G4LX46_SCHMA Loading...

COX6C domain-containing protein

AlphaFold DB , UniProt , Accession G4LX46, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 80 aa.

						>G4LX46_SCHMA|G4LX46
MDPAKLRNFRVGRALRAMGIATVVSTVVTGVVVYMYTKKEISTIRKFYHSYDPQLEWNVLLNSGILKTVNKDGSLVDLED
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	56.4	Low	64.6	Low	206 Å²	206	130.5 Å²	130.5	100%	1.015	64%	0.636	S	S	*	*				0	122	0	-156.4	174.8	-176.3	0	0	106.7	P3 L6	M1-P3 WeakPolarHBondContact O-CD 2.95Å; M1-L6 HydrophobicContact CE-CD2 4.26Å; M1-L6 HydrophobicContact SD-CD1 4.31Å
2	D	65.6	Low	65.6	Low	101 Å²	101	122.7 Å²	122.7	54%	0.54	61%	0.614	S	S	.	*			trans	-75.2	116.8	-167	-150.3	-13.5	0	0	0	111.1	A4 K5	D2-A4 PolarHBondContact O-N 3.38Å; D2-A4 VanDerWaalsContact O-N 3.13Å; D2-K5 HydrophobicContact CB-CD 4.45Å; D2-K5 WeakPolarHBondContact O-CB 3.33Å; D2-K5 PolarHBondContact O-N 3.35Å
3	P	67.8	Low	66.7	Low	100 Å²	100	126.2 Å²	126.2	65%	0.649	62%	0.616	S	S	*	*	H	α-helix	trans	-60.9	-26.9	-170	20.3	-31.7	0	0	0	113.7	M1 K5 L6 R7	M1-P3 WeakPolarHBondContact O-CD 2.95Å; P3-K5 VanDerWaalsContact C-N 3.31Å; P3-K5 PolarHBondContact O-N 3.38Å; P3-L6 PolarHBondContact O-N 3.46Å; P3-R7 PolarHBondContact O-N 2.83Å
4	A	67.2	Low	67.9	Low	62 Å²	62	120.8 Å²	120.8	51%	0.512	60%	0.602	S	S	.	*	H	α-helix	trans	-64	-33.4	174	0	0	0	0	0	113.1	D2	D2-A4 PolarHBondContact O-N 3.38Å; D2-A4 VanDerWaalsContact O-N 3.13Å
5	K	62.3	Low	69	Low	155 Å²	155	120.3 Å²	120.3	67%	0.674	60%	0.601	S	S	*	*	H	α-helix	trans	-70.1	-32.8	177.7	-82	179	175.2	172.5	0	112.2	D2 P3 F9	D2-K5 HydrophobicContact CB-CD 4.45Å; D2-K5 WeakPolarHBondContact O-CB 3.33Å; D2-K5 PolarHBondContact O-N 3.35Å; P3-K5 VanDerWaalsContact C-N 3.31Å; P3-K5 PolarHBondContact O-N 3.38Å; K5-F9 WeakPolarHBondContact O-CB 3.4Å; K5-F9 PolarHBondContact O-N 3.09Å; K5-F9 VanDerWaalsContact O-N 3.13Å
6	L	63.1	Low	70	Confident	103 Å²	103	125.1 Å²	125.1	54%	0.539	61%	0.61	S	S	.	*	H	α-helix	trans	-71.6	-37.8	178.5	-80.3	160.9	0	0	0	112.4	M1 P3 N8	M1-L6 HydrophobicContact CE-CD2 4.26Å; M1-L6 HydrophobicContact SD-CD1 4.31Å; P3-L6 PolarHBondContact O-N 3.46Å; L6-N8 PolarHBondContact O-N 2.89Å
7	R	63.2	Low	71	Confident	205 Å²	205	121.1 Å²	121.1	77%	0.774	60%	0.602	S	S	*	*	H	α-helix	trans	-64	-38.9	178.8	-166.5	171.7	76.4	-177.6	3.8	112.6	P3	P3-R7 PolarHBondContact O-N 2.83Å
8	N	63.8	Low	72	Confident	94 Å²	94	121.3 Å²	121.3	50%	0.503	60%	0.602	S	S	.	*	H	α-helix	trans	-97	-3.8	-176.4	-71.3	-12.1	0	0	0	114.2	L6 R10 V11 G12	L6-N8 PolarHBondContact O-N 2.89Å; N8-R10 VanDerWaalsContact C-N 3.3Å; N8-R10 PolarHBondContact O-N 2.67Å; N8-V11 PolarHBondContact O-N 3.47Å; N8-G12 PolarHBondContact O-N 2.84Å
9	F	63.1	Low	73	Confident	116 Å²	116	116.9 Å²	116.9	51%	0.509	59%	0.592	S	S	.	*	H	α-helix	trans	-61.3	-39.6	-176.7	-158.7	-106.1	0	0	0	112.6	K5 R13	K5-F9 WeakPolarHBondContact O-CB 3.4Å; K5-F9 PolarHBondContact O-N 3.09Å; K5-F9 VanDerWaalsContact O-N 3.13Å; F9-R13 PolarHBondContact O-N 3.26Å
10	R	65.6	Low	74	Confident	217 Å²	217	116.9 Å²	116.9	82%	0.819	59%	0.592	S	S	*	*	H	α-helix	trans	-71.1	-39.8	176.7	-67.7	-176.4	-177.5	176.6	0.5	111.7	N8 R13 A14	N8-R10 VanDerWaalsContact C-N 3.3Å; N8-R10 PolarHBondContact O-N 2.67Å; R10-R13 PolarHBondContact O-N 3.42Å; R10-A14 VanDerWaalsContact O-CB 3.29Å; R10-A14 WeakPolarHBondContact O-CB 3.41Å; R10-A14 PolarHBondContact O-N 3.01Å
11	V	72.8	Confident	74.9	Confident	77 Å²	77	114 Å²	114	47%	0.467	59%	0.586	S	S	.	*	H	α-helix	trans	-64.2	-45.1	-179.6	-176.7	0	0	0	0	111.1	N8 R13 A14 L15	N8-V11 PolarHBondContact O-N 3.47Å; V11-R13 PolarHBondContact O-N 3.29Å; V11-A14 PolarHBondContact O-N 3.4Å; V11-L15 HydrophobicContact CG1-CD1 4.09Å; V11-L15 HydrophobicContact CG1-CG 4.42Å; V11-L15 WeakPolarHBondContact O-CG 3.37Å; V11-L15 PolarHBondContact O-N 3.38Å
12	G	76.6	Confident	76.7	Confident	36 Å²	36	108.3 Å²	108.3	37%	0.371	56%	0.563	S	S	.	*	H	α-helix	trans	-63.8	-38.7	178.7	0	0	0	0	0	113.6	N8 R16	N8-G12 PolarHBondContact O-N 2.84Å; G12-R16 WeakPolarHBondContact O-CG 3.29Å; G12-R16 PolarHBondContact O-N 2.85Å
