G4LWT0_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession G4LWT0, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 148 aa.

						>G4LWT0_SCHMA|G4LWT0
MSHRLTRGQCLIAEVASYLVVAREVAAASSPVNSQASFDKTRSTDMSLGLVDSGSAASKSCPSNNSPHSFRSRFNKVPFQIEKLFDGDEELCSCLPSEFIPSSGNHPGSLKLPPGSSSSPALQCKTSYNFKTHWLPICQRFEDRSSND
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	37.1	Very low	58.8	Low	231 Å²	231	113.8 Å²	113.8	100%	1.138	57%	0.572	S	S	*	*				0	102.7	0	-70.2	176.1	176.3	0	0	107	H3	M1-H3 PolarHBondContact O-N 3.01Å
2	S	49.5	Very low	59.8	Low	116 Å²	116	114.3 Å²	114.3	81%	0.811	58%	0.575	S	S	*	*			trans	-74.2	115.7	176.5	-53.8	0	0	0	0	107.9	R4	S2-R4 VanDerWaalsContact C-N 3.34Å; S2-R4 PolarHBondContact O-N 2.82Å
3	H	55.8	Low	60.5	Low	175 Å²	175	107.8 Å²	107.8	81%	0.81	55%	0.551	S	S	*	*			trans	-63.1	94.6	177.5	-70.9	-82	0	0	0	108.8	M1 L5	M1-H3 PolarHBondContact O-N 3.01Å; H3-L5 PolarHBondContact O-N 2.98Å
4	R	55.6	Low	60.9	Low	179 Å²	179	104.9 Å²	104.9	68%	0.675	53%	0.534	S	S	*	.	P	Polyproline II helix	trans	-65.7	116.1	174.2	-68.7	-179	75.3	-174.2	3.1	107.6	S2 L91	S2-R4 VanDerWaalsContact C-N 3.34Å; S2-R4 PolarHBondContact O-N 2.82Å; R4-L91 VanDerWaalsContact NH2-CD2 3.27Å
5	L	61.7	Low	61.6	Low	68 Å²	68	104.3 Å²	104.3	36%	0.356	54%	0.537	S	S	.	.	P	Polyproline II helix	trans	-86.9	140.8	173.2	-65.7	175.7	0	0	0	109.1	H3 Q9	H3-L5 PolarHBondContact O-N 2.98Å; L5-Q9 VanDerWaalsContact CA-OE1 3.25Å; L5-Q9 HydrophobicContact CB-CB 3.99Å; L5-Q9 HydrophobicContact CD2-CB 4.03Å; L5-Q9 HydrophobicContact CG-CB 4.48Å
6	T	68.2	Low	62.2	Low	87 Å²	87	100.8 Å²	100.8	53%	0.534	53%	0.528	S	S	.	.	P	Polyproline II helix	trans	-71.7	157.7	168.7	65.1	0	0	0	0	109.9	G8 Q9 C10	T6-G8 PolarHBondContact O-N 2.82Å; T6-G8 VanDerWaalsContact O-N 3.12Å; T6-Q9 WeakPolarHBondContact O-CA 3.35Å; T6-Q9 WeakPolarHBondContact O-CB 3.31Å; T6-Q9 PolarHBondContact O-N 2.99Å; T6-Q9 WeakPolarHBondContact OG1-CG 3.35Å; T6-C10 PolarHBondContact O-N 3.46Å
7	R	56.4	Low	62.4	Low	173 Å²	173	95.7 Å²	95.7	65%	0.653	50%	0.503	S	S	*	.	H	α-helix	trans	-49.4	-41.3	177.7	-174.5	176.8	-176.8	-121.3	0.4	113	C10 L11 E90	R7-C10 PolarHBondContact O-N 3.11Å; R7-L11 WeakPolarHBondContact O-CG 3.34Å; R7-L11 PolarHBondContact O-N 2.9Å; R7-L11 VanDerWaalsContact O-N 3.08Å; R7-E90 IonicContact NE-OE2 3.95Å
8	G	66.9	Low	62.5	Low	37 Å²	37	96.4 Å²	96.4	38%	0.381	50%	0.499	S	S	.	.	H	α-helix	trans	-63.6	-39.6	175.9	0	0	0	0	0	113	T6 L11 I12	T6-G8 PolarHBondContact O-N 2.82Å; T6-G8 VanDerWaalsContact O-N 3.12Å; G8-L11 PolarHBondContact O-N 2.69Å; G8-I12 VanDerWaalsContact O-CG1 3.26Å; G8-I12 WeakPolarHBondContact O-CG1 3.43Å; G8-I12 PolarHBondContact O-N 3.11Å
9	Q	67.7	Low	62.8	Low	89 Å²	89	95.7 Å²	95.7	42%	0.416	50%	0.495	S	S	.	.	H	α-helix	trans	-67.2	-36.1	176.8	-69.8	170.6	-20.4	0	0	112.1	L5 T6 I12 A13	L5-Q9 VanDerWaalsContact CA-OE1 3.25Å; L5-Q9 HydrophobicContact CB-CB 3.99Å; L5-Q9 HydrophobicContact CD2-CB 4.03Å; L5-Q9 HydrophobicContact CG-CB 4.48Å; T6-Q9 WeakPolarHBondContact O-CA 3.35Å; T6-Q9 WeakPolarHBondContact O-CB 3.31Å; T6-Q9 PolarHBondContact O-N 2.99Å; T6-Q9 WeakPolarHBondContact OG1-CG 3.35Å; Q9-I12 PolarHBondContact O-N 3.12Å; Q9-A13 WeakPolarHBondContact O-CB 3.32Å; Q9-A13 PolarHBondContact O-N 2.86Å
10	C	63.6	Low	63.1	Low	7 Å²	7	94.7 Å²	94.7	5%	0.047	49%	0.494	C	S	.	.	H	α-helix	trans	-65.6	-43.4	173.3	-72.4	0	0	0	0	112.3	T6 R7 I12 A13 E14 C92	T6-C10 PolarHBondContact O-N 3.46Å; R7-C10 PolarHBondContact O-N 3.11Å; C10-I12 VanDerWaalsContact C-N 3.33Å; C10-I12 PolarHBondContact O-N 2.8Å; C10-A13 PolarHBondContact O-N 2.77Å; C10-E14 WeakPolarHBondContact O-CB 3.39Å; C10-E14 PolarHBondContact O-N 3.17Å; C10-C92 HydrophobicContact CB-CB 4.07Å; C10-C92 WeakPolarHBondContact SG-CB 3.28Å
11	L	64.1	Low	63.1	Low	90 Å²	90	92.3 Å²	92.3	47%	0.471	48%	0.483	S	S	.	.	H	α-helix	trans	-61.4	-41.5	174.9	-71	171.4	0	0	0	111.7	R7 G8 E14 V15	R7-L11 WeakPolarHBondContact O-CG 3.34Å; R7-L11 PolarHBondContact O-N 2.9Å; R7-L11 VanDerWaalsContact O-N 3.08Å; G8-L11 PolarHBondContact O-N 2.69Å; L11-E14 PolarHBondContact O-N 2.7Å; L11-V15 VanDerWaalsContact O-CG2 3.3Å; L11-V15 WeakPolarHBondContact O-CG2 3.32Å; L11-V15 PolarHBondContact O-N 3.15Å
12	I	71.3	Confident	64.3	Low	119 Å²	119	84.1 Å²	84.1	61%	0.61	45%	0.452	S	S	*	.	H	α-helix	trans	-64.6	-42.9	176.1	-68	164.3	0	0	0	110.8	G8 Q9 C10 E14 V15 A16	G8-I12 VanDerWaalsContact O-CG1 3.26Å; G8-I12 WeakPolarHBondContact O-CG1 3.43Å; G8-I12 PolarHBondContact O-N 3.11Å; Q9-I12 PolarHBondContact O-N 3.12Å; C10-I12 VanDerWaalsContact C-N 3.33Å; C10-I12 PolarHBondContact O-N 2.8Å; I12-E14 VanDerWaalsContact C-N 3.34Å; I12-E14 PolarHBondContact O-N 2.98Å; I12-V15 PolarHBondContact O-N 2.8Å; I12-A16 WeakPolarHBondContact O-CB 3.13Å; I12-A16 PolarHBondContact O-N 3.1Å
13	A	69.2	Low	64.8	Low	31 Å²	31	87 Å²	87	26%	0.256	45%	0.445	S	S	.	.	H	α-helix	trans	-63.8	-40.2	178	0	0	0	0	0	111.9	Q9 C10 A16 S17	Q9-A13 WeakPolarHBondContact O-CB 3.32Å; Q9-A13 PolarHBondContact O-N 2.86Å; C10-A13 PolarHBondContact O-N 2.77Å; A13-A16 PolarHBondContact O-N 3.01Å; A13-S17 WeakPolarHBondContact O-CB 3.02Å; A13-S17 PolarHBondContact O-N 2.68Å; A13-S17 PolarHBondContact O-OG 3.2Å
