-N68 PolarHBondContact O-N 3.22Å; D66-N69 PolarHBondContact O-N 3.02Å; D66-L70 WeakPolarHBondContact O-CG 3.47Å; D66-L70 PolarHBondContact O-N 2.98Å
67	Q	78.2	Confident	73.3	Confident	104 Å²	104	89.4 Å²	89.4	49%	0.486	48%	0.48	S	S	.	.	H	α-helix	trans	-58.8	-48.7	175.3	-73.9	169.8	14.5	0	0	111.9	S63 L64 N69 L70 D71	S63-Q67 WeakPolarHBondContact O-CB 3.45Å; S63-Q67 WeakPolarHBondContact O-CG 3.44Å; S63-Q67 PolarHBondContact O-N 3.49Å; L64-Q67 PolarHBondContact O-N 3.38Å; Q67-N69 VanDerWaalsContact C-N 3.3Å; Q67-N69 PolarHBondContact O-N 3.44Å; Q67-L70 PolarHBondContact O-N 2.94Å; Q67-D71 PolarHBondContact O-N 3.47Å
68	N	75.5	Confident	71.8	Confident	42 Å²	42	94 Å²	94	23%	0.225	51%	0.509	C	S	.	.	H	α-helix	trans	-63.1	-34.3	177.3	-82.7	-83.6	0	0	0	112.6	E17 L64 V65 D66 S72	E17-N68 PolarHBondContact OE2-ND2 3.05Å; E17-N68 VanDerWaalsContact OE2-ND2 3.13Å; L64-N68 WeakPolarHBondContact O-CB 3.22Å; L64-N68 PolarHBondContact O-N 3.08Å; L64-N68 PolarHBondContact O-ND2 3.21Å; V65-N68 PolarHBondContact O-N 3.38Å; D66-N68 PolarHBondContact O-N 3.22Å; N68-S72 WeakPolarHBondContact O-CB 3.43Å; N68-S72 PolarHBondContact O-N 2.87Å; N68-S72 VanDerWaalsContact O-N 3.17Å; N68-S72 PolarHBondContact O-OG 2.87Å
69	N	70.1	Confident	69.8	Low	94 Å²	94	97.2 Å²	97.2	50%	0.503	53%	0.526	S	S	.	.	H	α-helix	trans	-73.1	-34.6	175.5	-80.4	-65.4	0	0	0	112.7	V65 D66 Q67 S72 K73	V65-N69 WeakPolarHBondContact CG1-ND2 3.41Å; V65-N69 WeakPolarHBondContact O-CB 3.38Å; V65-N69 PolarHBondContact O-N 3.35Å; V65-N69 PolarHBondContact O-ND2 3.07Å; D66-N69 PolarHBondContact O-N 3.02Å; Q67-N69 VanDerWaalsContact C-N 3.3Å; Q67-N69 PolarHBondContact O-N 3.44Å; N69-S72 PolarHBondContact O-N 3.39Å; N69-K73 WeakPolarHBondContact O-CB 3.22Å; N69-K73 PolarHBondContact O-N 3.28Å; N69-K73 VanDerWaalsContact O-N 3.08Å
70	L	62.9	Low	68.2	Low	118 Å²	118	99.6 Å²	99.6	62%	0.618	54%	0.541	S	S	*	.	H	α-helix	trans	-67	-43.1	174.9	-69	170.7	0	0	0	111.1	D66 Q67 S72 K73 Q74	D66-L70 WeakPolarHBondContact O-CG 3.47Å; D66-L70 PolarHBondContact O-N 2.98Å; Q67-L70 PolarHBondContact O-N 2.94Å; L70-S72 PolarHBondContact O-N 3.34Å; L70-K73 PolarHBondContact O-N 3.19Å; L70-Q74 PolarHBondContact O-N 3.2Å
