G4LWY9_SCHMA Loading...

Smp_204370

AlphaFold DB , UniProt , Accession G4LWY9, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 58 aa.

						>G4LWY9_SCHMA|G4LWY9
MVALMTVQHNRSYYRNIFARVVAKSRIYTLLYEFVHGVQLNDARWLSLTKIRELFDTE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	65.6	Low	83.6	Confident	189 Å²	189	116.4 Å²	116.4	93%	0.931	61%	0.608	S	S	*	*				0	-44.5	0	-151.7	163.6	-179	0	0	112.7	A3 L4 M5	M1-A3 PolarHBondContact O-N 2.98Å; M1-L4 PolarHBondContact O-N 3.34Å; M1-M5 HydrophobicContact CE-CE 4.1Å; M1-M5 HydrophobicContact CG-CE 4.22Å
2	V	76	Confident	83.9	Confident	115 Å²	115	112 Å²	112	70%	0.697	60%	0.595	S	S	*	*	H	α-helix	trans	-53.3	-45.7	179.8	-179.7	0	0	0	0	113.9	L4 M5 T6	V2-L4 VanDerWaalsContact C-N 3.33Å; V2-L4 PolarHBondContact O-N 3.25Å; V2-M5 PolarHBondContact O-N 2.91Å; V2-T6 PolarHBondContact O-N 2.91Å; V2-T6 VanDerWaalsContact O-N 3.07Å; V2-T6 PolarHBondContact O-OG1 2.94Å
3	A	82.6	Confident	84.1	Confident	75 Å²	75	113.4 Å²	113.4	62%	0.62	59%	0.588	S	S	*	*	H	α-helix	trans	-59.3	-39	-177.3	0	0	0	0	0	113.8	M1 T6 V7	M1-A3 PolarHBondContact O-N 2.98Å; A3-T6 PolarHBondContact O-N 3.11Å; A3-V7 VanDerWaalsContact O-CG2 3.3Å; A3-V7 WeakPolarHBondContact O-CG2 3.25Å; A3-V7 PolarHBondContact O-N 3.28Å
4	L	86	Confident	84.1	Confident	127 Å²	127	116.4 Å²	116.4	67%	0.665	59%	0.59	S	S	*	*	H	α-helix	trans	-67.6	-41	179	-75.4	164.9	0	0	0	111.7	M1 V2 V7 Q8	M1-L4 PolarHBondContact O-N 3.34Å; V2-L4 VanDerWaalsContact C-N 3.33Å; V2-L4 PolarHBondContact O-N 3.25Å; L4-V7 PolarHBondContact O-N 3.29Å; L4-Q8 WeakPolarHBondContact O-CG 3.45Å; L4-Q8 PolarHBondContact O-N 3.17Å
5	M	86.8	Confident	84.3	Confident	113 Å²	113	119.2 Å²	119.2	56%	0.557	59%	0.59	S	S	*	*	H	α-helix	trans	-62.8	-43.5	176.6	-68.2	177.5	174.9	0	0	111	M1 V2 V7 Q8 H9	M1-M5 HydrophobicContact CE-CE 4.1Å; M1-M5 HydrophobicContact CG-CE 4.22Å; V2-M5 PolarHBondContact O-N 2.91Å; M5-V7 PolarHBondContact O-N 3.48Å; M5-Q8 PolarHBondContact O-N 3.25Å; M5-H9 WeakPolarHBondContact O-CB 3.41Å; M5-H9 PolarHBondContact O-N 3.09Å
6	T	87.1	Confident	84.5	Confident	71 Å²	71	117.7 Å²	117.7	44%	0.436	59%	0.585	S	S	.	*	H	α-helix	trans	-62.2	-41.6	176.2	-52.9	0	0	0	0	112	V2 A3 H9 N10	V2-T6 PolarHBondContact O-N 2.91Å; V2-T6 VanDerWaalsContact O-N 3.07Å; V2-T6 PolarHBondContact O-OG1 2.94Å; A3-T6 PolarHBondContact O-N 3.11Å; T6-H9 PolarHBondContact O-N 3.38Å; T6-N10 WeakPolarHBondContact O-CB 3.43Å; T6-N10 VanDerWaalsContact O-CG 3.25Å; T6-N10 PolarHBondContact O-N 3.4Å
7	V	86.4	Confident	84.6	Confident	94 Å²	94	114.7 Å²	114.7	57%	0.57	57%	0.571	S	S	*	*	H	α-helix	trans	-63.8	-43.4	177	170.5	0	0	0	0	111.5	A3 L4 M5 N10 R11	A3-V7 VanDerWaalsContact O-CG2 3.3Å; A3-V7 WeakPolarHBondContact O-CG2 3.25Å; A3-V7 PolarHBondContact O-N 3.28Å; L4-V7 PolarHBondContact O-N 3.29Å; M5-V7 PolarHBondContact O-N 3.48Å; V7-N10 PolarHBondContact O-N 3.24Å; V7-R11 WeakPolarHBondContact O-CB 3.44Å; V7-R11 PolarHBondContact O-N 2.92Å
8	Q	87.7	Confident	84.4	Confident	140 Å²	140	116.4 Å²	116.4	65%	0.654	58%	0.575	S	S	*	*	H	α-helix	trans	-65.5	-42.3	177.1	-73.3	-177.9	-20.6	0	0	112.1	L4 M5 R11 S12	L4-Q8 WeakPolarHBondContact O-CG 3.45Å; L4-Q8 PolarHBondContact O-N 3.17Å; M5-Q8 PolarHBondContact O-N 3.25Å; Q8-R11 PolarHBondContact O-N 3.31Å; Q8-S12 PolarHBondContact O-N 3.06Å
9	H	87.4	Confident	84.4	Confident	127 Å²	127	113.3 Å²	113.3	59%	0.588	57%	0.569	S	S	*	*	H	α-helix	trans	-59.8	-50	175.4	-177.5	80.5	0	0	0	111.2	M5 T6 R11 S12 Y13	M5-H9 WeakPolarHBondContact O-CB 3.41Å; M5-H9 PolarHBondContact O-N 3.09Å; T6-H9 PolarHBondContact O-N 3.38Å; H9-R11 VanDerWaalsContact C-N 3.33Å; H9-R11 PolarHBondContact O-N 3.45Å; H9-S12 WeakPolarHBondContact O-CB 3.47Å; H9-S12 PolarHBondContact O-N 3.2Å; H9-Y13 WeakPolarHBondContact O-CB 3.47Å; H9-Y13 PolarHBondContact O-N 2.95Å
