G4LUX0_SCHMA Loading...

4.1 G protein, putative

AlphaFold DB , UniProt , Accession G4LUX0, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 44 aa.

						>G4LUX0_SCHMA|G4LUX0
MIKNQICSDTKTSGRRNVHGDVKQPSVKCISTPTDMYLPQFISE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.9	Low	71	Confident	200 Å²	200	118.6 Å²	118.6	99%	0.985	60%	0.603	S	S	*	*				0	100.2	0	-61.2	172.3	179.4	0	0	108.3	K3 D35	M1-K3 PolarHBondContact O-N 3.03Å; M1-D35 WeakPolarHBondContact CG-OD2 3.34Å
2	I	52	Low	70.9	Confident	143 Å²	143	112.5 Å²	112.5	73%	0.733	58%	0.576	S	S	*	*			trans	-79.5	115.3	172.8	-62.8	170.8	0	0	0	106.1	N4 T34	I2-N4 PolarHBondContact O-N 2.94Å; I2-T34 PolarHBondContact O-OG1 2.82Å; I2-T34 VanDerWaalsContact O-OG1 3.09Å
3	K	61.7	Low	71	Confident	165 Å²	165	111.6 Å²	111.6	72%	0.717	59%	0.586	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-80.3	112.4	174.9	-66.2	179.7	-179.6	178.9	0	107.6	M1	M1-K3 PolarHBondContact O-N 3.03Å
4	N	65.8	Low	71	Confident	82 Å²	82	109 Å²	109	44%	0.439	60%	0.599	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-83.2	123.4	167	-72.4	44	0	0	0	107.9	I2 T32 T34	I2-N4 PolarHBondContact O-N 2.94Å; N4-T32 PolarHBondContact O-N 3.01Å; N4-T32 VanDerWaalsContact O-N 3.14Å; N4-T32 PolarHBondContact O-OG1 3.16Å; N4-T34 WeakPolarHBondContact CB-OG1 3.43Å; N4-T34 PolarHBondContact N-OG1 2.83Å; N4-T34 PolarHBondContact OD1-OG1 2.9Å
5	Q	76	Confident	71.6	Confident	127 Å²	127	113.3 Å²	113.3	59%	0.593	60%	0.603	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-93.6	119.3	174.7	-172.9	179.6	94.4	0	0	108.3	C7 C29 I30	Q5-C7 PolarHBondContact OE1-SG 2.87Å; Q5-C29 HydrophobicContact CG-CB 3.62Å; Q5-I30 WeakPolarHBondContact CA-O 3.39Å
6	I	81.6	Confident	72.6	Confident	85 Å²	85	117.1 Å²	117.1	44%	0.436	61%	0.607	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-98.6	118.1	172.7	-56.5	173	0	0	0	106.9	C29 I30 T32	I6-C29 CarbonylContact O-C 3.52Å; I6-C29 WeakPolarHBondContact O-CA 2.96Å; I6-C29 VanDerWaalsContact O-CA 3.27Å; I6-I30 HydrophobicContact CB-CG1 4.03Å; I6-I30 PolarHBondContact N-O 3.29Å; I6-I30 PolarHBondContact O-N 2.85Å; I6-T32 HydrophobicContact CD1-CG2 3.83Å
7	C	81.9	Confident	73	Confident	63 Å²	63	113.5 Å²	113.5	43%	0.426	59%	0.588	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-102.2	139.8	175.1	-63.2	0	0	0	0	110.5	Q5 V27 K28 C29	Q5-C7 PolarHBondContact OE1-SG 2.87Å; C7-V27 HydrophobicContact CB-CG1 3.97Å; C7-K28 CarbonylContact C-O 3.57Å; C7-K28 WeakPolarHBondContact CA-O 3.1Å; C7-C29 HydrophobicContact CB-CB 4.17Å; C7-C29 PolarHBondContact SG-SG 2.95Å; C7-C29 CovalentContact SG-SG 2.06Å; C7-C29 WeakPolarHBondContact CB-SG 3.5Å; C7-C29 WeakPolarHBondContact SG-CB 3.42Å