14	E	65.9	Low	64.9	Low	67 Å²	67	81.3 Å²	81.3	31%	0.313	42%	0.419	S	S	.	.	H	α-helix	trans	-61.8	-54.5	174.5	-177.8	172.1	-174.4	0	0	110.7	C10 L11 I12 A16 S17 Y18 I81	C10-E14 WeakPolarHBondContact O-CB 3.39Å; C10-E14 PolarHBondContact O-N 3.17Å; L11-E14 PolarHBondContact O-N 2.7Å; I12-E14 VanDerWaalsContact C-N 3.34Å; I12-E14 PolarHBondContact O-N 2.98Å; E14-A16 VanDerWaalsContact C-N 3.3Å; E14-A16 PolarHBondContact O-N 3.06Å; E14-S17 PolarHBondContact O-N 2.9Å; E14-S17 VanDerWaalsContact O-N 3.1Å; E14-S17 PolarHBondContact O-OG 2.87Å; E14-Y18 HydrophobicContact CG-CD2 3.8Å; E14-Y18 HydrophobicContact CG-CE2 3.5Å; E14-Y18 WeakPolarHBondContact O-CD2 3.19Å; E14-Y18 PolarHBondContact O-N 3.04Å; E14-I81 HydrophobicContact CB-CD1 4.27Å
15	V	70.7	Confident	65	Low	95 Å²	95	77 Å²	77	58%	0.576	41%	0.412	S	S	*	.	H	α-helix	trans	-59	-40.8	177.5	173.4	0	0	0	0	111.7	L11 I12 S17 Y18 L19	L11-V15 VanDerWaalsContact O-CG2 3.3Å; L11-V15 WeakPolarHBondContact O-CG2 3.32Å; L11-V15 PolarHBondContact O-N 3.15Å; I12-V15 PolarHBondContact O-N 2.8Å; V15-S17 VanDerWaalsContact C-N 3.35Å; V15-S17 PolarHBondContact O-N 3.43Å; V15-Y18 PolarHBondContact O-N 2.98Å; V15-L19 WeakPolarHBondContact O-CB 3.19Å; V15-L19 PolarHBondContact O-N 2.7Å
16	A	71.7	Confident	64.7	Low	49 Å²	49	76.3 Å²	76.3	41%	0.405	42%	0.416	S	S	.	.	H	α-helix	trans	-63.6	-40.6	176.9	0	0	0	0	0	111.8	I12 A13 E14 L19 V20	I12-A16 WeakPolarHBondContact O-CB 3.13Å; I12-A16 PolarHBondContact O-N 3.1Å; A13-A16 PolarHBondContact O-N 3.01Å; E14-A16 VanDerWaalsContact C-N 3.3Å; E14-A16 PolarHBondContact O-N 3.06Å; A16-L19 PolarHBondContact O-N 3.23Å; A16-V20 WeakPolarHBondContact O-CG2 3.42Å; A16-V20 PolarHBondContact O-N 3.34Å
17	S	64.8	Low	64.1	Low	14 Å²	14	75.7 Å²	75.7	10%	0.098	42%	0.42	C	S	.	.	H	α-helix	trans	-66.1	-41.6	176.2	73	0	0	0	0	112.5	A13 E14 V15 L19 V20 V21	A13-S17 WeakPolarHBondContact O-CB 3.02Å; A13-S17 PolarHBondContact O-N 2.68Å; A13-S17 PolarHBondContact O-OG 3.2Å; E14-S17 PolarHBondContact O-N 2.9Å; E14-S17 VanDerWaalsContact O-N 3.1Å; E14-S17 PolarHBondContact O-OG 2.87Å; V15-S17 VanDerWaalsContact C-N 3.35Å; V15-S17 PolarHBondContact O-N 3.43Å; S17-L19 VanDerWaalsContact C-N 3.3Å; S17-L19 PolarHBondContact O-N 2.82Å; S17-V20 PolarHBondContact O-N 3.43Å; S17-V21 WeakPolarHBondContact O-CG2 3.43Å; S17-V21 PolarHBondContact O-N 2.93Å; S17-V21 VanDerWaalsContact O-N 3.07Å
18	Y	65.6	Low	64	Low	108 Å²	108	70.6 Å²	70.6	42%	0.424	41%	0.414	S	S	.	.	H	α-helix	trans	-61	-41.1	172.6	-81.9	-68.8	0	0	0	111.6	E14 V15 V20 V21 A22	E14-Y18 HydrophobicContact CG-CD2 3.8Å; E14-Y18 HydrophobicContact CG-CE2 3.5Å; E14-Y18 WeakPolarHBondContact O-CD2 3.19Å; E14-Y18 PolarHBondContact O-N 3.04Å; V15-Y18 PolarHBondContact O-N 2.98Å; Y18-V20 VanDerWaalsContact C-N 3.34Å; Y18-V20 PolarHBondContact O-N 3.34Å; Y18-V21 PolarHBondContact O-N 3.47Å; Y18-A22 VanDerWaalsContact O-CB 3.24Å; Y18-A22 WeakPolarHBondContact O-CB 3.49Å; Y18-A22 PolarHBondContact O-N 3.49Å
19	L	67.6	Low	63.3	Low	83 Å²	83	72.9 Å²	72.9	44%	0.435	42%	0.424	S	S	.	.	H	α-helix	trans	-67.1	-34.9	179.9	-171.5	134.3	0	0	0	112.3	V15 A16 S17 R23	V15-L19 WeakPolarHBondContact O-CB 3.19Å; V15-L19 PolarHBondContact O-N 2.7Å; A16-L19 PolarHBondContact O-N 3.23Å; S17-L19 VanDerWaalsContact C-N 3.3Å; S17-L19 PolarHBondContact O-N 2.82Å; L19-R23 WeakPolarHBondContact O-CB 3.31Å; L19-R23 VanDerWaalsContact O-CG 3.28Å; L19-R23 WeakPolarHBondContact O-CG 3.18Å; L19-R23 PolarHBondContact O-N 3Å
20	V	68.6	Low	62	Low	76 Å²	76	72.4 Å²	72.4	46%	0.461	43%	0.431	S	S	.	.	H	α-helix	trans	-65.3	-48.5	172.5	172	0	0	0	0	110.6	A16 S17 Y18 A22 R23 E24	A16-V20 WeakPolarHBondContact O-CG2 3.42Å; A16-V20 PolarHBondContact O-N 3.34Å; S17-V20 PolarHBondContact O-N 3.43Å; Y18-V20 VanDerWaalsContact C-N 3.34Å; Y18-V20 PolarHBondContact O-N 3.34Å; V20-A22 PolarHBondContact O-N 3.5Å; V20-R23 PolarHBondContact O-N 3.04Å; V20-E24 PolarHBondContact O-N 3.39Å
21	V	63.5	Low	61.1	Low	45 Å²	45	77.3 Å²	77.3	27%	0.273	46%	0.463	S	S	.	.	H	α-helix	trans	-62.7	-45.2	178.5	175.5	0	0	0	0	111	S17 Y18 R23 E24 V25	S17-V21 WeakPolarHBondContact O-CG2 3.43Å; S17-V21 PolarHBondContact O-N 2.93Å; S17-V21 VanDerWaalsContact O-N 3.07Å; Y18-V21 PolarHBondContact O-N 3.47Å; V21-R23 PolarHBondContact O-N 3Å; V21-E24 PolarHBondContact O-N 3.27Å; V21-V25 HydrophobicContact CG1-CG2 4.37Å; V21-V25 VanDerWaalsContact O-CG2 3.31Å; V21-V25 WeakPolarHBondContact O-CG2 3.24Å; V21-V25 PolarHBondContact O-N 3.15Å
22	A	61.9	Low	60.2	Low	58 Å²	58	79.3 Å²	79.3	48%	0.479	48%	0.479	S	S	.	.	H	α-helix	trans	-64.2	-39	179.6	0	0	0	0	0	112.5	Y18 V20 V25 A26	Y18-A22 VanDerWaalsContact O-CB 3.24Å; Y18-A22 WeakPolarHBondContact O-CB 3.49Å; Y18-A22 PolarHBondContact O-N 3.49Å; V20-A22 PolarHBondContact O-N 3.5Å; A22-V25 PolarHBondContact O-N 3.23Å; A22-A26 VanDerWaalsContact O-CB 3.32Å; A22-A26 WeakPolarHBondContact O-CB 3.09Å; A22-A26 PolarHBondContact O-N 2.83Å
23	R	60.5	Low	58.6	Low	176 Å²	176	79.8 Å²	79.8	66%	0.664	48%	0.483	S	S	*	.	H	α-helix	trans	-66.2	-39.2	174.7	-79.6	-178.5	176.7	-178.9	1.3	112.3	L19 V20 V21 A26 A27	L19-R23 WeakPolarHBondContact O-CB 3.31Å; L19-R23 VanDerWaalsContact O-CG 3.28Å; L19-R23 WeakPolarHBondContact O-CG 3.18Å; L19-R23 PolarHBondContact O-N 3Å; V20-R23 PolarHBondContact O-N 3.04Å; V21-R23 PolarHBondContact O-N 3Å; R23-A26 PolarHBondContact O-N 2.87Å; R23-A27 WeakPolarHBondContact O-CB 3.41Å; R23-A27 PolarHBondContact O-N 3.26Å
24	E	56.9	Low	57.2	Low	57 Å²	57	83.3 Å²	83.3	27%	0.266	51%	0.505	S	S	.	.	H	α-helix	trans	-67.8	-40.1	175	-73.5	-156.8	166.2	0	0	112.1	V20 V21 A27 A28 S72 F74	V20-E24 PolarHBondContact O-N 3.39Å; V21-E24 PolarHBondContact O-N 3.27Å; E24-A27 PolarHBondContact O-N 3.07Å; E24-A28 VanDerWaalsContact O-CB 3.31Å; E24-A28 WeakPolarHBondContact O-CB 3.41Å; E24-A28 PolarHBondContact O-N 2.99Å; E24-S72 PolarHBondContact OE2-OG 3.5Å; E24-F74 WeakPolarHBondContact OE1-CD2 3.32Å