10	N	85.6	Confident	84.6	Confident	70 Å²	70	117.5 Å²	117.5	37%	0.374	58%	0.578	S	S	.	*	H	α-helix	trans	-61.4	-41.9	178.4	-72.4	-2.7	0	0	0	111.5	T6 V7 S12 Y13 Y14	T6-N10 WeakPolarHBondContact O-CB 3.43Å; T6-N10 VanDerWaalsContact O-CG 3.25Å; T6-N10 PolarHBondContact O-N 3.4Å; V7-N10 PolarHBondContact O-N 3.24Å; N10-S12 VanDerWaalsContact C-N 3.32Å; N10-S12 PolarHBondContact O-N 2.92Å; N10-Y13 WeakPolarHBondContact O-CB 3.34Å; N10-Y13 PolarHBondContact O-N 2.85Å; N10-Y14 HydrophobicContact CB-CD2 4.44Å; N10-Y14 HydrophobicContact CB-CE2 4.3Å; N10-Y14 WeakPolarHBondContact O-CD2 3.36Å; N10-Y14 PolarHBondContact O-N 3.39Å
11	R	88.1	Confident	84.7	Confident	159 Å²	159	116.1 Å²	116.1	60%	0.6	58%	0.576	S	S	*	*	H	α-helix	trans	-60.5	-41.8	176.8	-169.7	179.3	-170.1	-172.2	3.8	112	V7 Q8 H9 R15	V7-R11 WeakPolarHBondContact O-CB 3.44Å; V7-R11 PolarHBondContact O-N 2.92Å; Q8-R11 PolarHBondContact O-N 3.31Å; H9-R11 VanDerWaalsContact C-N 3.33Å; H9-R11 PolarHBondContact O-N 3.45Å; R11-R15 WeakPolarHBondContact O-CB 3.38Å; R11-R15 WeakPolarHBondContact O-CG 3.48Å; R11-R15 PolarHBondContact O-N 3.16Å; R11-R15 VanDerWaalsContact O-N 3.11Å
12	S	87.5	Confident	85.5	Confident	64 Å²	64	110.5 Å²	110.5	45%	0.448	55%	0.552	S	S	.	*	H	α-helix	trans	-65.7	-44.6	175.5	-172	0	0	0	0	111.6	Q8 H9 N10 Y14 R15 N16	Q8-S12 PolarHBondContact O-N 3.06Å; H9-S12 WeakPolarHBondContact O-CB 3.47Å; H9-S12 PolarHBondContact O-N 3.2Å; N10-S12 VanDerWaalsContact C-N 3.32Å; N10-S12 PolarHBondContact O-N 2.92Å; S12-Y14 PolarHBondContact O-N 3.39Å; S12-R15 PolarHBondContact O-N 3.25Å; S12-N16 PolarHBondContact O-N 2.96Å; S12-N16 PolarHBondContact O-ND2 3.47Å
13	Y	87.1	Confident	86	Confident	130 Å²	130	107.4 Å²	107.4	51%	0.51	54%	0.539	S	S	.	.	H	α-helix	trans	-56.9	-51.2	177.3	-179.2	-102.3	0	0	0	112.2	H9 N10 R15 N16 I17	H9-Y13 WeakPolarHBondContact O-CB 3.47Å; H9-Y13 PolarHBondContact O-N 2.95Å; N10-Y13 WeakPolarHBondContact O-CB 3.34Å; N10-Y13 PolarHBondContact O-N 2.85Å; Y13-R15 PolarHBondContact O-N 2.92Å; Y13-N16 PolarHBondContact O-N 2.87Å; Y13-I17 HydrophobicContact CD1-CD1 3.76Å; Y13-I17 HydrophobicContact CE1-CD1 3.24Å; Y13-I17 HydrophobicContact CE1-CG1 4.5Å; Y13-I17 HydrophobicContact CE2-CD1 4.11Å; Y13-I17 HydrophobicContact CG-CD1 4.38Å; Y13-I17 VanDerWaalsContact CZ-CD1 3.45Å; Y13-I17 WeakPolarHBondContact O-CG1 3.23Å; Y13-I17 PolarHBondContact O-N 3.41Å; Y13-I17 VanDerWaalsContact O-N 3.07Å
14	Y	83.9	Confident	86.1	Confident	155 Å²	155	110 Å²	110	61%	0.608	54%	0.536	S	S	*	.	H	α-helix	trans	-66.4	-36	178.7	-72.4	-64.7	0	0	0	113.2	N10 S12 I17 F18	N10-Y14 HydrophobicContact CB-CD2 4.44Å; N10-Y14 HydrophobicContact CB-CE2 4.3Å; N10-Y14 WeakPolarHBondContact O-CD2 3.36Å; N10-Y14 PolarHBondContact O-N 3.39Å; S12-Y14 PolarHBondContact O-N 3.39Å; Y14-I17 PolarHBondContact O-N 3.06Å; Y14-F18 WeakPolarHBondContact O-CB 3.4Å; Y14-F18 PolarHBondContact O-N 3.15Å
15	R	86	Confident	86	Confident	159 Å²	159	107.3 Å²	107.3	60%	0.6	53%	0.528	S	S	*	.	H	α-helix	trans	-62.6	-42.2	174.2	-80.8	-179.6	171.2	-159.5	-3.8	112.1	R11 S12 Y13 F18 A19	R11-R15 WeakPolarHBondContact O-CB 3.38Å; R11-R15 WeakPolarHBondContact O-CG 3.48Å; R11-R15 PolarHBondContact O-N 3.16Å; R11-R15 VanDerWaalsContact O-N 3.11Å; S12-R15 PolarHBondContact O-N 3.25Å; Y13-R15 PolarHBondContact O-N 2.92Å; R15-F18 PolarHBondContact O-N 3Å; R15-A19 WeakPolarHBondContact O-CB 3.29Å; R15-A19 PolarHBondContact O-N 2.93Å
16	N	87.7	Confident	86	Confident	95 Å²	95	110.7 Å²	110.7	51%	0.508	54%	0.535	S	S	.	.	H	α-helix	trans	-66.5	-40.4	178.2	-76	-23.5	0	0	0	112.1	S12 Y13 R20	S12-N16 PolarHBondContact O-N 2.96Å; S12-N16 PolarHBondContact O-ND2 3.47Å; Y13-N16 PolarHBondContact O-N 2.87Å; N16-R20 VanDerWaalsContact O-CG 3.31Å; N16-R20 WeakPolarHBondContact O-CG 3.26Å; N16-R20 PolarHBondContact O-N 3.37Å