13	R	80.2	Confident	78.1	Confident	169 Å²	169	108 Å²	108	64%	0.638	57%	0.565	S	S	*	*	H	α-helix	trans	-69.2	-42.2	173.4	-75.5	-175.8	178.2	-179.8	-2.2	112	F9 R10 V11 R16 A17	F9-R13 PolarHBondContact O-N 3.26Å; R10-R13 PolarHBondContact O-N 3.42Å; V11-R13 PolarHBondContact O-N 3.29Å; R13-R16 PolarHBondContact O-N 3.45Å; R13-A17 WeakPolarHBondContact O-CB 3.33Å; R13-A17 PolarHBondContact O-N 3.03Å
14	A	82.3	Confident	79.4	Confident	50 Å²	50	107 Å²	107	41%	0.413	56%	0.557	S	S	.	*	H	α-helix	trans	-61.2	-44.9	177.9	0	0	0	0	0	111.8	R10 V11 R16 A17 M18	R10-A14 VanDerWaalsContact O-CB 3.29Å; R10-A14 WeakPolarHBondContact O-CB 3.41Å; R10-A14 PolarHBondContact O-N 3.01Å; V11-A14 PolarHBondContact O-N 3.4Å; A14-R16 VanDerWaalsContact C-N 3.34Å; A14-R16 PolarHBondContact O-N 2.88Å; A14-A17 PolarHBondContact O-N 2.83Å; A14-M18 WeakPolarHBondContact O-CB 3.47Å; A14-M18 WeakPolarHBondContact O-CG 3.45Å; A14-M18 PolarHBondContact O-N 3.26Å
15	L	85.2	Confident	80.8	Confident	113 Å²	113	107.4 Å²	107.4	59%	0.592	56%	0.555	S	S	*	*	H	α-helix	trans	-61.2	-40.8	177	-73.8	171.6	0	0	0	112.5	V11 M18 G19	V11-L15 HydrophobicContact CG1-CD1 4.09Å; V11-L15 HydrophobicContact CG1-CG 4.42Å; V11-L15 WeakPolarHBondContact O-CG 3.37Å; V11-L15 PolarHBondContact O-N 3.38Å; L15-M18 PolarHBondContact O-N 2.85Å; L15-G19 PolarHBondContact O-N 3.46Å
16	R	85.1	Confident	82.4	Confident	198 Å²	198	104.5 Å²	104.5	75%	0.747	55%	0.551	S	S	*	*	H	α-helix	trans	-65.4	-43.5	174.6	-72.5	-179	-176	178.3	0.7	111.9	G12 R13 A14 M18 G19 I20	G12-R16 WeakPolarHBondContact O-CG 3.29Å; G12-R16 PolarHBondContact O-N 2.85Å; R13-R16 PolarHBondContact O-N 3.45Å; A14-R16 VanDerWaalsContact C-N 3.34Å; A14-R16 PolarHBondContact O-N 2.88Å; R16-M18 VanDerWaalsContact C-N 3.34Å; R16-G19 PolarHBondContact O-N 2.97Å; R16-I20 WeakPolarHBondContact O-CG1 3.44Å; R16-I20 PolarHBondContact O-N 3.12Å
17	A	87.6	Confident	84	Confident	57 Å²	57	103.8 Å²	103.8	47%	0.471	55%	0.551	S	S	.	*	H	α-helix	trans	-62.4	-42.3	177	0	0	0	0	0	111.6	R13 A14 I20 A21	R13-A17 WeakPolarHBondContact O-CB 3.33Å; R13-A17 PolarHBondContact O-N 3.03Å; A14-A17 PolarHBondContact O-N 2.83Å; A17-I20 PolarHBondContact O-N 3.37Å; A17-A21 VanDerWaalsContact O-CB 3.31Å; A17-A21 WeakPolarHBondContact O-CB 3.5Å; A17-A21 PolarHBondContact O-N 3.48Å
18	M	88.9	Confident	85.6	Confident	124 Å²	124	98 Å²	98	61%	0.611	54%	0.537	S	S	*	.	H	α-helix	trans	-60.2	-46.5	173.3	-75	-179.5	69.3	0	0	111.5	A14 L15 R16 I20 A21 T22	A14-M18 WeakPolarHBondContact O-CB 3.47Å; A14-M18 WeakPolarHBondContact O-CG 3.45Å; A14-M18 PolarHBondContact O-N 3.26Å; L15-M18 PolarHBondContact O-N 2.85Å; R16-M18 VanDerWaalsContact C-N 3.34Å; M18-I20 VanDerWaalsContact C-N 3.33Å; M18-I20 PolarHBondContact O-N 3.25Å; M18-A21 PolarHBondContact O-N 3.05Å; M18-T22 PolarHBondContact O-N 3.22Å; M18-T22 PolarHBondContact O-OG1 2.91Å
19	G	91.1	Very high	87.1	Confident	39 Å²	39	97.1 Å²	97.1	40%	0.402	54%	0.536	S	S	.	.	H	α-helix	trans	-56.9	-46.7	176.9	0	0	0	0	0	112.4	L15 R16 T22 V23	L15-G19 PolarHBondContact O-N 3.46Å; R16-G19 PolarHBondContact O-N 2.97Å; G19-T22 PolarHBondContact O-N 3.25Å; G19-V23 WeakPolarHBondContact O-CG2 3.38Å; G19-V23 PolarHBondContact O-N 3.08Å; G19-V23 VanDerWaalsContact O-N 3.1Å
20	I	92.3	Very high	88.7	Confident	115 Å²	115	93.6 Å²	93.6	59%	0.59	53%	0.532	S	S	*	.	H	α-helix	trans	-63.8	-46.4	177.2	-65.2	165.6	0	0	0	110.8	R16 A17 M18 T22 V23 V24	R16-I20 WeakPolarHBondContact O-CG1 3.44Å; R16-I20 PolarHBondContact O-N 3.12Å; A17-I20 PolarHBondContact O-N 3.37Å; M18-I20 VanDerWaalsContact C-N 3.33Å; M18-I20 PolarHBondContact O-N 3.25Å; I20-T22 VanDerWaalsContact C-N 3.31Å; I20-T22 PolarHBondContact O-N 3.01Å; I20-V23 PolarHBondContact O-N 2.93Å; I20-V24 HydrophobicContact CG2-CG2 4.26Å; I20-V24 WeakPolarHBondContact O-CG2 3.31Å; I20-V24 PolarHBondContact O-N 3.46Å