25	V	58	Low	55.8	Low	89 Å²	89	88.5 Å²	88.5	54%	0.539	53%	0.529	S	S	.	.	H	α-helix	trans	-63.5	-43.1	174.6	173.6	0	0	0	0	110.6	V21 A22 A27 A28 S29	V21-V25 HydrophobicContact CG1-CG2 4.37Å; V21-V25 VanDerWaalsContact O-CG2 3.31Å; V21-V25 WeakPolarHBondContact O-CG2 3.24Å; V21-V25 PolarHBondContact O-N 3.15Å; A22-V25 PolarHBondContact O-N 3.23Å; V25-A27 PolarHBondContact O-N 3.5Å; V25-A28 CarbonylContact O-C 3.34Å; V25-A28 PolarHBondContact O-N 3.32Å; V25-S29 WeakPolarHBondContact O-CB 3.34Å; V25-S29 PolarHBondContact O-N 3.07Å; V25-S29 PolarHBondContact O-OG 2.87Å
26	A	55.1	Low	54.3	Low	52 Å²	52	87.5 Å²	87.5	43%	0.43	53%	0.531	S	S	.	.	H	α-helix	trans	-63.5	-39.6	175.9	0	0	0	0	0	112.4	A22 R23 A28 S29 S30	A22-A26 VanDerWaalsContact O-CB 3.32Å; A22-A26 WeakPolarHBondContact O-CB 3.09Å; A22-A26 PolarHBondContact O-N 2.83Å; R23-A26 PolarHBondContact O-N 2.87Å; A26-A28 VanDerWaalsContact C-N 3.33Å; A26-S29 WeakPolarHBondContact CA-OG 3.47Å; A26-S29 PolarHBondContact O-N 3.32Å; A26-S29 PolarHBondContact O-OG 3.31Å; A26-S30 PolarHBondContact O-N 3.33Å
27	A	55.8	Low	52.6	Low	75 Å²	75	89.9 Å²	89.9	62%	0.62	55%	0.545	S	S	*	.	H	α-helix	trans	-68.3	-32.2	174.6	0	0	0	0	0	112.5	R23 E24 V25	R23-A27 WeakPolarHBondContact O-CB 3.41Å; R23-A27 PolarHBondContact O-N 3.26Å; E24-A27 PolarHBondContact O-N 3.07Å; V25-A27 PolarHBondContact O-N 3.5Å
28	A	54.8	Low	51.6	Low	65 Å²	65	98 Å²	98	54%	0.537	58%	0.579	S	S	.	*	H	α-helix	trans	-79.6	-25.8	176	0	0	0	0	0	113.2	E24 V25 A26	E24-A28 VanDerWaalsContact O-CB 3.31Å; E24-A28 WeakPolarHBondContact O-CB 3.41Å; E24-A28 PolarHBondContact O-N 2.99Å; V25-A28 CarbonylContact O-C 3.34Å; V25-A28 PolarHBondContact O-N 3.32Å; A26-A28 VanDerWaalsContact C-N 3.33Å
29	S	51.5	Low	50.4	Low	85 Å²	85	99.7 Å²	99.7	59%	0.594	60%	0.595	S	S	*	*	H	α-helix	trans	-94.2	-5.6	177.5	67.4	0	0	0	0	113.7	V25 A26 P31	V25-S29 WeakPolarHBondContact O-CB 3.34Å; V25-S29 PolarHBondContact O-N 3.07Å; V25-S29 PolarHBondContact O-OG 2.87Å; A26-S29 WeakPolarHBondContact CA-OG 3.47Å; A26-S29 PolarHBondContact O-N 3.32Å; A26-S29 PolarHBondContact O-OG 3.31Å; S29-P31 WeakPolarHBondContact O-CD 3.49Å
30	S	41.9	Very low	49.2	Very low	79 Å²	79	104.4 Å²	104.4	55%	0.552	61%	0.612	S	S	*	*	S	Bend	trans	-63.9	115.9	172.3	-108.2	0	0	0	0	108.1	A26 V32	A26-S30 PolarHBondContact O-N 3.33Å; S30-V32 PolarHBondContact O-N 3.26Å
31	P	44.4	Very low	48.2	Very low	111 Å²	111	106.7 Å²	106.7	72%	0.721	63%	0.626	S	S	*	*			trans	-58.9	117.1	167.5	24.9	-30	0	0	0	106	S29 N33	S29-P31 WeakPolarHBondContact O-CD 3.49Å; P31-N33 PolarHBondContact O-N 3.44Å
32	V	44	Very low	47.1	Very low	132 Å²	132	115.6 Å²	115.6	80%	0.8	66%	0.655	S	S	*	*			trans	-60.1	80.4	160.9	-83.3	0	0	0	0	106.5	S30 S34	S30-V32 PolarHBondContact O-N 3.26Å; V32-S34 PolarHBondContact O-N 3.45Å
33	N	38.4	Very low	46.3	Very low	129 Å²	129	118.1 Å²	118.1	69%	0.69	67%	0.669	S	S	*	*			trans	-73.7	84.5	168.1	-149.9	41.8	0	0	0	105.3	P31 Q35	P31-N33 PolarHBondContact O-N 3.44Å; N33-Q35 PolarHBondContact O-N 3.49Å
34	S	39.7	Very low	45.5	Very low	104 Å²	104	114.8 Å²	114.8	73%	0.727	67%	0.668	S	S	*	*	S	Bend	trans	-63.3	64.3	165.4	-59.3	0	0	0	0	109	V32	V32-S34 PolarHBondContact O-N 3.45Å
35	Q	37	Very low	44.5	Very low	177 Å²	177	118 Å²	118	83%	0.827	69%	0.687	S	S	*	*			trans	168.5	83.1	165.5	-104.1	174.3	-95.8	0	0	108.2	N33	N33-Q35 PolarHBondContact O-N 3.49Å
36	A	38.8	Very low	44	Very low	74 Å²	74	120.7 Å²	120.7	61%	0.612	70%	0.696	S	S	*	*			trans	-124.2	82.4	155	0	0	0	0	0	107.3	F38	A36-F38 HydrophobicContact CB-CD2 4.42Å; A36-F38 HydrophobicContact CB-CE2 4.48Å; A36-F38 PolarHBondContact O-N 2.92Å; A36-F38 VanDerWaalsContact O-N 3.11Å
37	S	36	Very low	43.2	Very low	99 Å²	99	123.2 Å²	123.2	69%	0.692	71%	0.71	S	S	*	*			trans	-42.5	110.4	154.1	146.9	0	0	0	0	109.1
38	F	44.5	Very low	42.8	Very low	184 Å²	184	127.9 Å²	127.9	81%	0.807	72%	0.724	S	S	*	*			trans	-118.8	59.9	155.8	-85.7	-81.9	0	0	0	108.7	A36	A36-F38 HydrophobicContact CB-CD2 4.42Å; A36-F38 HydrophobicContact CB-CE2 4.48Å; A36-F38 PolarHBondContact O-N 2.92Å; A36-F38 VanDerWaalsContact O-N 3.11Å
39	D	40	Very low	42.1	Very low	144 Å²	144	128.3 Å²	128.3	77%	0.77	73%	0.734	S	S	*	*			trans	-61	142	135.4	-86.7	-58.6	0	0	0	108.1
40	K	42.9	Very low	41.5	Very low	182 Å²	182	132.3 Å²	132.3	79%	0.791	75%	0.748	S	S	*	*			trans	72.3	118.6	-179	-96.2	163.8	168.9	172.4	0	114.3
41	T	46.5	Very low	41.8	Very low	124 Å²	124	134.7 Å²	134.7	76%	0.761	76%	0.759	S	S	*	*				-160.7	115.3	56.6	-52.3	0	0	0	0	110.5	S43	T41-S43 PolarHBondContact O-N 3.1Å; T41-S43 VanDerWaalsContact O-N 3.12Å
42	R	40.7	Very low	41.6	Very low	232 Å²	232	135.9 Å²	135.9	88%	0.875	76%	0.759	S	S	*	*			trans	-25.9	106.8	149.3	171.3	179.9	165.2	153.1	-2.9	111.9
43	S	44.2	Very low	41.4	Very low	111 Å²	111	134.6 Å²	134.6	78%	0.776	76%	0.756	S	S	*	*			trans	-118.3	103.4	159.2	-170.1	0	0	0	0	107.8	T41 D45	T41-S43 PolarHBondContact O-N 3.1Å; T41-S43 VanDerWaalsContact O-N 3.12Å; S43-D45 PolarHBondContact O-N 3.01Å
44	T	45.2	Very low	41.4	Very low	105 Å²	105	131.9 Å²	131.9	64%	0.644	76%	0.759	S	S	*	*			trans	-27.1	120	161.7	30.9	0	0	0	0	112.4
45	D	35.1	Very low	41.3	Very low	125 Å²	125	133.6 Å²	133.6	67%	0.668	77%	0.771	S	S	*	*				120.8	159.1	86.4	-171.4	9.6	0	0	0	105.8	S43	S43-D45 PolarHBondContact O-N 3.01Å
46	M	46.6	Very low	41.8	Very low	146 Å²	146	129.4 Å²	129.4	72%	0.719	77%	0.767	S	S	*	*			trans	93	80	-172.7	-35.5	-37.8	141.8	0	0	116.1