17	I	87.1	Confident	85.9	Confident	67 Å²	67	112.2 Å²	112.2	34%	0.344	54%	0.539	S	S	.	.	H	α-helix	trans	-62	-48.3	173.7	-70.2	170.4	0	0	0	110.5	Y13 Y14 A19 R20 V21	Y13-I17 HydrophobicContact CD1-CD1 3.76Å; Y13-I17 HydrophobicContact CE1-CD1 3.24Å; Y13-I17 HydrophobicContact CE1-CG1 4.5Å; Y13-I17 HydrophobicContact CE2-CD1 4.11Å; Y13-I17 HydrophobicContact CG-CD1 4.38Å; Y13-I17 VanDerWaalsContact CZ-CD1 3.45Å; Y13-I17 WeakPolarHBondContact O-CG1 3.23Å; Y13-I17 PolarHBondContact O-N 3.41Å; Y13-I17 VanDerWaalsContact O-N 3.07Å; Y14-I17 PolarHBondContact O-N 3.06Å; I17-A19 PolarHBondContact O-N 3.35Å; I17-R20 WeakPolarHBondContact O-CB 3.37Å; I17-R20 PolarHBondContact O-N 2.93Å; I17-R20 VanDerWaalsContact O-N 3.16Å; I17-V21 HydrophobicContact CG2-CG2 4.37Å; I17-V21 WeakPolarHBondContact O-CG2 3.35Å; I17-V21 PolarHBondContact O-N 2.95Å
18	F	81.5	Confident	85.5	Confident	146 Å²	146	114.6 Å²	114.6	64%	0.64	54%	0.539	S	S	*	.	H	α-helix	trans	-59	-46.9	179.8	-176.6	-98.1	0	0	0	111.7	Y14 R15 R20 V21 V22	Y14-F18 WeakPolarHBondContact O-CB 3.4Å; Y14-F18 PolarHBondContact O-N 3.15Å; R15-F18 PolarHBondContact O-N 3Å; F18-R20 VanDerWaalsContact C-N 3.31Å; F18-R20 PolarHBondContact O-N 3.49Å; F18-V21 PolarHBondContact O-N 3.03Å; F18-V22 HydrophobicContact CD1-CG2 4.07Å; F18-V22 HydrophobicContact CE1-CG2 3.66Å; F18-V22 HydrophobicContact CE2-CG2 4.17Å; F18-V22 HydrophobicContact CG-CG2 4.49Å; F18-V22 HydrophobicContact CZ-CG2 3.71Å; F18-V22 WeakPolarHBondContact O-CG2 3.29Å; F18-V22 PolarHBondContact O-N 3.41Å
19	A	84.5	Confident	85.3	Confident	56 Å²	56	111.2 Å²	111.2	46%	0.463	53%	0.528	S	S	.	.	H	α-helix	trans	-58.3	-41.5	176.1	0	0	0	0	0	112.4	R15 I17 A23	R15-A19 WeakPolarHBondContact O-CB 3.29Å; R15-A19 PolarHBondContact O-N 2.93Å; I17-A19 PolarHBondContact O-N 3.35Å; A19-A23 VanDerWaalsContact O-CB 3.28Å; A19-A23 WeakPolarHBondContact O-CB 3.46Å; A19-A23 PolarHBondContact O-N 2.92Å
20	R	87	Confident	85.1	Confident	197 Å²	197	110 Å²	110	74%	0.743	53%	0.525	S	S	*	.	H	α-helix	trans	-64.5	-42.5	176.2	-74.1	175.5	178.5	-168.6	-0.2	112.5	N16 I17 F18 K24	N16-R20 VanDerWaalsContact O-CG 3.31Å; N16-R20 WeakPolarHBondContact O-CG 3.26Å; N16-R20 PolarHBondContact O-N 3.37Å; I17-R20 WeakPolarHBondContact O-CB 3.37Å; I17-R20 PolarHBondContact O-N 2.93Å; I17-R20 VanDerWaalsContact O-N 3.16Å; F18-R20 VanDerWaalsContact C-N 3.31Å; F18-R20 PolarHBondContact O-N 3.49Å; R20-K24 VanDerWaalsContact O-CB 3.31Å; R20-K24 WeakPolarHBondContact O-CB 3.37Å; R20-K24 PolarHBondContact O-N 3.01Å
21	V	86.1	Confident	85	Confident	89 Å²	89	111.4 Å²	111.4	54%	0.539	53%	0.532	S	S	.	.	H	α-helix	trans	-65.4	-45	178.3	172.7	0	0	0	0	110.9	I17 F18 K24 S25	I17-V21 HydrophobicContact CG2-CG2 4.37Å; I17-V21 WeakPolarHBondContact O-CG2 3.35Å; I17-V21 PolarHBondContact O-N 2.95Å; F18-V21 PolarHBondContact O-N 3.03Å; V21-K24 PolarHBondContact O-N 3.4Å; V21-S25 WeakPolarHBondContact O-CB 3.32Å; V21-S25 PolarHBondContact O-N 3.45Å
22	V	83.8	Confident	84.8	Confident	71 Å²	71	111 Å²	111	43%	0.43	53%	0.531	S	S	.	.	H	α-helix	trans	-63.9	-44.2	177.6	174.2	0	0	0	0	111.2	F18 K24 S25 R26	F18-V22 HydrophobicContact CD1-CG2 4.07Å; F18-V22 HydrophobicContact CE1-CG2 3.66Å; F18-V22 HydrophobicContact CE2-CG2 4.17Å; F18-V22 HydrophobicContact CG-CG2 4.49Å; F18-V22 HydrophobicContact CZ-CG2 3.71Å; F18-V22 WeakPolarHBondContact O-CG2 3.29Å; F18-V22 PolarHBondContact O-N 3.41Å; V22-K24 PolarHBondContact O-N 2.93Å; V22-S25 PolarHBondContact O-N 3.4Å; V22-R26 WeakPolarHBondContact O-CB 3.48Å; V22-R26 PolarHBondContact O-N 3.37Å