21	A	92.7	Very high	90.2	Very high	57 Å²	57	86.8 Å²	86.8	47%	0.471	52%	0.515	S	S	.	.	H	α-helix	trans	-60.1	-41.6	179.6	0	0	0	0	0	111.8	A17 M18 V24 S25	A17-A21 VanDerWaalsContact O-CB 3.31Å; A17-A21 WeakPolarHBondContact O-CB 3.5Å; A17-A21 PolarHBondContact O-N 3.48Å; M18-A21 PolarHBondContact O-N 3.05Å; A21-V24 PolarHBondContact O-N 3.28Å; A21-S25 WeakPolarHBondContact O-CB 3.35Å; A21-S25 PolarHBondContact O-N 3.24Å
22	T	94.2	Very high	91.2	Very high	87 Å²	87	87.2 Å²	87.2	53%	0.534	52%	0.517	S	S	.	.	H	α-helix	trans	-62.2	-46.5	175.6	-59.1	0	0	0	0	111.3	M18 G19 I20 V24 S25 T26	M18-T22 PolarHBondContact O-N 3.22Å; M18-T22 PolarHBondContact O-OG1 2.91Å; G19-T22 PolarHBondContact O-N 3.25Å; I20-T22 VanDerWaalsContact C-N 3.31Å; I20-T22 PolarHBondContact O-N 3.01Å; T22-V24 PolarHBondContact O-N 2.7Å; T22-S25 PolarHBondContact O-N 2.87Å; T22-T26 WeakPolarHBondContact O-CB 3.39Å; T22-T26 PolarHBondContact O-N 3.33Å; T22-T26 PolarHBondContact O-OG1 3.37Å
23	V	95.2	Very high	92.1	Very high	94 Å²	94	89.4 Å²	89.4	57%	0.57	52%	0.523	S	S	*	.	H	α-helix	trans	-61.2	-47.9	178.4	172.7	0	0	0	0	110.8	G19 I20 S25 T26 V27	G19-V23 WeakPolarHBondContact O-CG2 3.38Å; G19-V23 PolarHBondContact O-N 3.08Å; G19-V23 VanDerWaalsContact O-N 3.1Å; I20-V23 PolarHBondContact O-N 2.93Å; V23-S25 PolarHBondContact O-N 3.42Å; V23-T26 PolarHBondContact O-N 3.46Å; V23-V27 VanDerWaalsContact O-CG2 3.32Å; V23-V27 WeakPolarHBondContact O-CG2 3.24Å; V23-V27 PolarHBondContact O-N 3.49Å
24	V	95.7	Very high	92.8	Very high	80 Å²	80	88.3 Å²	88.3	49%	0.485	52%	0.52	S	S	.	.	H	α-helix	trans	-62.1	-45.2	178.9	173.9	0	0	0	0	110.8	I20 A21 T22 T26 V27 V28	I20-V24 HydrophobicContact CG2-CG2 4.26Å; I20-V24 WeakPolarHBondContact O-CG2 3.31Å; I20-V24 PolarHBondContact O-N 3.46Å; A21-V24 PolarHBondContact O-N 3.28Å; T22-V24 PolarHBondContact O-N 2.7Å; V24-T26 PolarHBondContact O-N 2.63Å; V24-V27 PolarHBondContact O-N 3.2Å; V24-V28 HydrophobicContact CG1-CG2 4.26Å; V24-V28 VanDerWaalsContact O-CG2 3.3Å; V24-V28 WeakPolarHBondContact O-CG2 3.26Å; V24-V28 PolarHBondContact O-N 3.46Å
25	S	94.9	Very high	93.4	Very high	69 Å²	69	91.8 Å²	91.8	48%	0.483	53%	0.529	S	S	.	.	H	α-helix	trans	-60.6	-44.1	178.6	-176	0	0	0	0	112.1	A21 T22 V23 V27 V28 T29	A21-S25 WeakPolarHBondContact O-CB 3.35Å; A21-S25 PolarHBondContact O-N 3.24Å; T22-S25 PolarHBondContact O-N 2.87Å; V23-S25 PolarHBondContact O-N 3.42Å; S25-V27 PolarHBondContact O-N 2.97Å; S25-V28 PolarHBondContact O-N 2.92Å; S25-T29 VanDerWaalsContact O-CB 3.29Å; S25-T29 WeakPolarHBondContact O-CB 3.49Å; S25-T29 PolarHBondContact O-N 2.94Å; S25-T29 PolarHBondContact O-OG1 3.36Å
26	T	96.2	Very high	93.7	Very high	94 Å²	94	92.8 Å²	92.8	58%	0.577	53%	0.526	S	S	*	.	H	α-helix	trans	-62.7	-43.7	176.9	-60.3	0	0	0	0	111.5	T22 V23 V24 G30	T22-T26 WeakPolarHBondContact O-CB 3.39Å; T22-T26 PolarHBondContact O-N 3.33Å; T22-T26 PolarHBondContact O-OG1 3.37Å; V23-T26 PolarHBondContact O-N 3.46Å; V24-T26 PolarHBondContact O-N 2.63Å; T26-G30 PolarHBondContact O-N 3.26Å
27	V	96.8	Very high	93.9	Very high	89 Å²	89	86.1 Å²	86.1	54%	0.539	51%	0.507	S	S	.	.	H	α-helix	trans	-63.6	-48.5	178	171.9	0	0	0	0	110.8	V23 V24 S25 T29 G30 V31	V23-V27 VanDerWaalsContact O-CG2 3.32Å; V23-V27 WeakPolarHBondContact O-CG2 3.24Å; V23-V27 PolarHBondContact O-N 3.49Å; V24-V27 PolarHBondContact O-N 3.2Å; S25-V27 PolarHBondContact O-N 2.97Å; V27-T29 PolarHBondContact O-N 3.11Å; V27-G30 PolarHBondContact O-N 2.87Å; V27-V31 WeakPolarHBondContact O-CG2 3.43Å; V27-V31 PolarHBondContact O-N 2.59Å
28	V	96.8	Very high	93.9	Very high	82 Å²	82	89.3 Å²	89.3	50%	0.497	51%	0.511	S	S	.	.	H	α-helix	trans	-61.2	-47.1	179.5	171.9	0	0	0	0	110.6	V24 S25 G30 V31 V32	V24-V28 HydrophobicContact CG1-CG2 4.26Å; V24-V28 VanDerWaalsContact O-CG2 3.3Å; V24-V28 WeakPolarHBondContact O-CG2 3.26Å; V24-V28 PolarHBondContact O-N 3.46Å; S25-V28 PolarHBondContact O-N 2.92Å; V28-G30 VanDerWaalsContact C-N 3.34Å; V28-G30 PolarHBondContact O-N 3.13Å; V28-V31 PolarHBondContact O-N 3.3Å; V28-V32 HydrophobicContact CG1-CG2 4.45Å; V28-V32 WeakPolarHBondContact O-CG2 3.29Å; V28-V32 PolarHBondContact O-N 3.16Å