47	S	39.3	Very low	41.9	Very low	105 Å²	105	129.9 Å²	129.9	73%	0.734	77%	0.771	S	S	*	*				75	120.1	116.2	-82.1	0	0	0	0	121.1
48	L	47.9	Very low	42.1	Very low	173 Å²	173	130.2 Å²	130.2	91%	0.906	77%	0.773	S	S	*	*			trans	96.3	113.1	146.9	-58.6	165.4	0	0	0	118.1
49	G	39.4	Very low	42	Very low	73 Å²	73	131.2 Å²	131.2	75%	0.753	78%	0.777	S	S	*	*			trans	108.5	83.2	142.2	0	0	0	0	0	113.7
50	L	39.9	Very low	42.4	Very low	169 Å²	169	129.9 Å²	129.9	89%	0.885	78%	0.779	S	S	*	*				82.5	133.7	93.4	-149.8	91.2	0	0	0	113
51	V	46.8	Very low	42.5	Very low	129 Å²	129	126.6 Å²	126.6	78%	0.782	78%	0.778	S	S	*	*			trans	100.4	85.1	162.6	-162.1	0	0	0	0	116.1
52	D	41	Very low	42.6	Very low	136 Å²	136	126.6 Å²	126.6	73%	0.727	78%	0.78	S	S	*	*			trans	-45.5	153.4	154.7	-173.9	22.9	0	0	0	115.5
53	S	38.8	Very low	42.9	Very low	105 Å²	105	119.7 Å²	119.7	73%	0.734	77%	0.767	S	S	*	*			trans	70.4	116.1	147.8	-78.9	0	0	0	0	120.6
54	G	38.3	Very low	43	Very low	73 Å²	73	119.7 Å²	119.7	75%	0.753	76%	0.759	S	S	*	*			trans	179	57.7	164.8	0	0	0	0	0	114.4	A56	G54-A56 PolarHBondContact O-N 3.29Å
55	S	38.5	Very low	43.2	Very low	139 Å²	139	121.4 Å²	121.4	97%	0.972	76%	0.764	S	S	*	*			trans	-63.1	99.8	167.3	-168.5	0	0	0	0	109.3
56	A	47.3	Very low	43.6	Very low	90 Å²	90	118.4 Å²	118.4	74%	0.744	75%	0.753	S	S	*	*			trans	-130.1	95.7	172.7	0	0	0	0	0	109	G54	G54-A56 PolarHBondContact O-N 3.29Å
57	A	40.6	Very low	43.7	Very low	84 Å²	84	117.3 Å²	117.3	69%	0.694	76%	0.756	S	S	*	*			trans	26.4	118.9	134.2	0	0	0	0	0	117.9
58	S	40.2	Very low	44.1	Very low	106 Å²	106	117.7 Å²	117.7	74%	0.741	75%	0.746	S	S	*	*			trans	55.4	87.1	130.2	64.6	0	0	0	0	117.4
59	K	42.9	Very low	44	Very low	204 Å²	204	114.5 Å²	114.5	89%	0.887	74%	0.739	S	S	*	*			trans	-139	103.3	133.8	-69.9	-170.7	179.2	171.7	0	108.3	C61	K59-C61 PolarHBondContact O-N 3.48Å
60	S	47.6	Very low	44.3	Very low	117 Å²	117	120 Å²	120	82%	0.818	74%	0.742	S	S	*	*			trans	-56.2	106.5	162.4	51.9	0	0	0	0	107.4
61	C	46.3	Very low	44.8	Very low	112 Å²	112	122.4 Å²	122.4	76%	0.757	74%	0.739	S	S	*	*			trans	-54.9	133.5	167.3	-88.3	0	0	0	0	107.9	K59 S63	K59-C61 PolarHBondContact O-N 3.48Å; C61-S63 VanDerWaalsContact C-N 3.32Å; C61-S63 PolarHBondContact O-N 3.33Å
62	P	48.7	Very low	44.8	Very low	124 Å²	124	118.4 Å²	118.4	81%	0.805	72%	0.717	S	S	*	*			trans	-60.6	104.7	167.9	24.3	-29.3	0	0	0	107.1	N64	P62-N64 PolarHBondContact O-N 3.36Å
63	S	46.2	Very low	45.5	Very low	88 Å²	88	122 Å²	122	62%	0.615	72%	0.721	S	S	*	*			trans	-60.9	85.5	167.6	154.4	0	0	0	0	107.2	C61 N65	C61-S63 VanDerWaalsContact C-N 3.32Å; C61-S63 PolarHBondContact O-N 3.33Å; S63-N65 PolarHBondContact O-N 2.82Å; S63-N65 VanDerWaalsContact OG-CG 3.28Å; S63-N65 PolarHBondContact OG-ND2 2.89Å
64	N	45.8	Very low	45.9	Very low	111 Å²	111	120.7 Å²	120.7	59%	0.594	70%	0.702	S	S	*	*			trans	-78.3	64.8	173	-161.7	16.4	0	0	0	108.8	P62 S66 H68	P62-N64 PolarHBondContact O-N 3.36Å; N64-S66 PolarHBondContact O-N 3.48Å; N64-S66 VanDerWaalsContact O-N 3.15Å; N64-H68 PolarHBondContact ND2-NE2 2.71Å; N64-H68 VanDerWaalsContact ND2-NE2 3.11Å
65	N	48.9	Very low	46.5	Very low	140 Å²	140	124.4 Å²	124.4	75%	0.749	71%	0.705	S	S	*	*			trans	-81.7	37.9	170.5	-68	-15.6	0	0	0	110.3	S63	S63-N65 PolarHBondContact O-N 2.82Å; S63-N65 VanDerWaalsContact OG-CG 3.28Å; S63-N65 PolarHBondContact OG-ND2 2.89Å
66	S	44	Very low	47.2	Very low	63 Å²	63	122.4 Å²	122.4	44%	0.441	68%	0.678	S	S	.	*			trans	-71.8	133.5	162.3	-171.5	0	0	0	0	106.7	N64 H68	N64-S66 PolarHBondContact O-N 3.48Å; N64-S66 VanDerWaalsContact O-N 3.15Å; S66-H68 PolarHBondContact O-N 2.8Å
67	P	49	Very low	47.7	Very low	122 Å²	122	120.9 Å²	120.9	79%	0.792	66%	0.66	S	S	*	*			trans	-67.9	78.9	164.6	30.7	-30.5	0	0	0	106	S69	P67-S69 PolarHBondContact O-N 2.97Å
68	H	47.3	Very low	48.5	Very low	114 Å²	114	119.8 Å²	119.8	53%	0.528	65%	0.645	S	S	.	*			trans	-59	100.3	161.3	-76.5	-61.3	0	0	0	104.1	N64 S66 F70	N64-H68 PolarHBondContact ND2-NE2 2.71Å; N64-H68 VanDerWaalsContact ND2-NE2 3.11Å; S66-H68 PolarHBondContact O-N 2.8Å; H68-F70 VanDerWaalsContact C-N 3.3Å; H68-F70 PolarHBondContact O-N 2.77Å
69	S	45.5	Very low	49.5	Very low	106 Å²	106	116.8 Å²	116.8	74%	0.741	62%	0.619	S	S	*	*			trans	-44.2	105.7	163.8	177.9	0	0	0	0	105.5	P67 R71	P67-S69 PolarHBondContact O-N 2.97Å; S69-R71 PolarHBondContact O-N 3.5Å
70	F	46.2	Very low	50.3	Low	189 Å²	189	110.5 Å²	110.5	83%	0.829	59%	0.593	S	S	*	*			trans	-67.8	74	170.4	-98.9	-91.5	0	0	0	105.8	H68 S72	H68-F70 VanDerWaalsContact C-N 3.3Å; H68-F70 PolarHBondContact O-N 2.77Å; F70-S72 VanDerWaalsContact C-N 3.27Å; F70-S72 PolarHBondContact O-N 2.93Å
71	R	50.6	Low	51.2	Low	218 Å²	218	107.5 Å²	107.5	82%	0.823	57%	0.567	S	S	*	*			trans	-71.7	95.9	167.1	-164.2	177.3	-170.3	-175.4	2.8	103.9	S69 R73	S69-R71 PolarHBondContact O-N 3.5Å; R71-R73 PolarHBondContact O-N 2.8Å; R71-R73 VanDerWaalsContact O-N 3.17Å
72	S	47.6	Very low	52.1	Low	46 Å²	46	107.1 Å²	107.1	32%	0.322	55%	0.554	S	S	.	*			trans	-45.9	128.2	172.4	163.6	0	0	0	0	107.7	E24 F70 F74	E24-S72 PolarHBondContact OE2-OG 3.5Å; F70-S72 VanDerWaalsContact C-N 3.27Å; F70-S72 PolarHBondContact O-N 2.93Å; S72-F74 PolarHBondContact O-N 2.74Å; S72-F74 PolarHBondContact OG-N 2.85Å; S72-F74 PolarHBondContact OG-O 2.74Å
73	R	54.9	Low	53.1	Low	212 Å²	212	107.5 Å²	107.5	80%	0.8	54%	0.543	S	S	*	.	S	Bend	trans	-69.7	-9	176.3	-67.7	-174.3	-67.5	177.4	-1.5	111.3	R71	R71-R73 PolarHBondContact O-N 2.8Å; R71-R73 VanDerWaalsContact O-N 3.17Å