23	A	85.8	Confident	84.7	Confident	51 Å²	51	113.6 Å²	113.6	42%	0.421	54%	0.537	S	S	.	.	H	α-helix	trans	-60.7	-45.7	176.4	0	0	0	0	0	111.6	A19 R26 I27	A19-A23 VanDerWaalsContact O-CB 3.28Å; A19-A23 WeakPolarHBondContact O-CB 3.46Å; A19-A23 PolarHBondContact O-N 2.92Å; A23-R26 PolarHBondContact O-N 2.91Å; A23-I27 VanDerWaalsContact O-CG1 3.31Å; A23-I27 WeakPolarHBondContact O-CG1 3.27Å; A23-I27 PolarHBondContact O-N 3.49Å
24	K	85.4	Confident	84.6	Confident	129 Å²	129	114.3 Å²	114.3	56%	0.561	54%	0.542	S	S	*	.	H	α-helix	trans	-61.3	-45.9	176.9	-174.4	170.1	179.3	175.7	0	111.3	R20 V21 V22 R26 I27 Y28	R20-K24 VanDerWaalsContact O-CB 3.31Å; R20-K24 WeakPolarHBondContact O-CB 3.37Å; R20-K24 PolarHBondContact O-N 3.01Å; V21-K24 PolarHBondContact O-N 3.4Å; V22-K24 PolarHBondContact O-N 2.93Å; K24-R26 PolarHBondContact O-N 3.25Å; K24-I27 PolarHBondContact O-N 3.49Å; K24-Y28 HydrophobicContact CD-CE2 4.19Å; K24-Y28 HydrophobicContact CG-CD2 3.92Å; K24-Y28 HydrophobicContact CG-CE2 3.61Å; K24-Y28 WeakPolarHBondContact O-CD2 3.31Å; K24-Y28 PolarHBondContact O-N 2.96Å
25	S	84.3	Confident	84.6	Confident	70 Å²	70	110.3 Å²	110.3	49%	0.49	53%	0.534	S	S	.	.	H	α-helix	trans	-58.9	-45.9	177	-172.1	0	0	0	0	111.9	V21 V22 I27 Y28 T29	V21-S25 WeakPolarHBondContact O-CB 3.32Å; V21-S25 PolarHBondContact O-N 3.45Å; V22-S25 PolarHBondContact O-N 3.4Å; S25-I27 VanDerWaalsContact C-N 3.35Å; S25-I27 PolarHBondContact O-N 2.85Å; S25-Y28 WeakPolarHBondContact O-CB 3.41Å; S25-Y28 PolarHBondContact O-N 3.46Å; S25-Y28 VanDerWaalsContact O-N 3.14Å; S25-T29 PolarHBondContact O-N 3.38Å; S25-T29 PolarHBondContact O-OG1 3.26Å
26	R	85.7	Confident	84.4	Confident	185 Å²	185	106.1 Å²	106.1	70%	0.698	52%	0.521	S	S	*	.	H	α-helix	trans	-64.1	-38.3	178.8	-168.3	171.2	178.8	174.5	0.7	112.6	V22 A23 K24 T29 L30	V22-R26 WeakPolarHBondContact O-CB 3.48Å; V22-R26 PolarHBondContact O-N 3.37Å; A23-R26 PolarHBondContact O-N 2.91Å; K24-R26 PolarHBondContact O-N 3.25Å; R26-T29 PolarHBondContact O-N 2.87Å; R26-L30 HydrophobicContact CG-CD1 4.48Å; R26-L30 WeakPolarHBondContact O-CG 3.47Å; R26-L30 PolarHBondContact O-N 3.49Å
27	I	84.5	Confident	84.2	Confident	102 Å²	102	103 Å²	103	52%	0.523	51%	0.512	S	S	.	.	H	α-helix	trans	-63.2	-43.1	173.7	-68.3	165.3	0	0	0	110.4	A23 K24 S25 L30 L31	A23-I27 VanDerWaalsContact O-CG1 3.31Å; A23-I27 WeakPolarHBondContact O-CG1 3.27Å; A23-I27 PolarHBondContact O-N 3.49Å; K24-I27 PolarHBondContact O-N 3.49Å; S25-I27 VanDerWaalsContact C-N 3.35Å; S25-I27 PolarHBondContact O-N 2.85Å; I27-L30 PolarHBondContact O-N 2.92Å; I27-L31 HydrophobicContact CG2-CD1 3.88Å; I27-L31 HydrophobicContact CG2-CG 4.38Å; I27-L31 WeakPolarHBondContact O-CB 3.28Å; I27-L31 WeakPolarHBondContact O-CG 3.21Å; I27-L31 PolarHBondContact O-N 3.02Å
28	Y	78.9	Confident	84	Confident	145 Å²	145	102.6 Å²	102.6	57%	0.569	51%	0.512	S	S	*	.	H	α-helix	trans	-61.1	-44.4	175.3	-84.6	-71.4	0	0	0	112.4	K24 S25 L30 L31 Y32	K24-Y28 HydrophobicContact CD-CE2 4.19Å; K24-Y28 HydrophobicContact CG-CD2 3.92Å; K24-Y28 HydrophobicContact CG-CE2 3.61Å; K24-Y28 WeakPolarHBondContact O-CD2 3.31Å; K24-Y28 PolarHBondContact O-N 2.96Å; S25-Y28 WeakPolarHBondContact O-CB 3.41Å; S25-Y28 PolarHBondContact O-N 3.46Å; S25-Y28 VanDerWaalsContact O-N 3.14Å; Y28-L30 PolarHBondContact O-N 3.37Å; Y28-L31 PolarHBondContact O-N 3.42Å; Y28-Y32 VanDerWaalsContact O-CB 3.28Å; Y28-Y32 WeakPolarHBondContact O-CB 3.41Å; Y28-Y32 PolarHBondContact O-N 3.4Å
29	T	82.5	Confident	84	Confident	69 Å²	69	100.7 Å²	100.7	42%	0.423	51%	0.505	S	S	.	.	H	α-helix	trans	-59.8	-46.7	177	-54.1	0	0	0	0	111.4	S25 R26 L31 Y32 E33	S25-T29 PolarHBondContact O-N 3.38Å; S25-T29 PolarHBondContact O-OG1 3.26Å; R26-T29 PolarHBondContact O-N 2.87Å; T29-L31 PolarHBondContact O-N 3.02Å; T29-Y32 PolarHBondContact O-N 2.94Å; T29-E33 WeakPolarHBondContact O-CG 3.3Å; T29-E33 PolarHBondContact O-N 3.47Å