8	S	81.4	Confident	73.8	Confident	75 Å²	75	115.1 Å²	115.1	52%	0.524	60%	0.604	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-137	129.4	174.7	-62.8	0	0	0	0	110	K28	S8-K28 PolarHBondContact N-O 2.8Å; S8-K28 PolarHBondContact O-N 3.34Å
9	D	82.5	Confident	74.8	Confident	113 Å²	113	117.2 Å²	117.2	60%	0.604	61%	0.61	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-80.7	130.8	175.7	-58.2	-38.7	0	0	0	110.1	K11 V27	D9-K11 PolarHBondContact O-N 3.41Å; D9-V27 VanDerWaalsContact OD1-CG2 3.23Å; D9-V27 WeakPolarHBondContact OD1-CG2 3.41Å
10	T	73	Confident	75.3	Confident	46 Å²	46	113 Å²	113	28%	0.282	60%	0.596	S	S	.	*			trans	-74	118.4	168.7	59	0	0	0	0	109.1	T12 P25 S26 K28	T10-T12 PolarHBondContact O-N 3.09Å; T10-P25 WeakPolarHBondContact O-CB 3.43Å; T10-S26 PolarHBondContact N-O 3.03Å; T10-S26 PolarHBondContact OG1-OG 2.75Å; T10-S26 VanDerWaalsContact OG1-O 3.12Å; T10-S26 PolarHBondContact OG1-O 2.88Å; T10-S26 VanDerWaalsContact OG1-N 3.1Å; T10-S26 PolarHBondContact OG1-N 3.13Å; T10-S26 WeakPolarHBondContact CG2-OG 3.37Å; T10-K28 HydrophobicContact CG2-CD 4.36Å
11	K	73.5	Confident	75.7	Confident	206 Å²	206	112 Å²	112	90%	0.896	59%	0.591	S	S	*	*			trans	-62.5	109.9	170.2	-65.9	-175.4	-179.2	-179.3	0	109.5	D9 S13	D9-K11 PolarHBondContact O-N 3.41Å; K11-S13 PolarHBondContact O-N 3.14Å; K11-S13 VanDerWaalsContact O-N 3.12Å
12	T	69.6	Low	77.1	Confident	45 Å²	45	107.9 Å²	107.9	28%	0.276	58%	0.577	S	S	.	*			trans	-80.5	90	168.8	36.3	0	0	0	0	108.5	T10 G14 K23	T10-T12 PolarHBondContact O-N 3.09Å; T12-G14 VanDerWaalsContact C-N 3.31Å; T12-G14 PolarHBondContact O-N 3.43Å; T12-K23 WeakPolarHBondContact CB-O 3.27Å; T12-K23 HydrophobicContact CG2-CB 3.53Å; T12-K23 WeakPolarHBondContact CG2-O 3.46Å; T12-K23 PolarHBondContact OG1-O 3.43Å
13	S	71.9	Confident	78.4	Confident	101 Å²	101	105.3 Å²	105.3	71%	0.706	56%	0.561	S	S	*	*			trans	-63.1	85.8	177.2	175.5	0	0	0	0	111.1	K11 R15	K11-S13 PolarHBondContact O-N 3.14Å; K11-S13 VanDerWaalsContact O-N 3.12Å; S13-R15 WeakPolarHBondContact O-CG 3.1Å; S13-R15 PolarHBondContact O-N 2.82Å
14	G	71.1	Confident	79.1	Confident	75 Å²	75	105.8 Å²	105.8	77%	0.773	57%	0.565	S	S	*	*	S	Bend	trans	55.6	7.5	171.5	0	0	0	0	0	116.5	T12	T12-G14 VanDerWaalsContact C-N 3.31Å; T12-G14 PolarHBondContact O-N 3.43Å