74	F	48.5	Very low	54	Low	77 Å²	77	108.6 Å²	108.6	34%	0.338	54%	0.541	S	S	.	.			trans	-128.4	67.8	-175.5	-52.4	-72.7	0	0	0	110.1	E24 S72 K76	E24-F74 WeakPolarHBondContact OE1-CD2 3.32Å; S72-F74 PolarHBondContact O-N 2.74Å; S72-F74 PolarHBondContact OG-N 2.85Å; S72-F74 PolarHBondContact OG-O 2.74Å; F74-K76 PolarHBondContact O-N 3.21Å
75	N	50.4	Low	55.1	Low	151 Å²	151	109.9 Å²	109.9	81%	0.807	54%	0.542	S	S	*	.	S	Bend	trans	-76	0.8	166.4	69.1	-13.2	0	0	0	112.9
76	K	53.7	Low	56	Low	97 Å²	97	108 Å²	108	42%	0.422	53%	0.532	S	S	.	.	S	Bend	trans	-148	142.8	-173.4	-168.5	171.2	-174.8	168.7	0	109.2	F74 P78	F74-K76 PolarHBondContact O-N 3.21Å; K76-P78 WeakPolarHBondContact O-CD 3.42Å
77	V	56.3	Low	57.5	Low	58 Å²	58	108.2 Å²	108.2	35%	0.352	54%	0.544	S	S	.	.			trans	-55.5	121.4	173	-174.7	0	0	0	0	107.8	F79	V77-F79 HydrophobicContact CG1-CD1 4.29Å; V77-F79 HydrophobicContact CG1-CD2 4.35Å; V77-F79 HydrophobicContact CG1-CE1 4.21Å; V77-F79 HydrophobicContact CG1-CE2 4.29Å; V77-F79 HydrophobicContact CG1-CG 4.36Å; V77-F79 HydrophobicContact CG1-CZ 4.22Å; V77-F79 VanDerWaalsContact CG1-O 3.29Å; V77-F79 WeakPolarHBondContact CG1-O 3.36Å; V77-F79 PolarHBondContact O-N 2.68Å
78	P	58.3	Low	58.6	Low	60 Å²	60	110.6 Å²	110.6	39%	0.39	55%	0.55	S	S	.	.	S	Bend	trans	-71.3	1.3	-170.9	25.4	-31	0	0	0	113.4	K76 S97	K76-P78 WeakPolarHBondContact O-CD 3.42Å; P78-S97 WeakPolarHBondContact O-CB 3.2Å; P78-S97 PolarHBondContact O-N 2.97Å
79	F	59.9	Low	58.6	Low	44 Å²	44	110.8 Å²	110.8	19%	0.193	55%	0.551	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-143.5	150.1	177.1	56.3	-90.3	0	0	0	111.3	V77 I81 C94 L95	V77-F79 HydrophobicContact CG1-CD1 4.29Å; V77-F79 HydrophobicContact CG1-CD2 4.35Å; V77-F79 HydrophobicContact CG1-CE1 4.21Å; V77-F79 HydrophobicContact CG1-CE2 4.29Å; V77-F79 HydrophobicContact CG1-CG 4.36Å; V77-F79 HydrophobicContact CG1-CZ 4.22Å; V77-F79 VanDerWaalsContact CG1-O 3.29Å; V77-F79 WeakPolarHBondContact CG1-O 3.36Å; V77-F79 PolarHBondContact O-N 2.68Å; F79-I81 HydrophobicContact CD2-CG1 3.88Å; F79-I81 HydrophobicContact CE2-CD1 3.98Å; F79-I81 HydrophobicContact CE2-CG1 3.81Å; F79-C94 HydrophobicContact CD2-CB 4.09Å; F79-L95 CarbonylContact C-O 3.47Å; F79-L95 WeakPolarHBondContact CA-O 3.29Å; F79-L95 WeakPolarHBondContact CB-O 3.36Å
80	Q	61.5	Low	59	Low	71 Å²	71	108.7 Å²	108.7	33%	0.332	53%	0.529	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.2	146.1	164.4	-62.5	-176.4	7.2	0	0	108.6	C94 L95	Q80-C94 CarbonylContact O-C 3.49Å; Q80-C94 VanDerWaalsContact O-CA 3.32Å; Q80-C94 WeakPolarHBondContact O-CA 3.46Å; Q80-L95 HydrophobicContact CB-CB 4.48Å; Q80-L95 PolarHBondContact N-O 3.42Å; Q80-L95 PolarHBondContact O-N 3.45Å
81	I	65.2	Low	59.5	Low	55 Å²	55	101.7 Å²	101.7	28%	0.282	50%	0.5	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.2	107.5	170.2	-55.1	175.2	0	0	0	106.6	E14 F79 C92 S93	E14-I81 HydrophobicContact CB-CD1 4.27Å; F79-I81 HydrophobicContact CD2-CG1 3.88Å; F79-I81 HydrophobicContact CE2-CD1 3.98Å; F79-I81 HydrophobicContact CE2-CG1 3.81Å; I81-C92 HydrophobicContact CG2-CB 4.2Å; I81-S93 CarbonylContact C-O 3.58Å; I81-S93 WeakPolarHBondContact CA-O 3.27Å
82	E	66.2	Low	59.9	Low	104 Å²	104	92.2 Å²	92.2	49%	0.486	47%	0.468	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.1	129.9	168.2	-74.5	-168.8	155.3	0	0	109.3	C92 S93 L95	E82-C92 CarbonylContact O-C 3.55Å; E82-C92 VanDerWaalsContact O-CA 3.27Å; E82-C92 WeakPolarHBondContact O-CA 3.37Å; E82-S93 PolarHBondContact N-O 2.91Å; E82-S93 PolarHBondContact O-N 3.26Å; E82-L95 HydrophobicContact CG-CD1 3.72Å; E82-L95 HydrophobicContact CG-CG 4.26Å; E82-L95 WeakPolarHBondContact OE1-CD1 3.48Å; E82-L95 WeakPolarHBondContact OE2-CD1 3.43Å
83	K	68.7	Low	60.5	Low	131 Å²	131	93.1 Å²	93.1	57%	0.57	47%	0.474	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-108.2	122.5	172.6	-61.3	-176.1	164.7	-142.2	0	108.4	E90 L91	K83-E90 WeakPolarHBondContact CD-OE1 3.19Å; K83-E90 WeakPolarHBondContact CE-OE1 3.26Å; K83-E90 IonicContact NZ-OE1 2.83Å; K83-E90 PolarHBondContact NZ-OE1 3.42Å; K83-L91 CarbonylContact C-O 3.55Å; K83-L91 WeakPolarHBondContact CA-O 3.44Å
84	L	65.9	Low	60.7	Low	111 Å²	111	85.3 Å²	85.3	58%	0.581	45%	0.451	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-117.8	146.4	174.2	-179.4	67.9	0	0	0	108.3	L91	L84-L91 HydrophobicContact CB-CB 4.33Å; L84-L91 PolarHBondContact N-O 3.45Å; L84-L91 WeakPolarHBondContact O-CA 3.37Å; L84-L91 PolarHBondContact O-N 3.35Å; L84-L91 VanDerWaalsContact O-O 3.13Å
85	F	69.6	Low	61.3	Low	139 Å²	139	83.6 Å²	83.6	61%	0.61	45%	0.445	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-106.3	127.3	169.6	-70.2	-88.5	0	0	0	109.1	E89 E90	F85-E89 CarbonylContact C-O 3.56Å; F85-E89 WeakPolarHBondContact CA-O 3.3Å; F85-E90 HydrophobicContact CD1-CB 4.18Å; F85-E90 HydrophobicContact CE1-CB 3.83Å; F85-E90 HydrophobicContact CE1-CG 3.96Å; F85-E90 HydrophobicContact CZ-CB 4.5Å; F85-E90 HydrophobicContact CZ-CG 4.12Å
86	D	67.7	Low	61.6	Low	101 Å²	101	80.2 Å²	80.2	54%	0.54	43%	0.431	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111	91	169.9	-171.9	11.2	0	0	0	108.2	D88 E89 L91	D86-D88 PolarHBondContact O-N 2.86Å; D86-E89 PolarHBondContact N-O 3.05Å; D86-E89 WeakPolarHBondContact O-CB 3.41Å; D86-E89 PolarHBondContact O-N 3.5Å; D86-L91 HydrophobicContact CB-CD1 3.7Å; D86-L91 HydrophobicContact CB-CG 4.26Å
87	G	74.3	Confident	61.8	Low	66 Å²	66	77.1 Å²	77.1	68%	0.68	42%	0.422	S	S	*	.	T	Hydrogen-bonded Turn	trans	62.4	-119.4	-166.6	0	0	0	0	0	111.3
88	D	71.9	Confident	61.9	Low	173 Å²	173	83.2 Å²	83.2	93%	0.925	45%	0.447	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.4	-3.6	175.4	-64.4	-34.2	0	0	0	112.9	D86	D86-D88 PolarHBondContact O-N 2.86Å