29	T	96.4	Very high	93.8	Very high	76 Å²	76	91.3 Å²	91.3	47%	0.466	52%	0.516	S	S	.	.	H	α-helix	trans	-60.3	-44.9	177.8	-56.3	0	0	0	0	110.9	S25 V27 V31 V32 V33	S25-T29 VanDerWaalsContact O-CB 3.29Å; S25-T29 WeakPolarHBondContact O-CB 3.49Å; S25-T29 PolarHBondContact O-N 2.94Å; S25-T29 PolarHBondContact O-OG1 3.36Å; V27-T29 PolarHBondContact O-N 3.11Å; T29-V31 VanDerWaalsContact C-N 3.34Å; T29-V31 PolarHBondContact O-N 3.22Å; T29-V32 PolarHBondContact O-N 3Å; T29-V33 HydrophobicContact CG2-CG2 4.24Å; T29-V33 WeakPolarHBondContact O-CB 3.31Å; T29-V33 VanDerWaalsContact O-CG2 3.3Å; T29-V33 WeakPolarHBondContact O-CG2 3.22Å; T29-V33 PolarHBondContact O-N 2.93Å
30	G	96.1	Very high	93.4	Very high	42 Å²	42	93.4 Å²	93.4	43%	0.433	52%	0.515	S	S	.	.	H	α-helix	trans	-59	-43	176.9	0	0	0	0	0	112.8	T26 V27 V28 Y34	T26-G30 PolarHBondContact O-N 3.26Å; V27-G30 PolarHBondContact O-N 2.87Å; V28-G30 VanDerWaalsContact C-N 3.34Å; V28-G30 PolarHBondContact O-N 3.13Å; G30-Y34 VanDerWaalsContact O-CB 3.24Å; G30-Y34 WeakPolarHBondContact O-CB 3.44Å; G30-Y34 PolarHBondContact O-N 3.49Å
31	V	96.3	Very high	92.9	Very high	75 Å²	75	92.4 Å²	92.4	46%	0.455	51%	0.51	S	S	.	.	H	α-helix	trans	-64.9	-45.9	176.9	171.6	0	0	0	0	111.4	V27 V28 T29 Y34 M35	V27-V31 WeakPolarHBondContact O-CG2 3.43Å; V27-V31 PolarHBondContact O-N 2.59Å; V28-V31 PolarHBondContact O-N 3.3Å; T29-V31 VanDerWaalsContact C-N 3.34Å; T29-V31 PolarHBondContact O-N 3.22Å; V31-Y34 PolarHBondContact O-N 2.61Å; V31-M35 HydrophobicContact CG1-CE 4.08Å; V31-M35 WeakPolarHBondContact O-CG 3.23Å; V31-M35 PolarHBondContact O-N 3.44Å
32	V	95.3	Very high	92.5	Very high	86 Å²	86	91.7 Å²	91.7	52%	0.521	50%	0.502	S	S	.	.	H	α-helix	trans	-62.2	-48.6	179.4	172	0	0	0	0	110.7	V28 T29 Y34 M35 Y36	V28-V32 HydrophobicContact CG1-CG2 4.45Å; V28-V32 WeakPolarHBondContact O-CG2 3.29Å; V28-V32 PolarHBondContact O-N 3.16Å; T29-V32 PolarHBondContact O-N 3Å; V32-Y34 VanDerWaalsContact C-N 3.33Å; V32-Y34 PolarHBondContact O-N 3.2Å; V32-M35 PolarHBondContact O-N 3.41Å; V32-Y36 WeakPolarHBondContact O-CB 3.2Å; V32-Y36 PolarHBondContact O-N 2.84Å
33	V	95.3	Very high	91.9	Very high	81 Å²	81	91.5 Å²	91.5	49%	0.491	50%	0.501	S	S	.	.	H	α-helix	trans	-61.9	-41.6	178.3	171.5	0	0	0	0	111	T29 Y36 T37	T29-V33 HydrophobicContact CG2-CG2 4.24Å; T29-V33 WeakPolarHBondContact O-CB 3.31Å; T29-V33 VanDerWaalsContact O-CG2 3.3Å; T29-V33 WeakPolarHBondContact O-CG2 3.22Å; T29-V33 PolarHBondContact O-N 2.93Å; V33-Y36 PolarHBondContact O-N 2.9Å; V33-T37 VanDerWaalsContact O-CB 3.24Å; V33-T37 WeakPolarHBondContact O-CB 3.4Å; V33-T37 PolarHBondContact O-N 3.43Å; V33-T37 PolarHBondContact O-OG1 2.96Å
34	Y	94.4	Very high	91.4	Very high	146 Å²	146	91.3 Å²	91.3	57%	0.573	50%	0.495	S	S	*	.	H	α-helix	trans	-61.6	-46.4	176.4	176.6	-98.3	0	0	0	111.7	G30 V31 V32 K38	G30-Y34 VanDerWaalsContact O-CB 3.24Å; G30-Y34 WeakPolarHBondContact O-CB 3.44Å; G30-Y34 PolarHBondContact O-N 3.49Å; V31-Y34 PolarHBondContact O-N 2.61Å; V32-Y34 VanDerWaalsContact C-N 3.33Å; V32-Y34 PolarHBondContact O-N 3.2Å; Y34-K38 HydrophobicContact CE1-CD 4.1Å; Y34-K38 VanDerWaalsContact O-CB 3.25Å; Y34-K38 WeakPolarHBondContact O-CB 3.5Å; Y34-K38 PolarHBondContact O-N 3.24Å
35	M	94.2	Very high	90.9	Very high	123 Å²	123	96.9 Å²	96.9	61%	0.606	51%	0.508	S	S	*	.	H	α-helix	trans	-63.3	-43.6	177.8	-73.8	-146.1	-86.5	0	0	112	V31 V32 K38 K39	V31-M35 HydrophobicContact CG1-CE 4.08Å; V31-M35 WeakPolarHBondContact O-CG 3.23Å; V31-M35 PolarHBondContact O-N 3.44Å; V32-M35 PolarHBondContact O-N 3.41Å; M35-K38 PolarHBondContact O-N 2.9Å; M35-K39 VanDerWaalsContact O-CB 3.31Å; M35-K39 WeakPolarHBondContact O-CB 3.23Å; M35-K39 PolarHBondContact O-N 3.43Å