71	D	58.4	Low	66.2	Low	109 Å²	109	103.4 Å²	103.4	58%	0.583	58%	0.583	S	S	*	*	H	α-helix	trans	-61.2	-35.1	174.7	-68.2	-14.8	0	0	0	111.7	Q67 K73	Q67-D71 PolarHBondContact O-N 3.47Å; D71-K73 VanDerWaalsContact C-N 3.35Å
72	S	56.5	Low	65.1	Low	80 Å²	80	107.6 Å²	107.6	56%	0.559	61%	0.606	S	S	*	*	H	α-helix	trans	-74.7	-22.5	176.6	-56	0	0	0	0	113.4	N68 N69 L70 T75	N68-S72 WeakPolarHBondContact O-CB 3.43Å; N68-S72 PolarHBondContact O-N 2.87Å; N68-S72 VanDerWaalsContact O-N 3.17Å; N68-S72 PolarHBondContact O-OG 2.87Å; N69-S72 PolarHBondContact O-N 3.39Å; L70-S72 PolarHBondContact O-N 3.34Å; S72-T75 PolarHBondContact O-OG1 3.33Å
73	K	51.4	Low	63.9	Low	155 Å²	155	108.7 Å²	108.7	67%	0.674	61%	0.611	S	S	*	*	H	α-helix	trans	-91.3	-15.7	-176.6	-156.8	169	-178.4	179.7	0	113.2	N69 L70 D71 T75	N69-K73 WeakPolarHBondContact O-CB 3.22Å; N69-K73 PolarHBondContact O-N 3.28Å; N69-K73 VanDerWaalsContact O-N 3.08Å; L70-K73 PolarHBondContact O-N 3.19Å; D71-K73 VanDerWaalsContact C-N 3.35Å; K73-T75 PolarHBondContact O-N 3.44Å
74	Q	49.7	Very low	62.6	Low	161 Å²	161	112.1 Å²	112.1	75%	0.752	63%	0.626	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.5	-5.2	178.1	-166.3	161.2	6.2	0	0	113.9	L70	L70-Q74 PolarHBondContact O-N 3.2Å
75	T	51.7	Low	61.4	Low	109 Å²	109	118.1 Å²	118.1	67%	0.669	66%	0.66	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92	4.6	-178.8	63	0	0	0	0	115.4	S72 K73	S72-T75 PolarHBondContact O-OG1 3.33Å; K73-T75 PolarHBondContact O-N 3.44Å
76	V	56.8	Low	60	Low	108 Å²	108	120.4 Å²	120.4	66%	0.655	67%	0.671	S	S	*	*	S	Bend	trans	-107.8	-16	-170.5	-163.7	0	0	0	0	114.5
77	D	52.2	Low	58.5	Low	149 Å²	149	122.6 Å²	122.6	80%	0.797	68%	0.684	S	S	*	*	S	Bend	trans	-109.2	19.8	-169.4	-65.2	-34.3	0	0	0	115.9
78	T	58.9	Low	57.1	Low	117 Å²	117	123.9 Å²	123.9	72%	0.718	70%	0.698	S	S	*	*	S	Bend	trans	-112.4	1.3	179.1	55.5	0	0	0	0	116.8
79	D	50.4	Low	55.7	Low	153 Å²	153	130.2 Å²	130.2	82%	0.818	74%	0.735	S	S	*	*			trans	-117.8	44.6	-179.8	-70.9	-44.8	0	0	0	113.6
80	T	56.7	Low	54.5	Low	144 Å²	144	133.3 Å²	133.3	88%	0.883	75%	0.754	S	S	*	*			trans	-112.2	92.6	160.2	-58.1	0	0	0	0	108.6
81	C	48.6	Very low	53.7	Low	196 Å²	196	134.6 Å²	134.6	100%	1.324	77%	0.767	S	S	*	*			trans	-75.5	0	166.1	-164.7	0	0	0	0	110.8

Retrieved 81 of 81 residues in 28.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).