89	E	48.2	Very low	61.5	Low	118 Å²	118	87.4 Å²	87.4	55%	0.551	46%	0.459	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-89	118.8	-179.8	-58.6	-157	146.2	0	0	111.6	F85 D86 L91	F85-E89 CarbonylContact C-O 3.56Å; F85-E89 WeakPolarHBondContact CA-O 3.3Å; D86-E89 PolarHBondContact N-O 3.05Å; D86-E89 WeakPolarHBondContact O-CB 3.41Å; D86-E89 PolarHBondContact O-N 3.5Å; E89-L91 PolarHBondContact O-N 2.89Å
90	E	53.7	Low	60.9	Low	61 Å²	61	88.4 Å²	88.4	29%	0.285	47%	0.466	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79	114.4	168.4	-171.2	-174.8	-177.2	0	0	109.4	R7 K83 F85	R7-E90 IonicContact NE-OE2 3.95Å; K83-E90 WeakPolarHBondContact CD-OE1 3.19Å; K83-E90 WeakPolarHBondContact CE-OE1 3.26Å; K83-E90 IonicContact NZ-OE1 2.83Å; K83-E90 PolarHBondContact NZ-OE1 3.42Å; F85-E90 HydrophobicContact CD1-CB 4.18Å; F85-E90 HydrophobicContact CE1-CB 3.83Å; F85-E90 HydrophobicContact CE1-CG 3.96Å; F85-E90 HydrophobicContact CZ-CB 4.5Å; F85-E90 HydrophobicContact CZ-CG 4.12Å
91	L	56.9	Low	60.2	Low	42 Å²	42	90.3 Å²	90.3	22%	0.22	48%	0.484	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.5	126.4	174.1	-59.8	178.9	0	0	0	109.8	R4 K83 L84 D86 E89	R4-L91 VanDerWaalsContact NH2-CD2 3.27Å; K83-L91 CarbonylContact C-O 3.55Å; K83-L91 WeakPolarHBondContact CA-O 3.44Å; L84-L91 HydrophobicContact CB-CB 4.33Å; L84-L91 PolarHBondContact N-O 3.45Å; L84-L91 WeakPolarHBondContact O-CA 3.37Å; L84-L91 PolarHBondContact O-N 3.35Å; L84-L91 VanDerWaalsContact O-O 3.13Å; D86-L91 HydrophobicContact CB-CD1 3.7Å; D86-L91 HydrophobicContact CB-CG 4.26Å; E89-L91 PolarHBondContact O-N 2.89Å
92	C	59.5	Low	58.9	Low	20 Å²	20	92.7 Å²	92.7	14%	0.135	51%	0.506	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114	134.1	177.1	-67.2	0	0	0	0	110.3	C10 I81 E82	C10-C92 HydrophobicContact CB-CB 4.07Å; C10-C92 WeakPolarHBondContact SG-CB 3.28Å; I81-C92 HydrophobicContact CG2-CB 4.2Å; E82-C92 CarbonylContact O-C 3.55Å; E82-C92 VanDerWaalsContact O-CA 3.27Å; E82-C92 WeakPolarHBondContact O-CA 3.37Å
93	S	60.1	Low	57.8	Low	65 Å²	65	93.9 Å²	93.9	46%	0.455	53%	0.526	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.3	123.6	175.3	-64.4	0	0	0	0	110.1	I81 E82 L95	I81-S93 CarbonylContact C-O 3.58Å; I81-S93 WeakPolarHBondContact CA-O 3.27Å; E82-S93 PolarHBondContact N-O 2.91Å; E82-S93 PolarHBondContact O-N 3.26Å; S93-L95 PolarHBondContact O-N 3.44Å
94	C	59.1	Low	56.3	Low	47 Å²	47	89.8 Å²	89.8	32%	0.318	52%	0.52	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.7	112.8	171.9	-60	0	0	0	0	109	F79 Q80	F79-C94 HydrophobicContact CD2-CB 4.09Å; Q80-C94 CarbonylContact O-C 3.49Å; Q80-C94 VanDerWaalsContact O-CA 3.32Å; Q80-C94 WeakPolarHBondContact O-CA 3.46Å
95	L	61	Low	55	Low	42 Å²	42	91.3 Å²	91.3	22%	0.22	53%	0.529	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.2	136.4	174.7	-63	-174.9	0	0	0	110.3	F79 Q80 E82 S93	F79-L95 CarbonylContact C-O 3.47Å; F79-L95 WeakPolarHBondContact CA-O 3.29Å; F79-L95 WeakPolarHBondContact CB-O 3.36Å; Q80-L95 HydrophobicContact CB-CB 4.48Å; Q80-L95 PolarHBondContact N-O 3.42Å; Q80-L95 PolarHBondContact O-N 3.45Å; E82-L95 HydrophobicContact CG-CD1 3.72Å; E82-L95 HydrophobicContact CG-CG 4.26Å; E82-L95 WeakPolarHBondContact OE1-CD1 3.48Å; E82-L95 WeakPolarHBondContact OE2-CD1 3.43Å; S93-L95 PolarHBondContact O-N 3.44Å
96	P	56.3	Low	53.4	Low	79 Å²	79	93.1 Å²	93.1	51%	0.513	54%	0.539	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-58.3	143.2	173.1	24.5	-31.9	0	0	0	110.9	E98 F99	P96-E98 PolarHBondContact O-N 2.95Å; P96-F99 PolarHBondContact O-N 2.83Å; P96-F99 VanDerWaalsContact O-N 3.15Å
97	S	58.2	Low	51.9	Low	33 Å²	33	95.1 Å²	95.1	23%	0.231	56%	0.557	C	S	.	*	G	3₁₀ helix	trans	-54.3	-14.8	179.8	166.7	0	0	0	0	113.8	P78 F99 I100	P78-S97 WeakPolarHBondContact O-CB 3.2Å; P78-S97 PolarHBondContact O-N 2.97Å; S97-F99 PolarHBondContact O-N 2.79Å; S97-I100 WeakPolarHBondContact O-CD1 3.49Å; S97-I100 WeakPolarHBondContact O-CG1 3.41Å; S97-I100 PolarHBondContact O-N 2.94Å
98	E	57.8	Low	50.1	Low	185 Å²	185	95 Å²	95	86%	0.864	56%	0.557	S	S	*	*	G	3₁₀ helix	trans	-69.9	-6.9	179.1	-58.5	-176.2	-177.7	0	0	113.3	P96 I100	P96-E98 PolarHBondContact O-N 2.95Å; E98-I100 VanDerWaalsContact C-N 3.33Å; E98-I100 PolarHBondContact O-N 3.47Å
99	F	49.4	Very low	48.6	Very low	149 Å²	149	91.9 Å²	91.9	65%	0.654	55%	0.549	S	S	*	.	G	3₁₀ helix	trans	-88.9	12.9	176.4	-141.9	-97.6	0	0	0	114.6	P96 S97 P101	P96-F99 PolarHBondContact O-N 2.83Å; P96-F99 VanDerWaalsContact O-N 3.15Å; S97-F99 PolarHBondContact O-N 2.79Å; F99-P101 WeakPolarHBondContact O-CD 3.41Å
100	I	48.2	Very low	48.3	Very low	65 Å²	65	94.6 Å²	94.6	33%	0.333	57%	0.566	S	S	.	*			trans	-74.6	111.8	170.1	-60.9	161.6	0	0	0	107	S97 E98 S102	S97-I100 WeakPolarHBondContact O-CD1 3.49Å; S97-I100 WeakPolarHBondContact O-CG1 3.41Å; S97-I100 PolarHBondContact O-N 2.94Å; E98-I100 VanDerWaalsContact C-N 3.33Å; E98-I100 PolarHBondContact O-N 3.47Å; I100-S102 PolarHBondContact O-N 2.86Å
101	P	45.8	Very low	47.7	Very low	111 Å²	111	100.9 Å²	100.9	72%	0.721	59%	0.592	S	S	*	*			trans	-58.2	114.4	164.9	24.8	-30.7	0	0	0	105.8	F99 S103	F99-P101 WeakPolarHBondContact O-CD 3.41Å; P101-S103 PolarHBondContact O-N 3.01Å
102	S	39.4	Very low	47	Very low	105 Å²	105	106 Å²	106	73%	0.734	62%	0.619	S	S	*	*			trans	-56.3	96.7	173	-172.4	0	0	0	0	106.6	I100 G104	I100-S102 PolarHBondContact O-N 2.86Å; S102-G104 PolarHBondContact O-N 3.24Å