36	Y	91.3	Very high	90.5	Very high	134 Å²	134	100.5 Å²	100.5	53%	0.525	52%	0.515	S	S	.	.	H	α-helix	trans	-63.5	-48.2	177.9	-169.2	-95.5	0	0	0	111.9	V32 V33 K38 K39 E40	V32-Y36 WeakPolarHBondContact O-CB 3.2Å; V32-Y36 PolarHBondContact O-N 2.84Å; V33-Y36 PolarHBondContact O-N 2.9Å; Y36-K38 VanDerWaalsContact C-N 3.34Å; Y36-K38 PolarHBondContact O-N 3.42Å; Y36-K39 PolarHBondContact O-N 3.38Å; Y36-E40 WeakPolarHBondContact CE1-OE2 3.25Å; Y36-E40 HydrophobicContact CE2-CG 4.2Å; Y36-E40 VanDerWaalsContact CE2-OE1 3.23Å; Y36-E40 WeakPolarHBondContact CE2-OE1 3.45Å; Y36-E40 PolarHBondContact O-N 3.12Å; Y36-E40 PolarHBondContact OH-OE1 3.12Å; Y36-E40 PolarHBondContact OH-OE2 2.91Å
37	T	89.5	Confident	90.1	Very high	58 Å²	58	101 Å²	101	36%	0.356	51%	0.509	S	S	.	.	I	π-helix	trans	-59.9	-44.3	177	-59.7	0	0	0	0	111.4	V33 K39 I41 S42	V33-T37 VanDerWaalsContact O-CB 3.24Å; V33-T37 WeakPolarHBondContact O-CB 3.4Å; V33-T37 PolarHBondContact O-N 3.43Å; V33-T37 PolarHBondContact O-OG1 2.96Å; T37-K39 PolarHBondContact O-N 2.9Å; T37-I41 HydrophobicContact CG2-CB 4.23Å; T37-I41 HydrophobicContact CG2-CD1 3.93Å; T37-I41 WeakPolarHBondContact O-CA 3.42Å; T37-I41 VanDerWaalsContact O-CB 3.3Å; T37-I41 WeakPolarHBondContact O-CB 3.44Å; T37-I41 PolarHBondContact O-N 2.93Å; T37-I41 VanDerWaalsContact O-N 3.12Å; T37-S42 PolarHBondContact O-N 3.36Å; T37-S42 VanDerWaalsContact O-N 3.12Å
38	K	89	Confident	89.6	Confident	125 Å²	125	104.1 Å²	104.1	54%	0.543	51%	0.512	S	S	.	.	I	π-helix	trans	-65.8	-39.4	178.3	-170.9	176.4	-178.8	177.7	0	111.6	Y34 M35 Y36 S42	Y34-K38 HydrophobicContact CE1-CD 4.1Å; Y34-K38 VanDerWaalsContact O-CB 3.25Å; Y34-K38 WeakPolarHBondContact O-CB 3.5Å; Y34-K38 PolarHBondContact O-N 3.24Å; M35-K38 PolarHBondContact O-N 2.9Å; Y36-K38 VanDerWaalsContact C-N 3.34Å; Y36-K38 PolarHBondContact O-N 3.42Å; K38-S42 WeakPolarHBondContact O-CB 3.32Å; K38-S42 PolarHBondContact O-OG 3.26Å
39	K	85.3	Confident	89.1	Confident	166 Å²	166	108.4 Å²	108.4	72%	0.722	53%	0.527	S	S	*	.	I	π-helix	trans	-77.3	-49.4	-176.7	-168.4	178.6	177.9	-174	0	112.5	M35 Y36 T37 T43	M35-K39 VanDerWaalsContact O-CB 3.31Å; M35-K39 WeakPolarHBondContact O-CB 3.23Å; M35-K39 PolarHBondContact O-N 3.43Å; Y36-K39 PolarHBondContact O-N 3.38Å; T37-K39 PolarHBondContact O-N 2.9Å; K39-T43 VanDerWaalsContact O-CB 3.22Å; K39-T43 WeakPolarHBondContact O-CB 3.43Å; K39-T43 PolarHBondContact O-OG1 2.84Å
40	E	84	Confident	88.7	Confident	83 Å²	83	109.5 Å²	109.5	39%	0.388	54%	0.537	S	S	.	.	I	π-helix	trans	-90.1	-57.2	-174.2	-65.6	-162.4	-179.6	0	0	111.8	Y36 S42 T43 I44	Y36-E40 WeakPolarHBondContact CE1-OE2 3.25Å; Y36-E40 HydrophobicContact CE2-CG 4.2Å; Y36-E40 VanDerWaalsContact CE2-OE1 3.23Å; Y36-E40 WeakPolarHBondContact CE2-OE1 3.45Å; Y36-E40 PolarHBondContact O-N 3.12Å; Y36-E40 PolarHBondContact OH-OE1 3.12Å; Y36-E40 PolarHBondContact OH-OE2 2.91Å; E40-S42 PolarHBondContact O-N 2.93Å; E40-T43 PolarHBondContact O-N 2.97Å; E40-I44 WeakPolarHBondContact O-CB 3.2Å; E40-I44 VanDerWaalsContact O-CG1 3.29Å; E40-I44 WeakPolarHBondContact O-CG1 3.5Å; E40-I44 PolarHBondContact O-N 3.48Å
41	I	81.1	Confident	88.3	Confident	93 Å²	93	111.3 Å²	111.3	48%	0.477	53%	0.532	S	S	.	.	I	π-helix	trans	-64.9	-42.4	-173	-61	174.7	0	0	0	110.5	T37 T43 R45	T37-I41 HydrophobicContact CG2-CB 4.23Å; T37-I41 HydrophobicContact CG2-CD1 3.93Å; T37-I41 WeakPolarHBondContact O-CA 3.42Å; T37-I41 VanDerWaalsContact O-CB 3.3Å; T37-I41 WeakPolarHBondContact O-CB 3.44Å; T37-I41 PolarHBondContact O-N 2.93Å; T37-I41 VanDerWaalsContact O-N 3.12Å; I41-T43 VanDerWaalsContact C-N 3.34Å; I41-T43 PolarHBondContact O-N 2.78Å; I41-R45 WeakPolarHBondContact O-CB 3.18Å; I41-R45 PolarHBondContact O-N 3.27Å
42	S	83.8	Confident	88	Confident	42 Å²	42	111.5 Å²	111.5	29%	0.294	53%	0.53	S	S	.	.	H	α-helix	trans	-67.4	-35.5	178.9	100.6	0	0	0	0	112.8	T37 K38 E40 K46	T37-S42 PolarHBondContact O-N 3.36Å; T37-S42 VanDerWaalsContact O-N 3.12Å; K38-S42 WeakPolarHBondContact O-CB 3.32Å; K38-S42 PolarHBondContact O-OG 3.26Å; E40-S42 PolarHBondContact O-N 2.93Å; S42-K46 WeakPolarHBondContact O-CB 3.36Å; S42-K46 VanDerWaalsContact O-CG 3.25Å; S42-K46 WeakPolarHBondContact O-CG 3.43Å; S42-K46 PolarHBondContact O-N 2.77Å