15	R	80.2	Confident	79.7	Confident	174 Å²	174	105.6 Å²	105.6	66%	0.657	57%	0.569	S	S	*	*			trans	-78.7	127	-176.2	-77.5	172.8	173.3	169	-1.7	108.1	S13 K23	S13-R15 WeakPolarHBondContact O-CG 3.1Å; S13-R15 PolarHBondContact O-N 2.82Å; R15-K23 HydrophobicContact CB-CD 3.78Å; R15-K23 HydrophobicContact CB-CG 4.44Å; R15-K23 WeakPolarHBondContact O-CB 3.23Å; R15-K23 WeakPolarHBondContact O-CG 3.13Å; R15-K23 PolarHBondContact O-N 2.8Å
16	R	87	Confident	80	Confident	174 Å²	174	102.2 Å²	102.2	66%	0.657	56%	0.559	S	S	*	*	B	Isolated β-bridge	trans	-90.9	152.7	170.4	-65.6	-176.8	-74	165.5	-0.2	110.4	G20 D21 K23	R16-G20 WeakPolarHBondContact CD-O 3.44Å; R16-D21 CarbonylContact C-O 3.42Å; R16-D21 WeakPolarHBondContact CB-O 3.47Å; R16-D21 WeakPolarHBondContact CA-O 3.17Å; R16-K23 WeakPolarHBondContact O-CE 3.2Å
17	N	80.7	Confident	80.1	Confident	55 Å²	55	102.3 Å²	102.3	29%	0.294	56%	0.563	S	S	.	*			trans	-71.7	178.3	169.4	71.2	15.2	0	0	0	109.7	H19 G20 D21 K23	N17-H19 PolarHBondContact O-N 3.33Å; N17-H19 WeakPolarHBondContact OD1-CA 3.32Å; N17-H19 WeakPolarHBondContact OD1-CB 3.19Å; N17-H19 PolarHBondContact OD1-N 3.05Å; N17-G20 PolarHBondContact O-N 2.84Å; N17-G20 PolarHBondContact OD1-N 3.12Å; N17-D21 PolarHBondContact N-O 2.9Å; N17-D21 PolarHBondContact OD1-OD2 2.06Å; N17-D21 PolarHBondContact OD1-N 2.87Å; N17-D21 WeakPolarHBondContact ND2-CB 3.49Å; N17-D21 PolarHBondContact ND2-OD2 3.32Å; N17-K23 HydrophobicContact CB-CG 4.35Å
18	V	86.9	Confident	79.9	Confident	143 Å²	143	106 Å²	106	87%	0.867	57%	0.572	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.9	-17.8	179.7	-64.3	0	0	0	0	113.7
19	H	92.4	Very high	79.8	Confident	155 Å²	155	105 Å²	105	72%	0.718	57%	0.565	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.6	-1.4	176.3	-54.2	117.1	0	0	0	112.8	N17	N17-H19 PolarHBondContact O-N 3.33Å; N17-H19 WeakPolarHBondContact OD1-CA 3.32Å; N17-H19 WeakPolarHBondContact OD1-CB 3.19Å; N17-H19 PolarHBondContact OD1-N 3.05Å
20	G	84.3	Confident	79.7	Confident	33 Å²	33	104.5 Å²	104.5	34%	0.34	56%	0.561	S	S	.	*	S	Bend	trans	84.6	6.6	-179.3	0	0	0	0	0	114.7	R16 N17	R16-G20 WeakPolarHBondContact CD-O 3.44Å; N17-G20 PolarHBondContact O-N 2.84Å; N17-G20 PolarHBondContact OD1-N 3.12Å