103	S	42.8	Very low	46.2	Very low	129 Å²	129	110.3 Å²	110.3	90%	0.902	65%	0.647	S	S	*	*			trans	-65.9	78.7	171.4	156.2	0	0	0	0	106.2	P101	P101-S103 PolarHBondContact O-N 3.01Å
104	G	37.1	Very low	45.1	Very low	44 Å²	44	114 Å²	114	45%	0.454	67%	0.669	S	S	.	*	S	Bend	trans	172.9	82.7	-171.5	0	0	0	0	0	110.1	S102	S102-G104 PolarHBondContact O-N 3.24Å
105	N	37.9	Very low	44	Very low	143 Å²	143	114.5 Å²	114.5	77%	0.765	68%	0.682	S	S	*	*	S	Bend	trans	58.1	116.5	157.4	-58.1	-23.2	0	0	0	116.8
106	H	36.8	Very low	42.8	Very low	178 Å²	178	118.5 Å²	118.5	82%	0.824	71%	0.714	S	S	*	*			trans	134.4	112.7	145.7	-63	-55.2	0	0	0	112	G108	H106-G108 PolarHBondContact O-N 3.08Å
107	P	36.4	Very low	41.5	Very low	142 Å²	142	120.3 Å²	120.3	92%	0.922	73%	0.728	S	S	*	*			trans	-79.1	103.9	169.2	32.2	-26.6	0	0	0	107.4
108	G	36.1	Very low	40.2	Very low	65 Å²	65	124 Å²	124	67%	0.67	75%	0.754	S	S	*	*			trans	179	92.9	179.5	0	0	0	0	0	114.7	H106	H106-G108 PolarHBondContact O-N 3.08Å
109	S	39.3	Very low	39.1	Very low	107 Å²	107	120.7 Å²	120.7	75%	0.748	75%	0.751	S	S	*	*			trans	61.1	67.5	147.3	-170.2	0	0	0	0	117.5	K111	S109-K111 PolarHBondContact O-N 3.12Å; S109-K111 VanDerWaalsContact O-N 3.1Å
110	L	42.7	Very low	38.4	Very low	174 Å²	174	119.1 Å²	119.1	91%	0.911	76%	0.756	S	S	*	*			trans	-72.5	98.2	151	-79.1	169.2	0	0	0	108.4	L112	L110-L112 PolarHBondContact O-N 3.36Å
111	K	40	Very low	37.4	Very low	194 Å²	194	120.5 Å²	120.5	84%	0.843	78%	0.777	S	S	*	*			trans	-63.8	100.9	170.3	-120.8	173.2	178.4	177	0	107.7	S109	S109-K111 PolarHBondContact O-N 3.12Å; S109-K111 VanDerWaalsContact O-N 3.1Å
112	L	43.4	Very low	36.8	Very low	149 Å²	149	123 Å²	123	78%	0.78	78%	0.784	S	S	*	*			trans	-59.6	140.7	168	-72.4	165	0	0	0	109	L110	L110-L112 PolarHBondContact O-N 3.36Å
113	P	43.4	Very low	36.3	Very low	111 Å²	111	126 Å²	126	72%	0.721	79%	0.786	S	S	*	*			trans	-58.4	130.3	172.7	23.3	-30.9	0	0	0	109.2	G115	P113-G115 PolarHBondContact O-N 3.02Å
114	P	36.7	Very low	35.6	Very low	141 Å²	141	124.7 Å²	124.7	92%	0.916	78%	0.776	S	S	*	*			trans	-74.7	97.2	177.9	29.8	-30.1	0	0	0	107.9
115	G	34.6	Very low	35.2	Very low	58 Å²	58	131.4 Å²	131.4	60%	0.598	79%	0.792	S	S	*	*			trans	-172.3	118	178.4	0	0	0	0	0	112.9	P113	P113-G115 PolarHBondContact O-N 3.02Å
116	S	36.6	Very low	35.1	Very low	126 Å²	126	128.3 Å²	128.3	88%	0.881	78%	0.779	S	S	*	*			trans	76.4	73	171.2	55.3	0	0	0	0	117.6
117	S	29.3	Very low	34.9	Very low	117 Å²	117	125.4 Å²	125.4	82%	0.818	78%	0.779	S	S	*	*			trans	-64.4	118.2	152.3	58.1	0	0	0	0	111
118	S	31.4	Very low	34.7	Very low	110 Å²	110	126.3 Å²	126.3	77%	0.769	77%	0.765	S	S	*	*			trans	167.7	85.3	138.9	58.6	0	0	0	0	109.7
119	S	33.5	Very low	34.5	Very low	116 Å²	116	131.2 Å²	131.2	81%	0.811	78%	0.776	S	S	*	*	S	Bend	trans	-164.1	140.4	148.8	-90.3	0	0	0	0	109.9	A121	S119-A121 PolarHBondContact O-N 3.13Å
120	P	34.5	Very low	34.5	Very low	116 Å²	116	133.2 Å²	133.2	75%	0.753	77%	0.771	S	S	*	*			trans	-65.1	135.4	-164.3	26.3	-32.3	0	0	0	110.6	L122	P120-L122 VanDerWaalsContact C-N 3.32Å; P120-L122 PolarHBondContact O-N 2.92Å
121	A	27.5	Very low	34.1	Very low	95 Å²	95	132.7 Å²	132.7	79%	0.785	76%	0.762	S	S	*	*			trans	-58.7	91.2	172.2	0	0	0	0	0	110.3	S119 Q123	S119-A121 PolarHBondContact O-N 3.13Å; A121-Q123 VanDerWaalsContact C-N 3.27Å; A121-Q123 PolarHBondContact O-N 3.12Å; A121-Q123 VanDerWaalsContact O-N 3.07Å
122	L	34.3	Very low	34.2	Very low	163 Å²	163	127.6 Å²	127.6	85%	0.853	75%	0.747	S	S	*	*			trans	-71.9	94.7	155	-89.8	154.8	0	0	0	105.9	P120 C124	P120-L122 VanDerWaalsContact C-N 3.32Å; P120-L122 PolarHBondContact O-N 2.92Å; L122-C124 PolarHBondContact O-N 2.85Å
123	Q	28.9	Very low	33.8	Very low	168 Å²	168	126.9 Å²	126.9	79%	0.785	74%	0.739	S	S	*	*			trans	-57.5	86.3	163	-72.2	-174.8	9.6	0	0	107.7	A121 K125	A121-Q123 VanDerWaalsContact C-N 3.27Å; A121-Q123 PolarHBondContact O-N 3.12Å; A121-Q123 VanDerWaalsContact O-N 3.07Å; Q123-K125 PolarHBondContact O-N 3.08Å
124	C	28.2	Very low	33.6	Very low	101 Å²	101	131 Å²	131	68%	0.682	74%	0.74	S	S	*	*			trans	-73.9	91	169.5	-143.1	0	0	0	0	106.2	L122 T126	L122-C124 PolarHBondContact O-N 2.85Å; C124-T126 HydrophobicContact CB-CG2 4.16Å; C124-T126 PolarHBondContact O-N 2.92Å; C124-T126 VanDerWaalsContact SG-CG2 3.56Å
125	K	28	Very low	33.4	Very low	185 Å²	185	130.1 Å²	130.1	80%	0.804	73%	0.728	S	S	*	*			trans	-62.8	77.5	155.4	-81.9	-177.6	175.5	177.7	0	106.4	Q123 S127	Q123-K125 PolarHBondContact O-N 3.08Å; K125-S127 PolarHBondContact O-N 3.07Å
126	T	35.5	Very low	33.4	Very low	79 Å²	79	132.7 Å²	132.7	49%	0.485	73%	0.734	S	S	.	*			trans	-73.6	82.9	171	36.3	0	0	0	0	107.9	C124 Y128	C124-T126 HydrophobicContact CB-CG2 4.16Å; C124-T126 PolarHBondContact O-N 2.92Å; C124-T126 VanDerWaalsContact SG-CG2 3.56Å; T126-Y128 HydrophobicContact CG2-CD2 3.76Å; T126-Y128 HydrophobicContact CG2-CE2 4.36Å; T126-Y128 PolarHBondContact O-N 2.82Å
127	S	32.7	Very low	33.4	Very low	117 Å²	117	131.7 Å²	131.7	82%	0.818	72%	0.718	S	S	*	*			trans	-66.4	61.8	149.7	56.4	0	0	0	0	108.5	K125	K125-S127 PolarHBondContact O-N 3.07Å
128	Y	33.3	Very low	33.4	Very low	160 Å²	160	131.8 Å²	131.8	63%	0.627	72%	0.717	S	S	*	*			trans	-107.9	109.8	175.8	-91.7	-98.9	0	0	0	107.3	T126 F130	T126-Y128 HydrophobicContact CG2-CD2 3.76Å; T126-Y128 HydrophobicContact CG2-CE2 4.36Å; T126-Y128 PolarHBondContact O-N 2.82Å; Y128-F130 HydrophobicContact CD1-CZ 4.36Å; Y128-F130 HydrophobicContact CG-CE2 4.13Å; Y128-F130 HydrophobicContact CG-CZ 4.26Å; Y128-F130 PolarHBondContact O-N 2.84Å