43	T	82.5	Confident	87.6	Confident	84 Å²	84	110.8 Å²	110.8	52%	0.515	53%	0.527	S	S	.	.	H	α-helix	trans	-71.2	-45.5	179.8	-58.4	0	0	0	0	110.8	K39 E40 I41 R45 K46 F47	K39-T43 VanDerWaalsContact O-CB 3.22Å; K39-T43 WeakPolarHBondContact O-CB 3.43Å; K39-T43 PolarHBondContact O-OG1 2.84Å; E40-T43 PolarHBondContact O-N 2.97Å; I41-T43 VanDerWaalsContact C-N 3.34Å; I41-T43 PolarHBondContact O-N 2.78Å; T43-R45 VanDerWaalsContact C-N 3.33Å; T43-R45 PolarHBondContact O-N 2.86Å; T43-K46 PolarHBondContact O-N 3.37Å; T43-F47 WeakPolarHBondContact O-CB 3.36Å; T43-F47 PolarHBondContact O-N 2.87Å
44	I	85.2	Confident	87.3	Confident	89 Å²	89	113.7 Å²	113.7	46%	0.456	54%	0.535	S	S	.	.	H	α-helix	trans	-60.8	-45	175.5	-68.3	169.2	0	0	0	110.2	E40 K46 F47 Y48	E40-I44 WeakPolarHBondContact O-CB 3.2Å; E40-I44 VanDerWaalsContact O-CG1 3.29Å; E40-I44 WeakPolarHBondContact O-CG1 3.5Å; E40-I44 PolarHBondContact O-N 3.48Å; I44-K46 VanDerWaalsContact C-N 3.33Å; I44-K46 PolarHBondContact O-N 3.45Å; I44-F47 WeakPolarHBondContact O-CB 3.24Å; I44-F47 PolarHBondContact O-N 3.48Å; I44-Y48 HydrophobicContact CG2-CD2 3.56Å; I44-Y48 HydrophobicContact CG2-CE2 3.43Å; I44-Y48 VanDerWaalsContact CG2-CE2 3.43Å; I44-Y48 VanDerWaalsContact O-CD2 3.23Å; I44-Y48 WeakPolarHBondContact O-CD2 3.3Å; I44-Y48 PolarHBondContact O-N 2.9Å
45	R	84.4	Confident	87.1	Confident	197 Å²	197	112 Å²	112	74%	0.743	54%	0.536	S	S	*	.	H	α-helix	trans	-62.5	-40.4	178.1	-164.7	178.3	-152.8	170.7	6.6	112.2	I41 T43 H49	I41-R45 WeakPolarHBondContact O-CB 3.18Å; I41-R45 PolarHBondContact O-N 3.27Å; T43-R45 VanDerWaalsContact C-N 3.33Å; T43-R45 PolarHBondContact O-N 2.86Å; R45-H49 WeakPolarHBondContact O-CB 3.25Å; R45-H49 PolarHBondContact O-N 3.01Å
46	K	86.8	Confident	86.9	Confident	146 Å²	146	110 Å²	110	64%	0.635	53%	0.525	S	S	*	.	H	α-helix	trans	-64.2	-45.5	174.7	-77.9	176.5	-177	-175.3	0	111.4	S42 T43 I44 Y48 H49 S50	S42-K46 WeakPolarHBondContact O-CB 3.36Å; S42-K46 VanDerWaalsContact O-CG 3.25Å; S42-K46 WeakPolarHBondContact O-CG 3.43Å; S42-K46 PolarHBondContact O-N 2.77Å; T43-K46 PolarHBondContact O-N 3.37Å; I44-K46 VanDerWaalsContact C-N 3.33Å; I44-K46 PolarHBondContact O-N 3.45Å; K46-Y48 PolarHBondContact O-N 3.28Å; K46-H49 PolarHBondContact O-N 2.88Å; K46-S50 PolarHBondContact O-N 2.86Å; K46-S50 VanDerWaalsContact O-N 3.11Å; K46-S50 PolarHBondContact O-OG 3.25Å; K46-S50 VanDerWaalsContact O-OG 3.08Å
47	F	87.3	Confident	86.7	Confident	104 Å²	104	108.8 Å²	108.8	46%	0.456	52%	0.519	S	S	.	.	H	α-helix	trans	-53.6	-56	176.1	176.1	-96.1	0	0	0	110.4	T43 I44 H49 S50 Y51	T43-F47 WeakPolarHBondContact O-CB 3.36Å; T43-F47 PolarHBondContact O-N 2.87Å; I44-F47 WeakPolarHBondContact O-CB 3.24Å; I44-F47 PolarHBondContact O-N 3.48Å; F47-H49 VanDerWaalsContact C-N 3.29Å; F47-H49 PolarHBondContact O-N 3.42Å; F47-S50 CarbonylContact O-C 3.57Å; F47-S50 PolarHBondContact O-N 3.49Å; F47-S50 VanDerWaalsContact O-N 3.13Å; F47-S50 PolarHBondContact O-OG 3.29Å; F47-Y51 AromaticContact CE1-CD2 3.66Å; F47-Y51 HydrophobicContact CE1-CD2 3.66Å; F47-Y51 HydrophobicContact CE1-CE2 4.18Å; F47-Y51 HydrophobicContact CE1-CG 4.15Å; F47-Y51 HydrophobicContact CE2-CD2 4.36Å; F47-Y51 AromaticContact CZ-CD2 3.53Å; F47-Y51 HydrophobicContact CZ-CD2 3.53Å; F47-Y51 AromaticContact CZ-CE2 3.97Å; F47-Y51 HydrophobicContact CZ-CE2 3.97Å; F47-Y51 HydrophobicContact CZ-CG 4.41Å; F47-Y51 WeakPolarHBondContact O-CA 3.3Å; F47-Y51 WeakPolarHBondContact O-CB 3.24Å; F47-Y51 PolarHBondContact O-N 3.41Å
48	Y	86.2	Confident	86.7	Confident	155 Å²	155	109.9 Å²	109.9	61%	0.608	52%	0.523	S	S	*	.	H	α-helix	trans	-65.4	-28	-179.4	-75.3	-64.1	0	0	0	114.3	I44 K46 S50	I44-Y48 HydrophobicContact CG2-CD2 3.56Å; I44-Y48 HydrophobicContact CG2-CE2 3.43Å; I44-Y48 VanDerWaalsContact CG2-CE2 3.43Å; I44-Y48 VanDerWaalsContact O-CD2 3.23Å; I44-Y48 WeakPolarHBondContact O-CD2 3.3Å; I44-Y48 PolarHBondContact O-N 2.9Å; K46-Y48 PolarHBondContact O-N 3.28Å; Y48-S50 VanDerWaalsContact C-N 3.34Å