21	D	85.4	Confident	80	Confident	93 Å²	93	105.9 Å²	105.9	50%	0.497	57%	0.572	S	S	.	*	P	Polyproline II helix	trans	-77	145.9	172.9	-44.9	-60.7	0	0	0	110	R16 N17 K23	R16-D21 CarbonylContact C-O 3.42Å; R16-D21 WeakPolarHBondContact CB-O 3.47Å; R16-D21 WeakPolarHBondContact CA-O 3.17Å; N17-D21 PolarHBondContact N-O 2.9Å; N17-D21 PolarHBondContact OD1-OD2 2.06Å; N17-D21 PolarHBondContact OD1-N 2.87Å; N17-D21 WeakPolarHBondContact ND2-CB 3.49Å; N17-D21 PolarHBondContact ND2-OD2 3.32Å; D21-K23 PolarHBondContact O-N 3.1Å; D21-K23 VanDerWaalsContact O-N 3.16Å
22	V	81.4	Confident	79.7	Confident	112 Å²	112	98.2 Å²	98.2	68%	0.679	54%	0.543	S	S	*	.	B	Isolated β-bridge	trans	-55.2	123.9	169.2	178.4	0	0	0	0	108	Q24	V22-Q24 PolarHBondContact O-N 3.12Å
23	K	77.7	Confident	79.3	Confident	90 Å²	90	100.9 Å²	100.9	39%	0.391	56%	0.561	S	S	.	*	P	Polyproline II helix	trans	-58.2	119.7	176.5	-76	-175.8	-174.5	-168.5	0	108	T12 R15 R16 N17 D21	T12-K23 WeakPolarHBondContact CB-O 3.27Å; T12-K23 HydrophobicContact CG2-CB 3.53Å; T12-K23 WeakPolarHBondContact CG2-O 3.46Å; T12-K23 PolarHBondContact OG1-O 3.43Å; R15-K23 HydrophobicContact CB-CD 3.78Å; R15-K23 HydrophobicContact CB-CG 4.44Å; R15-K23 WeakPolarHBondContact O-CB 3.23Å; R15-K23 WeakPolarHBondContact O-CG 3.13Å; R15-K23 PolarHBondContact O-N 2.8Å; R16-K23 WeakPolarHBondContact O-CE 3.2Å; N17-K23 HydrophobicContact CB-CG 4.35Å; D21-K23 PolarHBondContact O-N 3.1Å; D21-K23 VanDerWaalsContact O-N 3.16Å
24	Q	77.1	Confident	78.6	Confident	175 Å²	175	98.1 Å²	98.1	82%	0.818	54%	0.54	S	S	*	.	P	Polyproline II helix	trans	-60	134.8	173.4	-68.6	-172.5	5.6	0	0	108.8	V22 S26	V22-Q24 PolarHBondContact O-N 3.12Å; Q24-S26 PolarHBondContact O-N 2.8Å
25	P	78.1	Confident	77.6	Confident	78 Å²	78	99.7 Å²	99.7	51%	0.506	53%	0.531	S	S	.	.	P	Polyproline II helix	trans	-59.6	128.3	171.6	25.9	-32.3	0	0	0	108.3	T10	T10-P25 WeakPolarHBondContact O-CB 3.43Å
26	S	82	Confident	76.2	Confident	56 Å²	56	99.5 Å²	99.5	39%	0.392	54%	0.539	S	S	.	.	P	Polyproline II helix	trans	-85.8	130	171.9	64	0	0	0	0	109.6	T10 Q24	T10-S26 PolarHBondContact N-O 3.03Å; T10-S26 PolarHBondContact OG1-OG 2.75Å; T10-S26 VanDerWaalsContact OG1-O 3.12Å; T10-S26 PolarHBondContact OG1-O 2.88Å; T10-S26 VanDerWaalsContact OG1-N 3.1Å; T10-S26 PolarHBondContact OG1-N 3.13Å; T10-S26 WeakPolarHBondContact CG2-OG 3.37Å; Q24-S26 PolarHBondContact O-N 2.8Å
27	V	83.5	Confident	74.7	Confident	87 Å²	87	101.2 Å²	101.2	53%	0.527	55%	0.547	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.8	122.6	171.3	-168.7	0	0	0	0	107.9	C7 D9	C7-V27 HydrophobicContact CB-CG1 3.97Å; D9-V27 VanDerWaalsContact OD1-CG2 3.23Å; D9-V27 WeakPolarHBondContact OD1-CG2 3.41Å