30	L	84.7	Confident	83.9	Confident	101 Å²	101	103.9 Å²	103.9	53%	0.529	51%	0.514	S	S	.	.	H	α-helix	trans	-63	-42	178.8	-71.5	171.2	0	0	0	112.4	R26 I27 Y28 F34	R26-L30 HydrophobicContact CG-CD1 4.48Å; R26-L30 WeakPolarHBondContact O-CG 3.47Å; R26-L30 PolarHBondContact O-N 3.49Å; I27-L30 PolarHBondContact O-N 2.92Å; Y28-L30 PolarHBondContact O-N 3.37Å; L30-F34 WeakPolarHBondContact O-CB 3.34Å; L30-F34 PolarHBondContact O-N 3.08Å
31	L	84	Confident	83.8	Confident	100 Å²	100	98.6 Å²	98.6	52%	0.524	50%	0.501	S	S	.	.	H	α-helix	trans	-65.6	-41.2	176.3	-72.8	172.1	0	0	0	111.5	I27 Y28 T29 F34 V35	I27-L31 HydrophobicContact CG2-CD1 3.88Å; I27-L31 HydrophobicContact CG2-CG 4.38Å; I27-L31 WeakPolarHBondContact O-CB 3.28Å; I27-L31 WeakPolarHBondContact O-CG 3.21Å; I27-L31 PolarHBondContact O-N 3.02Å; Y28-L31 PolarHBondContact O-N 3.42Å; T29-L31 PolarHBondContact O-N 3.02Å; L31-F34 PolarHBondContact O-N 3.36Å; L31-V35 WeakPolarHBondContact O-CB 3.33Å; L31-V35 VanDerWaalsContact O-CG2 3.26Å; L31-V35 WeakPolarHBondContact O-CG2 3.16Å; L31-V35 PolarHBondContact O-N 3.49Å
32	Y	82.7	Confident	83.6	Confident	150 Å²	150	98.6 Å²	98.6	59%	0.588	50%	0.498	S	S	*	.	H	α-helix	trans	-62.8	-47.9	177.9	-176.2	-92.2	0	0	0	111.5	Y28 T29 F34 V35 H36	Y28-Y32 VanDerWaalsContact O-CB 3.28Å; Y28-Y32 WeakPolarHBondContact O-CB 3.41Å; Y28-Y32 PolarHBondContact O-N 3.4Å; T29-Y32 PolarHBondContact O-N 2.94Å; Y32-F34 VanDerWaalsContact C-N 3.34Å; Y32-F34 PolarHBondContact O-N 2.94Å; Y32-V35 PolarHBondContact O-N 3.37Å; Y32-H36 AromaticContact CD1-CD2 3.65Å; Y32-H36 AromaticContact CD2-CD2 3.77Å; Y32-H36 AromaticContact CD2-NE2 3.97Å; Y32-H36 AromaticContact CE1-CD2 3.3Å; Y32-H36 WeakPolarHBondContact CE1-CD2 3.47Å; Y32-H36 AromaticContact CE1-NE2 3.64Å; Y32-H36 AromaticContact CE2-CD2 3.45Å; Y32-H36 VanDerWaalsContact CE2-CD2 3.45Å; Y32-H36 WeakPolarHBondContact CE2-CD2 3.41Å; Y32-H36 AromaticContact CE2-NE2 3.21Å; Y32-H36 WeakPolarHBondContact CE2-NE2 3.31Å; Y32-H36 AromaticContact CG-CD2 3.88Å; Y32-H36 AromaticContact CZ-CD2 3.21Å; Y32-H36 AromaticContact CZ-NE2 3.02Å; Y32-H36 WeakPolarHBondContact O-CB 3.45Å; Y32-H36 PolarHBondContact O-CD2 3.14Å; Y32-H36 PolarHBondContact O-N 3.01Å; Y32-H36 PolarHBondContact OH-NE2 2.93Å; Y32-H36 VanDerWaalsContact OH-NE2 3.08Å
33	E	85.4	Confident	83.5	Confident	119 Å²	119	98 Å²	98	56%	0.556	50%	0.5	S	S	*	.	H	α-helix	trans	-60.9	-41.7	176.3	-73.8	177.5	175.5	0	0	112	T29 G37	T29-E33 WeakPolarHBondContact O-CG 3.3Å; T29-E33 PolarHBondContact O-N 3.47Å; E33-G37 PolarHBondContact O-N 3.3Å
34	F	84.6	Confident	83.5	Confident	144 Å²	144	103.4 Å²	103.4	63%	0.632	51%	0.51	S	S	*	.	H	α-helix	trans	-63.7	-49.4	177.2	-176	-98.4	0	0	0	111.8	L30 L31 Y32 H36 G37 V38	L30-F34 WeakPolarHBondContact O-CB 3.34Å; L30-F34 PolarHBondContact O-N 3.08Å; L31-F34 PolarHBondContact O-N 3.36Å; Y32-F34 VanDerWaalsContact C-N 3.34Å; Y32-F34 PolarHBondContact O-N 2.94Å; F34-H36 PolarHBondContact O-N 3.35Å; F34-G37 PolarHBondContact O-N 2.89Å; F34-V38 HydrophobicContact CD1-CG2 4.29Å; F34-V38 HydrophobicContact CE1-CG2 3.92Å; F34-V38 HydrophobicContact CE2-CG2 4.43Å; F34-V38 HydrophobicContact CZ-CG2 4Å; F34-V38 WeakPolarHBondContact O-CG2 3.5Å; F34-V38 PolarHBondContact O-N 3.36Å
35	V	84.1	Confident	83.3	Confident	71 Å²	71	105.3 Å²	105.3	43%	0.43	51%	0.513	S	S	.	.	H	α-helix	trans	-62.6	-44.9	179.7	172.1	0	0	0	0	110.9	L31 Y32 G37 V38 Q39	L31-V35 WeakPolarHBondContact O-CB 3.33Å; L31-V35 VanDerWaalsContact O-CG2 3.26Å; L31-V35 WeakPolarHBondContact O-CG2 3.16Å; L31-V35 PolarHBondContact O-N 3.49Å; Y32-V35 PolarHBondContact O-N 3.37Å; V35-G37 VanDerWaalsContact C-N 3.35Å; V35-G37 PolarHBondContact O-N 2.95Å; V35-V38 PolarHBondContact O-N 3.07Å; V35-Q39 HydrophobicContact CG1-CG 4.49Å; V35-Q39 WeakPolarHBondContact O-CB 3.31Å; V35-Q39 WeakPolarHBondContact O-CG 3.42Å; V35-Q39 PolarHBondContact O-N 3.43Å