49	H	86.9	Confident	86.6	Confident	172 Å²	172	108.3 Å²	108.3	80%	0.796	52%	0.523	S	S	*	.	H	α-helix	trans	-71	-31.7	175.7	-170.5	-69.5	0	0	0	112.4	R45 K46 F47	R45-H49 WeakPolarHBondContact O-CB 3.25Å; R45-H49 PolarHBondContact O-N 3.01Å; K46-H49 PolarHBondContact O-N 2.88Å; F47-H49 VanDerWaalsContact C-N 3.29Å; F47-H49 PolarHBondContact O-N 3.42Å
50	S	87.1	Confident	86.8	Confident	98 Å²	98	103 Å²	103	69%	0.685	50%	0.503	S	S	*	.	H	α-helix	trans	-98.7	0.2	176.1	57.5	0	0	0	0	113.7	K46 F47 Y48 D52	K46-S50 PolarHBondContact O-N 2.86Å; K46-S50 VanDerWaalsContact O-N 3.11Å; K46-S50 PolarHBondContact O-OG 3.25Å; K46-S50 VanDerWaalsContact O-OG 3.08Å; F47-S50 CarbonylContact O-C 3.57Å; F47-S50 PolarHBondContact O-N 3.49Å; F47-S50 VanDerWaalsContact O-N 3.13Å; F47-S50 PolarHBondContact O-OG 3.29Å; Y48-S50 VanDerWaalsContact C-N 3.34Å; S50-D52 PolarHBondContact O-N 2.92Å
51	Y	88.4	Confident	86.9	Confident	81 Å²	81	99.6 Å²	99.6	32%	0.318	49%	0.487	S	S	.	.			trans	-77.1	117.6	-173.7	176.5	-105.3	0	0	0	109.8	F47 P53 E56	F47-Y51 AromaticContact CE1-CD2 3.66Å; F47-Y51 HydrophobicContact CE1-CD2 3.66Å; F47-Y51 HydrophobicContact CE1-CE2 4.18Å; F47-Y51 HydrophobicContact CE1-CG 4.15Å; F47-Y51 HydrophobicContact CE2-CD2 4.36Å; F47-Y51 AromaticContact CZ-CD2 3.53Å; F47-Y51 HydrophobicContact CZ-CD2 3.53Å; F47-Y51 AromaticContact CZ-CE2 3.97Å; F47-Y51 HydrophobicContact CZ-CE2 3.97Å; F47-Y51 HydrophobicContact CZ-CG 4.41Å; F47-Y51 WeakPolarHBondContact O-CA 3.3Å; F47-Y51 WeakPolarHBondContact O-CB 3.24Å; F47-Y51 PolarHBondContact O-N 3.41Å; Y51-P53 HydrophobicContact CD1-CG 4Å; Y51-P53 HydrophobicContact CE1-CB 3.96Å; Y51-P53 HydrophobicContact CE1-CG 3.64Å; Y51-E56 HydrophobicContact CE2-CB 4.19Å; Y51-E56 HydrophobicContact CE2-CG 4.46Å; Y51-E56 VanDerWaalsContact CE2-OE2 3.26Å; Y51-E56 WeakPolarHBondContact CE2-OE2 3.3Å; Y51-E56 PolarHBondContact OH-OE2 3.43Å
52	D	89.1	Confident	87.1	Confident	79 Å²	79	100.3 Å²	100.3	42%	0.422	49%	0.492	S	S	.	.			trans	-105.6	105.9	171.6	-175.9	-21.6	0	0	0	108.6	S50 Q54 L55 E56	S50-D52 PolarHBondContact O-N 2.92Å; D52-Q54 VanDerWaalsContact C-N 3.26Å; D52-Q54 PolarHBondContact O-N 3.21Å; D52-Q54 WeakPolarHBondContact OD1-CB 3.29Å; D52-Q54 PolarHBondContact OD1-N 3.39Å; D52-L55 HydrophobicContact CB-CB 3.86Å; D52-L55 PolarHBondContact O-N 3.1Å; D52-L55 PolarHBondContact OD1-N 3.49Å; D52-E56 PolarHBondContact O-N 2.96Å
53	P	88.5	Confident	87.2	Confident	71 Å²	71	101.1 Å²	101.1	46%	0.461	50%	0.498	S	S	.	.	H	α-helix	trans	-60.6	-33.7	-179.8	-15.9	25	0	0	0	113	Y51 W57	Y51-P53 HydrophobicContact CD1-CG 4Å; Y51-P53 HydrophobicContact CE1-CB 3.96Å; Y51-P53 HydrophobicContact CE1-CG 3.64Å; P53-W57 VanDerWaalsContact O-CB 3.24Å; P53-W57 WeakPolarHBondContact O-CB 3.32Å; P53-W57 PolarHBondContact O-N 2.88Å
54	Q	89.1	Confident	87.1	Confident	142 Å²	142	99.6 Å²	99.6	66%	0.664	50%	0.499	S	S	*	.	H	α-helix	trans	-69.7	-40.6	179	-102.2	95.9	25.2	0	0	111	D52 W57 N58	D52-Q54 VanDerWaalsContact C-N 3.26Å; D52-Q54 PolarHBondContact O-N 3.21Å; D52-Q54 WeakPolarHBondContact OD1-CB 3.29Å; D52-Q54 PolarHBondContact OD1-N 3.39Å; Q54-W57 PolarHBondContact O-N 3.45Å; Q54-N58 VanDerWaalsContact O-CG 3.29Å; Q54-N58 PolarHBondContact O-N 2.83Å; Q54-N58 PolarHBondContact O-ND2 3.21Å
55	L	89.2	Confident	87.1	Confident	111 Å²	111	101.3 Å²	101.3	58%	0.581	51%	0.507	S	S	*	.	H	α-helix	trans	-64.1	-47	176.4	-168.8	80.6	0	0	0	110.8	D52 W57 N58 V59	D52-L55 HydrophobicContact CB-CB 3.86Å; D52-L55 PolarHBondContact O-N 3.1Å; D52-L55 PolarHBondContact OD1-N 3.49Å; L55-W57 VanDerWaalsContact C-N 3.33Å; L55-W57 PolarHBondContact O-N 3.37Å; L55-N58 PolarHBondContact O-N 3.41Å; L55-V59 WeakPolarHBondContact O-CG2 3.31Å; L55-V59 PolarHBondContact O-N 2.94Å