129	N	31.7	Very low	33.7	Very low	169 Å²	169	134.1 Å²	134.1	90%	0.904	72%	0.715	S	S	*	*			trans	-60.3	79.6	155.4	-89.2	-72.9	0	0	0	107.5	K131	N129-K131 PolarHBondContact O-N 2.76Å
130	F	39	Very low	33.7	Very low	148 Å²	148	139 Å²	139	65%	0.649	72%	0.716	S	S	*	*			trans	-68.5	86.4	162	-72.8	-77.9	0	0	0	106.3	Y128 T132	Y128-F130 HydrophobicContact CD1-CZ 4.36Å; Y128-F130 HydrophobicContact CG-CE2 4.13Å; Y128-F130 HydrophobicContact CG-CZ 4.26Å; Y128-F130 PolarHBondContact O-N 2.84Å; F130-T132 PolarHBondContact O-N 2.78Å; F130-T132 PolarHBondContact O-OG1 2.72Å
131	K	32.9	Very low	33.9	Very low	164 Å²	164	143.3 Å²	143.3	71%	0.713	72%	0.723	S	S	*	*			trans	-70.7	81.9	157.7	-165.8	165.9	-179.4	179.9	0	105.5	N129 H133	N129-K131 PolarHBondContact O-N 2.76Å; K131-H133 PolarHBondContact O-CD2 2.75Å; K131-H133 PolarHBondContact O-N 2.81Å
132	T	42.9	Very low	34.5	Very low	86 Å²	86	146.5 Å²	146.5	53%	0.528	72%	0.722	S	S	.	*			trans	-60.4	92	171.3	-37.4	0	0	0	0	106	F130 W134	F130-T132 PolarHBondContact O-N 2.78Å; F130-T132 PolarHBondContact O-OG1 2.72Å; T132-W134 HydrophobicContact CG2-CD2 4.24Å; T132-W134 HydrophobicContact CG2-CG 4.36Å; T132-W134 HydrophobicContact CG2-CZ2 4.15Å; T132-W134 PolarHBondContact O-N 3.46Å
133	H	35.8	Very low	34.6	Very low	134 Å²	134	145.9 Å²	145.9	62%	0.62	72%	0.72	S	S	*	*			trans	-69.2	84.4	166.1	-82.4	-91	0	0	0	105.8	K131 L135	K131-H133 PolarHBondContact O-CD2 2.75Å; K131-H133 PolarHBondContact O-N 2.81Å; H133-L135 PolarHBondContact O-N 2.83Å
134	W	38.2	Very low	35.3	Very low	197 Å²	197	149.1 Å²	149.1	75%	0.746	73%	0.725	S	S	*	*			trans	-61.1	84	157.2	-62.5	96.9	0	0	0	105.8	T132 P136	T132-W134 HydrophobicContact CG2-CD2 4.24Å; T132-W134 HydrophobicContact CG2-CG 4.36Å; T132-W134 HydrophobicContact CG2-CZ2 4.15Å; T132-W134 PolarHBondContact O-N 3.46Å; W134-P136 WeakPolarHBondContact O-CD 3.36Å
135	L	33.3	Very low	35.9	Very low	124 Å²	124	148.6 Å²	148.6	65%	0.649	72%	0.722	S	S	*	*			trans	-65.4	117.8	170.1	-76.8	171	0	0	0	106	H133 I137	H133-L135 PolarHBondContact O-N 2.83Å; L135-I137 HydrophobicContact CB-CD1 4.49Å; L135-I137 HydrophobicContact CB-CG1 3.91Å; L135-I137 PolarHBondContact O-N 2.89Å
136	P	34.2	Very low	36.9	Very low	112 Å²	112	145 Å²	145	73%	0.727	72%	0.72	S	S	*	*			trans	-72.8	91.8	166.9	24.6	-16.2	0	0	0	105.6	W134 C138	W134-P136 WeakPolarHBondContact O-CD 3.36Å; P136-C138 PolarHBondContact O-N 2.78Å
137	I	36.3	Very low	37	Very low	105 Å²	105	148.3 Å²	148.3	54%	0.538	74%	0.735	S	S	.	*			trans	-79.6	67.8	175.6	-50.3	176.8	0	0	0	107.6	L135 Q139	L135-I137 HydrophobicContact CB-CD1 4.49Å; L135-I137 HydrophobicContact CB-CG1 3.91Å; L135-I137 PolarHBondContact O-N 2.89Å; I137-Q139 HydrophobicContact CG2-CB 4.3Å; I137-Q139 PolarHBondContact O-N 2.86Å
138	C	30	Very low	37.5	Very low	118 Å²	118	153.8 Å²	153.8	80%	0.797	76%	0.755	S	S	*	*			trans	-76.8	84.1	151	-73	0	0	0	0	106.1	P136 R140	P136-C138 PolarHBondContact O-N 2.78Å; C138-R140 VanDerWaalsContact C-N 3.32Å; C138-R140 PolarHBondContact O-N 3.43Å
139	Q	37.6	Very low	37.7	Very low	159 Å²	159	153.5 Å²	153.5	74%	0.743	76%	0.761	S	S	*	*			trans	-71.8	98.7	165.5	-159.4	165.1	3.4	0	0	106.2	I137 F141	I137-Q139 HydrophobicContact CG2-CB 4.3Å; I137-Q139 PolarHBondContact O-N 2.86Å; Q139-F141 PolarHBondContact O-N 2.85Å
140	R	33.3	Very low	38	Very low	220 Å²	220	152.7 Å²	152.7	83%	0.83	75%	0.754	S	S	*	*			trans	-50.4	114.1	165.6	-102.1	-172.1	175.9	170	-0.9	106.4	C138 E142	C138-R140 VanDerWaalsContact C-N 3.32Å; C138-R140 PolarHBondContact O-N 3.43Å; R140-E142 PolarHBondContact O-N 2.88Å
141	F	39.2	Very low	38	Very low	205 Å²	205	152.9 Å²	152.9	90%	0.899	76%	0.76	S	S	*	*			trans	-64.6	93.7	159.9	-79.5	-92.7	0	0	0	106.1	Q139 D143	Q139-F141 PolarHBondContact O-N 2.85Å; F141-D143 VanDerWaalsContact C-N 3.33Å; F141-D143 PolarHBondContact O-N 2.82Å; F141-D143 VanDerWaalsContact O-N 3.13Å
142	E	38.8	Very low	38.3	Very low	163 Å²	163	152.3 Å²	152.3	76%	0.762	76%	0.762	S	S	*	*			trans	-69.9	101.7	159.1	-79.8	179.4	140.8	0	0	106.3	R140 R144	R140-E142 PolarHBondContact O-N 2.88Å; E142-R144 PolarHBondContact O-N 3.44Å
143	D	37.2	Very low	38	Very low	150 Å²	150	156.4 Å²	156.4	80%	0.802	78%	0.777	S	S	*	*			trans	-60.5	84.1	169	-166.6	12.1	0	0	0	108.7	F141 S145	F141-D143 VanDerWaalsContact C-N 3.33Å; F141-D143 PolarHBondContact O-N 2.82Å; F141-D143 VanDerWaalsContact O-N 3.13Å; D143-S145 PolarHBondContact O-N 3.24Å; D143-S145 VanDerWaalsContact O-N 3.12Å
144	R	43.1	Very low	38.1	Very low	236 Å²	236	157.9 Å²	157.9	89%	0.891	79%	0.788	S	S	*	*			trans	-82.3	73.9	165.7	-88	-168.1	171.3	-158.8	-1.7	108.5	E142 S146	E142-R144 PolarHBondContact O-N 3.44Å; R144-S146 VanDerWaalsContact C-N 3.33Å; R144-S146 PolarHBondContact O-N 2.97Å; R144-S146 VanDerWaalsContact O-N 3.08Å
145	S	41.4	Very low	38.1	Very low	90 Å²	90	155.1 Å²	155.1	63%	0.629	79%	0.791	S	S	*	*			trans	-64	96.1	152.6	170.6	0	0	0	0	108	D143	D143-S145 PolarHBondContact O-N 3.24Å; D143-S145 VanDerWaalsContact O-N 3.12Å
146	S	49.4	Very low	38.5	Very low	109 Å²	109	157.5 Å²	157.5	76%	0.762	80%	0.801	S	S	*	*			trans	-94.3	95.6	166.5	178.5	0	0	0	0	108.1	R144	R144-S146 VanDerWaalsContact C-N 3.33Å; R144-S146 PolarHBondContact O-N 2.97Å; R144-S146 VanDerWaalsContact O-N 3.08Å
147	N	37	Very low	38.9	Very low	149 Å²	149	161.3 Å²	161.3	80%	0.797	81%	0.808	S	S	*	*			trans	-99	103.7	157.9	-99.2	-32.8	0	0	0	106.6
148	D	43	Very low	39.1	Very low	232 Å²	232	166.5 Å²	166.5	100%	1.241	83%	0.832	S	S	*	*			trans	-172.5	0	147.3	-108	-53.1	0	0	0	108.3

Retrieved 148 of 148 residues in 30.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).