36	H	82.6	Confident	83.1	Confident	71 Å²	71	107.9 Å²	107.9	33%	0.329	52%	0.521	S	S	.	.	H	α-helix	trans	-64.2	-39	175.8	-89.9	-78.3	0	0	0	112.5	Y32 F34 Q39 L40	Y32-H36 AromaticContact CD1-CD2 3.65Å; Y32-H36 AromaticContact CD2-CD2 3.77Å; Y32-H36 AromaticContact CD2-NE2 3.97Å; Y32-H36 AromaticContact CE1-CD2 3.3Å; Y32-H36 WeakPolarHBondContact CE1-CD2 3.47Å; Y32-H36 AromaticContact CE1-NE2 3.64Å; Y32-H36 AromaticContact CE2-CD2 3.45Å; Y32-H36 VanDerWaalsContact CE2-CD2 3.45Å; Y32-H36 WeakPolarHBondContact CE2-CD2 3.41Å; Y32-H36 AromaticContact CE2-NE2 3.21Å; Y32-H36 WeakPolarHBondContact CE2-NE2 3.31Å; Y32-H36 AromaticContact CG-CD2 3.88Å; Y32-H36 AromaticContact CZ-CD2 3.21Å; Y32-H36 AromaticContact CZ-NE2 3.02Å; Y32-H36 WeakPolarHBondContact O-CB 3.45Å; Y32-H36 PolarHBondContact O-CD2 3.14Å; Y32-H36 PolarHBondContact O-N 3.01Å; Y32-H36 PolarHBondContact OH-NE2 2.93Å; Y32-H36 VanDerWaalsContact OH-NE2 3.08Å; F34-H36 PolarHBondContact O-N 3.35Å; H36-Q39 PolarHBondContact O-N 2.93Å; H36-L40 WeakPolarHBondContact O-CB 3.44Å; H36-L40 VanDerWaalsContact O-CG 3.27Å; H36-L40 WeakPolarHBondContact O-CG 3.28Å; H36-L40 PolarHBondContact O-N 2.94Å
37	G	82.9	Confident	82.9	Confident	31 Å²	31	101.7 Å²	101.7	32%	0.32	51%	0.506	S	S	.	.	H	α-helix	trans	-62.4	-43.4	175.7	0	0	0	0	0	112.6	E33 F34 V35 L40 N41	E33-G37 PolarHBondContact O-N 3.3Å; F34-G37 PolarHBondContact O-N 2.89Å; V35-G37 VanDerWaalsContact C-N 3.35Å; V35-G37 PolarHBondContact O-N 2.95Å; G37-L40 PolarHBondContact O-N 3.14Å; G37-N41 PolarHBondContact O-N 3.21Å
38	V	82.9	Confident	82.7	Confident	58 Å²	58	100.9 Å²	100.9	35%	0.352	50%	0.502	S	S	.	.	H	α-helix	trans	-63.4	-48.1	174.9	173.5	0	0	0	0	110.5	F34 V35 L40 N41 D42	F34-V38 HydrophobicContact CD1-CG2 4.29Å; F34-V38 HydrophobicContact CE1-CG2 3.92Å; F34-V38 HydrophobicContact CE2-CG2 4.43Å; F34-V38 HydrophobicContact CZ-CG2 4Å; F34-V38 WeakPolarHBondContact O-CG2 3.5Å; F34-V38 PolarHBondContact O-N 3.36Å; V35-V38 PolarHBondContact O-N 3.07Å; V38-L40 VanDerWaalsContact C-N 3.33Å; V38-L40 PolarHBondContact O-N 3.16Å; V38-N41 PolarHBondContact O-N 2.96Å; V38-N41 VanDerWaalsContact O-N 3.15Å; V38-D42 PolarHBondContact O-N 3.3Å
39	Q	81.2	Confident	83	Confident	105 Å²	105	97.2 Å²	97.2	49%	0.491	50%	0.495	S	S	.	.	H	α-helix	trans	-59.7	-40.8	178.2	-74.8	178.3	-18.4	0	0	113.1	V35 H36 A43	V35-Q39 HydrophobicContact CG1-CG 4.49Å; V35-Q39 WeakPolarHBondContact O-CB 3.31Å; V35-Q39 WeakPolarHBondContact O-CG 3.42Å; V35-Q39 PolarHBondContact O-N 3.43Å; H36-Q39 PolarHBondContact O-N 2.93Å; Q39-A43 VanDerWaalsContact O-CB 3.29Å; Q39-A43 WeakPolarHBondContact O-CB 3.49Å; Q39-A43 PolarHBondContact O-N 3.38Å
40	L	82.8	Confident	82.9	Confident	123 Å²	123	100.7 Å²	100.7	64%	0.644	50%	0.504	S	S	*	.	H	α-helix	trans	-66.8	-39.1	176.5	-74.4	171.9	0	0	0	111.9	H36 G37 V38 R44	H36-L40 WeakPolarHBondContact O-CB 3.44Å; H36-L40 VanDerWaalsContact O-CG 3.27Å; H36-L40 WeakPolarHBondContact O-CG 3.28Å; H36-L40 PolarHBondContact O-N 2.94Å; G37-L40 PolarHBondContact O-N 3.14Å; V38-L40 VanDerWaalsContact C-N 3.33Å; V38-L40 PolarHBondContact O-N 3.16Å; L40-R44 VanDerWaalsContact O-CB 3.29Å; L40-R44 WeakPolarHBondContact O-CB 3.36Å; L40-R44 PolarHBondContact O-N 3.47Å
41	N	84.4	Confident	82.7	Confident	87 Å²	87	99.9 Å²	99.9	47%	0.465	50%	0.5	S	S	.	.	H	α-helix	trans	-65.3	-46.7	174.9	-94.5	-21	0	0	0	111.4	G37 V38 A43 R44 W45	G37-N41 PolarHBondContact O-N 3.21Å; V38-N41 PolarHBondContact O-N 2.96Å; V38-N41 VanDerWaalsContact O-N 3.15Å; N41-A43 PolarHBondContact O-N 3.47Å; N41-R44 WeakPolarHBondContact O-CB 3.48Å; N41-R44 PolarHBondContact O-N 3.07Å; N41-R44 VanDerWaalsContact O-N 3.16Å; N41-W45 PolarHBondContact O-N 3.42Å