28	K	78.6	Confident	73.2	Confident	139 Å²	139	105.2 Å²	105.2	60%	0.604	57%	0.568	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-107.9	121.5	170.3	-67.8	-173.9	-179.6	-176.6	0	108.8	C7 S8 T10	C7-K28 CarbonylContact C-O 3.57Å; C7-K28 WeakPolarHBondContact CA-O 3.1Å; S8-K28 PolarHBondContact N-O 2.8Å; S8-K28 PolarHBondContact O-N 3.34Å; T10-K28 HydrophobicContact CG2-CD 4.36Å
29	C	78.7	Confident	71.5	Confident	55 Å²	55	103 Å²	103	37%	0.372	56%	0.557	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-110	128.2	175.8	-59	0	0	0	0	109.9	Q5 I6 C7	Q5-C29 HydrophobicContact CG-CB 3.62Å; I6-C29 CarbonylContact O-C 3.52Å; I6-C29 WeakPolarHBondContact O-CA 2.96Å; I6-C29 VanDerWaalsContact O-CA 3.27Å; C7-C29 HydrophobicContact CB-CB 4.17Å; C7-C29 PolarHBondContact SG-SG 2.95Å; C7-C29 CovalentContact SG-SG 2.06Å; C7-C29 WeakPolarHBondContact CB-SG 3.5Å; C7-C29 WeakPolarHBondContact SG-CB 3.42Å
30	I	80.8	Confident	69.7	Low	102 Å²	102	103.7 Å²	103.7	52%	0.523	56%	0.56	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-106.5	137.5	171.6	60.3	170.3	0	0	0	109	Q5 I6 T32	Q5-I30 WeakPolarHBondContact CA-O 3.39Å; I6-I30 HydrophobicContact CB-CG1 4.03Å; I6-I30 PolarHBondContact N-O 3.29Å; I6-I30 PolarHBondContact O-N 2.85Å; I30-T32 HydrophobicContact CD1-CG2 3.91Å; I30-T32 HydrophobicContact CG1-CG2 4.29Å
31	S	79.9	Confident	68.2	Low	75 Å²	75	111.8 Å²	111.8	52%	0.524	59%	0.586	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-88.1	105.7	167.5	-61.9	0	0	0	0	107.2
32	T	66.3	Low	66.6	Low	45 Å²	45	114.9 Å²	114.9	28%	0.276	60%	0.601	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-83.8	133.2	169.5	52.6	0	0	0	0	108.5	N4 I6 I30 T34	N4-T32 PolarHBondContact O-N 3.01Å; N4-T32 VanDerWaalsContact O-N 3.14Å; N4-T32 PolarHBondContact O-OG1 3.16Å; I6-T32 HydrophobicContact CD1-CG2 3.83Å; I30-T32 HydrophobicContact CD1-CG2 3.91Å; I30-T32 HydrophobicContact CG1-CG2 4.29Å; T32-T34 VanDerWaalsContact O-N 3.13Å; T32-T34 PolarHBondContact O-N 3.02Å
33	P	61.3	Low	65	Low	101 Å²	101	114.9 Å²	114.9	66%	0.656	61%	0.606	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-65.1	113.7	167.5	27.3	-30.6	0	0	0	107.8	D35	P33-D35 PolarHBondContact O-N 3.18Å