42	D	82.6	Confident	82.6	Confident	89 Å²	89	103.4 Å²	103.4	48%	0.476	51%	0.506	S	S	.	.	H	α-helix	trans	-62.2	-43.7	178.9	-68.7	-17.1	0	0	0	111.3	V38 R44 W45 L46	V38-D42 PolarHBondContact O-N 3.3Å; D42-R44 VanDerWaalsContact C-N 3.29Å; D42-R44 PolarHBondContact O-N 3.49Å; D42-W45 PolarHBondContact O-N 3.11Å; D42-L46 WeakPolarHBondContact O-CG 3.42Å; D42-L46 PolarHBondContact O-N 2.99Å
43	A	82.4	Confident	82.6	Confident	58 Å²	58	102.5 Å²	102.5	48%	0.479	51%	0.507	S	S	.	.	H	α-helix	trans	-61.8	-37.3	175.2	0	0	0	0	0	112.4	Q39 N41 S47	Q39-A43 VanDerWaalsContact O-CB 3.29Å; Q39-A43 WeakPolarHBondContact O-CB 3.49Å; Q39-A43 PolarHBondContact O-N 3.38Å; N41-A43 PolarHBondContact O-N 3.47Å; A43-S47 PolarHBondContact O-N 3.49Å
44	R	84.3	Confident	82.3	Confident	165 Å²	165	102.4 Å²	102.4	62%	0.623	51%	0.51	S	S	*	.	H	α-helix	trans	-70.1	-39	175.7	-176.5	179.9	175.7	-173.1	-1.1	112.2	L40 N41 D42 S47 L48	L40-R44 VanDerWaalsContact O-CB 3.29Å; L40-R44 WeakPolarHBondContact O-CB 3.36Å; L40-R44 PolarHBondContact O-N 3.47Å; N41-R44 WeakPolarHBondContact O-CB 3.48Å; N41-R44 PolarHBondContact O-N 3.07Å; N41-R44 VanDerWaalsContact O-N 3.16Å; D42-R44 VanDerWaalsContact C-N 3.29Å; D42-R44 PolarHBondContact O-N 3.49Å; R44-S47 PolarHBondContact O-N 3.3Å; R44-S47 PolarHBondContact O-OG 2.93Å; R44-L48 HydrophobicContact CG-CD1 4.37Å; R44-L48 WeakPolarHBondContact O-CG 3.32Å; R44-L48 PolarHBondContact O-N 3.39Å
45	W	81.8	Confident	82.1	Confident	168 Å²	168	102.8 Å²	102.8	64%	0.636	51%	0.511	S	S	*	.	H	α-helix	trans	-63.5	-45.5	174.9	-80.3	113.5	0	0	0	111.2	N41 D42 S47 L48 T49	N41-W45 PolarHBondContact O-N 3.42Å; D42-W45 PolarHBondContact O-N 3.11Å; W45-S47 VanDerWaalsContact C-N 3.31Å; W45-S47 PolarHBondContact O-N 2.91Å; W45-L48 PolarHBondContact O-N 2.88Å; W45-T49 WeakPolarHBondContact O-CG2 3.45Å; W45-T49 PolarHBondContact O-N 3.24Å; W45-T49 PolarHBondContact O-OG1 3.41Å
46	L	80.5	Confident	81.7	Confident	124 Å²	124	104.9 Å²	104.9	65%	0.649	52%	0.52	S	S	*	.	H	α-helix	trans	-61.7	-36.2	176.4	-73.3	168.2	0	0	0	113	D42 T49 K50	D42-L46 WeakPolarHBondContact O-CG 3.42Å; D42-L46 PolarHBondContact O-N 2.99Å; L46-T49 WeakPolarHBondContact CA-OG1 3.39Å; L46-T49 PolarHBondContact O-OG1 2.9Å; L46-K50 WeakPolarHBondContact O-CB 3.47Å; L46-K50 PolarHBondContact O-N 3.36Å; L46-K50 VanDerWaalsContact O-N 3.09Å
47	S	82	Confident	80.8	Confident	55 Å²	55	107 Å²	107	39%	0.385	54%	0.538	S	S	.	.	H	α-helix	trans	-70.9	-39.5	176.6	70.4	0	0	0	0	111.8	A43 R44 W45 K50 I51	A43-S47 PolarHBondContact O-N 3.49Å; R44-S47 PolarHBondContact O-N 3.3Å; R44-S47 PolarHBondContact O-OG 2.93Å; W45-S47 VanDerWaalsContact C-N 3.31Å; W45-S47 PolarHBondContact O-N 2.91Å; S47-K50 PolarHBondContact O-N 2.93Å; S47-I51 VanDerWaalsContact O-CG1 3.23Å; S47-I51 WeakPolarHBondContact O-CG1 3.37Å; S47-I51 PolarHBondContact O-N 3.18Å
48	L	80.4	Confident	79.3	Confident	85 Å²	85	117 Å²	117	45%	0.445	58%	0.577	S	S	.	*	H	α-helix	trans	-65.6	-40.6	176	-72.4	172.3	0	0	0	112.3	R44 W45 I51 R52	R44-L48 HydrophobicContact CG-CD1 4.37Å; R44-L48 WeakPolarHBondContact O-CG 3.32Å; R44-L48 PolarHBondContact O-N 3.39Å; W45-L48 PolarHBondContact O-N 2.88Å; L48-I51 PolarHBondContact O-N 2.92Å; L48-R52 WeakPolarHBondContact O-CB 3.07Å; L48-R52 PolarHBondContact O-N 3.44Å
49	T	84.9	Confident	79.1	Confident	69 Å²	69	120 Å²	120	42%	0.423	59%	0.588	S	S	.	*	H	α-helix	trans	-64.2	-43	175.1	53.5	0	0	0	0	111.1	W45 L46 I51 R52 E53	W45-T49 WeakPolarHBondContact O-CG2 3.45Å; W45-T49 PolarHBondContact O-N 3.24Å; W45-T49 PolarHBondContact O-OG1 3.41Å; L46-T49 WeakPolarHBondContact CA-OG1 3.39Å; L46-T49 PolarHBondContact O-OG1 2.9Å; T49-I51 VanDerWaalsContact C-N 3.35Å; T49-I51 PolarHBondContact O-N 3.01Å; T49-R52 WeakPolarHBondContact O-CB 3.44Å; T49-R52 PolarHBondContact O-N 3.4Å; T49-E53 WeakPolarHBondContact O-CG 3.3Å; T49-E53 PolarHBondContact O-N 3.46Å