34	T	58.3	Low	63.6	Low	44 Å²	44	123.2 Å²	123.2	27%	0.27	65%	0.647	S	S	.	*	T	Hydrogen-bonded Turn	trans	-73.1	20.5	177.2	-39.3	0	0	0	0	112.2	I2 N4 T32	I2-T34 PolarHBondContact O-OG1 2.82Å; I2-T34 VanDerWaalsContact O-OG1 3.09Å; N4-T34 WeakPolarHBondContact CB-OG1 3.43Å; N4-T34 PolarHBondContact N-OG1 2.83Å; N4-T34 PolarHBondContact OD1-OG1 2.9Å; T32-T34 VanDerWaalsContact O-N 3.13Å; T32-T34 PolarHBondContact O-N 3.02Å
35	D	48.5	Very low	62.9	Low	108 Å²	108	120.7 Å²	120.7	58%	0.578	64%	0.638	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.9	10.4	-174.5	-80.1	-50.9	0	0	0	114.4	M1 P33	M1-D35 WeakPolarHBondContact CG-OD2 3.34Å; P33-D35 PolarHBondContact O-N 3.18Å
36	M	50.8	Low	62.2	Low	170 Å²	170	122.9 Å²	122.9	84%	0.837	65%	0.645	S	S	*	*	S	Bend	trans	-121.5	-7.2	172.8	-61.9	-157.5	-62.4	0	0	115.3
37	Y	57.5	Low	61.1	Low	210 Å²	210	126.6 Å²	126.6	82%	0.824	66%	0.659	S	S	*	*			trans	-126.4	38.2	175.7	-67.8	-80.2	0	0	0	112.1	P39	Y37-P39 VanDerWaalsContact C-CD 3.5Å; Y37-P39 WeakPolarHBondContact O-CD 3.18Å
38	L	48.8	Very low	59.7	Low	139 Å²	139	128.9 Å²	128.9	73%	0.728	67%	0.667	S	S	*	*			trans	-74.9	104.7	144.3	-128.8	86.3	0	0	0	104	Q40	L38-Q40 PolarHBondContact O-N 2.99Å
39	P	50.1	Low	58.6	Low	97 Å²	97	128.3 Å²	128.3	63%	0.63	67%	0.671	S	S	*	*			trans	-53.5	110	154	24.9	-30.3	0	0	0	104.1	Y37 F41	Y37-P39 VanDerWaalsContact C-CD 3.5Å; Y37-P39 WeakPolarHBondContact O-CD 3.18Å; P39-F41 VanDerWaalsContact C-N 3.25Å; P39-F41 PolarHBondContact O-N 3.03Å
40	Q	55	Low	57.2	Low	168 Å²	168	133.2 Å²	133.2	79%	0.785	69%	0.69	S	S	*	*			trans	-50.7	110.7	155.6	-84.2	171.1	-32.2	0	0	103.3	L38 I42	L38-Q40 PolarHBondContact O-N 2.99Å; Q40-I42 VanDerWaalsContact C-N 3.32Å; Q40-I42 PolarHBondContact O-N 2.92Å
41	F	52.9	Low	55.5	Low	203 Å²	203	135.4 Å²	135.4	89%	0.89	70%	0.702	S	S	*	*			trans	-46.4	117.1	153.8	-87.3	-93.4	0	0	0	104.8	P39	P39-F41 VanDerWaalsContact C-N 3.25Å; P39-F41 PolarHBondContact O-N 3.03Å
42	I	52.5	Low	53.7	Low	158 Å²	158	140.1 Å²	140.1	81%	0.81	72%	0.716	S	S	*	*			trans	-65.3	141.1	-157.5	-50.2	165.3	0	0	0	106.8	Q40 E44	Q40-I42 VanDerWaalsContact C-N 3.32Å; Q40-I42 PolarHBondContact O-N 2.92Å; I42-E44 PolarHBondContact O-N 3.41Å
43	S	47.2	Very low	52.6	Low	112 Å²	112	148 Å²	148	78%	0.783	75%	0.753	S	S	*	*			trans	-46.3	111.7	168.6	-58.4	0	0	0	0	110.2
44	E	48.7	Very low	51.8	Low	266 Å²	266	152.3 Å²	152.3	100%	1.243	76%	0.762	S	S	*	*				164.3	0	112.6	-147.4	171	119.3	0	0	109.9	I42	I42-E44 PolarHBondContact O-N 3.41Å

Retrieved 44 of 44 residues in 8.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).