50	K	80.6	Confident	79	Confident	141 Å²	141	120.7 Å²	120.7	61%	0.613	59%	0.593	S	S	*	*	H	α-helix	trans	-64	-38.2	177	-170	175.5	-176	177.8	0	112.7	L46 S47 L54	L46-K50 WeakPolarHBondContact O-CB 3.47Å; L46-K50 PolarHBondContact O-N 3.36Å; L46-K50 VanDerWaalsContact O-N 3.09Å; S47-K50 PolarHBondContact O-N 2.93Å; K50-L54 WeakPolarHBondContact O-CG 3.45Å; K50-L54 PolarHBondContact O-N 3.01Å
51	I	80.3	Confident	78.8	Confident	84 Å²	84	120.6 Å²	120.6	43%	0.431	59%	0.59	S	S	.	*	H	α-helix	trans	-65	-44.1	174.1	-70.2	165.1	0	0	0	110.1	S47 L48 T49 E53 L54 F55	S47-I51 VanDerWaalsContact O-CG1 3.23Å; S47-I51 WeakPolarHBondContact O-CG1 3.37Å; S47-I51 PolarHBondContact O-N 3.18Å; L48-I51 PolarHBondContact O-N 2.92Å; T49-I51 VanDerWaalsContact C-N 3.35Å; T49-I51 PolarHBondContact O-N 3.01Å; I51-E53 PolarHBondContact O-N 3.2Å; I51-L54 WeakPolarHBondContact O-CB 3.36Å; I51-L54 PolarHBondContact O-N 3.33Å; I51-F55 HydrophobicContact CG2-CD2 3.84Å; I51-F55 HydrophobicContact CG2-CE2 3.67Å; I51-F55 VanDerWaalsContact O-CD2 3.25Å; I51-F55 WeakPolarHBondContact O-CD2 3.39Å; I51-F55 PolarHBondContact O-N 3.07Å
52	R	81.9	Confident	78.5	Confident	175 Å²	175	122.6 Å²	122.6	66%	0.66	60%	0.597	S	S	*	*	H	α-helix	trans	-60.5	-44.6	177.3	-177.1	177.3	-179.8	170.3	4.2	112.2	L48 T49 L54 F55 D56	L48-R52 WeakPolarHBondContact O-CB 3.07Å; L48-R52 PolarHBondContact O-N 3.44Å; T49-R52 WeakPolarHBondContact O-CB 3.44Å; T49-R52 PolarHBondContact O-N 3.4Å; R52-L54 PolarHBondContact O-N 3.05Å; R52-F55 PolarHBondContact O-N 3.32Å; R52-F55 VanDerWaalsContact O-N 3.11Å; R52-D56 IonicContact NE-OD2 3.59Å; R52-D56 PolarHBondContact O-N 3.17Å
53	E	81.7	Confident	78.2	Confident	131 Å²	131	124.7 Å²	124.7	61%	0.612	61%	0.605	S	S	*	*	H	α-helix	trans	-58.1	-34.6	175.8	-75.4	172.9	-175.1	0	0	112.7	T49 I51 T57	T49-E53 WeakPolarHBondContact O-CG 3.3Å; T49-E53 PolarHBondContact O-N 3.46Å; I51-E53 PolarHBondContact O-N 3.2Å; E53-T57 PolarHBondContact O-OG1 3.3Å
54	L	80.2	Confident	77.9	Confident	116 Å²	116	129.1 Å²	129.1	61%	0.607	61%	0.613	S	S	*	*	H	α-helix	trans	-69.8	-33.3	176.7	-72.3	165.9	0	0	0	113.1	K50 I51 R52 T57	K50-L54 WeakPolarHBondContact O-CG 3.45Å; K50-L54 PolarHBondContact O-N 3.01Å; I51-L54 WeakPolarHBondContact O-CB 3.36Å; I51-L54 PolarHBondContact O-N 3.33Å; R52-L54 PolarHBondContact O-N 3.05Å; L54-T57 PolarHBondContact O-OG1 3.33Å
55	F	79.3	Confident	77.5	Confident	153 Å²	153	126.6 Å²	126.6	67%	0.671	61%	0.613	S	S	*	*	H	α-helix	trans	-84.1	-26.7	178.9	-77	-74.5	0	0	0	113.2	I51 R52 T57	I51-F55 HydrophobicContact CG2-CD2 3.84Å; I51-F55 HydrophobicContact CG2-CE2 3.67Å; I51-F55 VanDerWaalsContact O-CD2 3.25Å; I51-F55 WeakPolarHBondContact O-CD2 3.39Å; I51-F55 PolarHBondContact O-N 3.07Å; R52-F55 PolarHBondContact O-N 3.32Å; R52-F55 VanDerWaalsContact O-N 3.11Å; F55-T57 PolarHBondContact O-N 3.28Å
56	D	76.1	Confident	77.1	Confident	115 Å²	115	123.4 Å²	123.4	62%	0.615	61%	0.611	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.8	0.1	176	-75.5	-25.1	0	0	0	112.6	R52	R52-D56 IonicContact NE-OD2 3.59Å; R52-D56 PolarHBondContact O-N 3.17Å
57	T	63.2	Low	76.9	Confident	114 Å²	114	123.3 Å²	123.3	70%	0.699	61%	0.608	S	S	*	*	T	Hydrogen-bonded Turn	trans	-99.9	7.4	178.7	42.9	0	0	0	0	116	E53 L54 F55	E53-T57 PolarHBondContact O-OG1 3.3Å; L54-T57 PolarHBondContact O-OG1 3.33Å; F55-T57 PolarHBondContact O-N 3.28Å
58	E	51.6	Low	76.4	Confident	242 Å²	242	129.5 Å²	129.5	100%	1.131	63%	0.628	S	S	*	*			trans	-100.2	0	166.8	-74.9	-171.3	157.3	0	0	112

Retrieved 58 of 58 residues in 79.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).