56	E	89.2	Confident	87	Confident	80 Å²	80	93.8 Å²	93.8	37%	0.374	48%	0.482	S	S	.	.	H	α-helix	trans	-61.4	-44	177.9	-168	-173.3	-132.9	0	0	111.1	Y51 D52 N58 V59 L60	Y51-E56 HydrophobicContact CE2-CB 4.19Å; Y51-E56 HydrophobicContact CE2-CG 4.46Å; Y51-E56 VanDerWaalsContact CE2-OE2 3.26Å; Y51-E56 WeakPolarHBondContact CE2-OE2 3.3Å; Y51-E56 PolarHBondContact OH-OE2 3.43Å; D52-E56 PolarHBondContact O-N 2.96Å; E56-N58 VanDerWaalsContact C-N 3.32Å; E56-N58 PolarHBondContact O-N 2.93Å; E56-V59 PolarHBondContact O-N 3.32Å; E56-V59 VanDerWaalsContact O-N 3.12Å; E56-L60 HydrophobicContact CG-CD1 4.07Å; E56-L60 HydrophobicContact CG-CG 4.33Å; E56-L60 WeakPolarHBondContact O-CB 3.35Å; E56-L60 WeakPolarHBondContact O-CG 3.19Å; E56-L60 PolarHBondContact O-N 3.4Å
57	W	88.2	Confident	86.6	Confident	109 Å²	109	95 Å²	95	41%	0.413	49%	0.487	S	S	.	.	H	α-helix	trans	-55.9	-45.8	175.2	178.9	-113.5	0	0	0	112.4	P53 Q54 L55 V59 L60 L61 L66 V69	P53-W57 VanDerWaalsContact O-CB 3.24Å; P53-W57 WeakPolarHBondContact O-CB 3.32Å; P53-W57 PolarHBondContact O-N 2.88Å; Q54-W57 PolarHBondContact O-N 3.45Å; L55-W57 VanDerWaalsContact C-N 3.33Å; L55-W57 PolarHBondContact O-N 3.37Å; W57-V59 VanDerWaalsContact C-N 3.35Å; W57-V59 PolarHBondContact O-N 3.36Å; W57-L60 PolarHBondContact O-N 3.27Å; W57-L61 HydrophobicContact CD2-CD1 4.3Å; W57-L61 HydrophobicContact CD2-CG 4.23Å; W57-L61 HydrophobicContact CG-CD1 4.36Å; W57-L61 HydrophobicContact CH2-CD2 4.3Å; W57-L61 HydrophobicContact CZ2-CD1 4.05Å; W57-L61 HydrophobicContact CZ2-CD2 3.81Å; W57-L61 HydrophobicContact CZ2-CG 3.96Å; W57-L61 WeakPolarHBondContact O-CB 3.45Å; W57-L61 WeakPolarHBondContact O-CG 3.47Å; W57-L61 PolarHBondContact O-N 2.99Å; W57-L66 HydrophobicContact CE3-CD1 4.19Å; W57-L66 HydrophobicContact CH2-CD1 3.76Å; W57-L66 HydrophobicContact CZ3-CD1 3.56Å; W57-V69 HydrophobicContact CH2-CB 4.49Å; W57-V69 HydrophobicContact CH2-CG1 4.43Å; W57-V69 HydrophobicContact CH2-CG2 4.08Å; W57-V69 HydrophobicContact CZ2-CG1 4.26Å
58	N	88.8	Confident	86.4	Confident	81 Å²	81	93.3 Å²	93.3	43%	0.433	49%	0.486	S	S	.	.	H	α-helix	trans	-65.2	-37.1	177.2	-73	-25.6	0	0	0	112.4	Q54 L55 E56 N62	Q54-N58 VanDerWaalsContact O-CG 3.29Å; Q54-N58 PolarHBondContact O-N 2.83Å; Q54-N58 PolarHBondContact O-ND2 3.21Å; L55-N58 PolarHBondContact O-N 3.41Å; E56-N58 VanDerWaalsContact C-N 3.32Å; E56-N58 PolarHBondContact O-N 2.93Å; N58-N62 WeakPolarHBondContact O-CB 3.37Å; N58-N62 PolarHBondContact O-N 3.43Å; N58-N62 PolarHBondContact O-ND2 2.91Å
59	V	88.4	Confident	86.1	Confident	91 Å²	91	86.7 Å²	86.7	55%	0.552	46%	0.461	S	S	*	.	H	α-helix	trans	-64.9	-44.5	174	172	0	0	0	0	110.3	L55 E56 W57 N62 S63	L55-V59 WeakPolarHBondContact O-CG2 3.31Å; L55-V59 PolarHBondContact O-N 2.94Å; E56-V59 PolarHBondContact O-N 3.32Å; E56-V59 VanDerWaalsContact O-N 3.12Å; W57-V59 VanDerWaalsContact C-N 3.35Å; W57-V59 PolarHBondContact O-N 3.36Å; V59-N62 PolarHBondContact O-N 3Å; V59-S63 VanDerWaalsContact O-CB 3.29Å; V59-S63 WeakPolarHBondContact O-CB 3.5Å; V59-S63 PolarHBondContact O-N 3.27Å
60	L	88.3	Confident	85.6	Confident	55 Å²	55	82.2 Å²	82.2	29%	0.288	44%	0.443	S	S	.	.	H	α-helix	trans	-63.8	-45.7	178.5	-71.2	171.1	0	0	0	111.9	E56 W57 N62 S63 L66	E56-L60 HydrophobicContact CG-CD1 4.07Å; E56-L60 HydrophobicContact CG-CG 4.33Å; E56-L60 WeakPolarHBondContact O-CB 3.35Å; E56-L60 WeakPolarHBondContact O-CG 3.19Å; E56-L60 PolarHBondContact O-N 3.4Å; W57-L60 PolarHBondContact O-N 3.27Å; L60-N62 PolarHBondContact O-N 2.95Å; L60-S63 PolarHBondContact O-N 3.47Å; L60-S63 PolarHBondContact O-OG 2.99Å; L60-L66 HydrophobicContact CB-CD1 3.93Å; L60-L66 HydrophobicContact CB-CG 4.24Å
61	L	86.6	Confident	85.2	Confident	12 Å²	12	84.1 Å²	84.1	6%	0.063	44%	0.439	C	S	.	.	H	α-helix	trans	-57.5	-47.8	174.1	-79	175.6	0	0	0	111.8	W57 S63 G64 L66 V69 N70	W57-L61 HydrophobicContact CD2-CD1 4.3Å; W57-L61 HydrophobicContact CD2-CG 4.23Å; W57-L61 HydrophobicContact CG-CD1 4.36Å; W57-L61 HydrophobicContact CH2-CD2 4.3Å; W57-L61 HydrophobicContact CZ2-CD1 4.05Å; W57-L61 HydrophobicContact CZ2-CD2 3.81Å; W57-L61 HydrophobicContact CZ2-CG 3.96Å; W57-L61 WeakPolarHBondContact O-CB 3.45Å; W57-L61 WeakPolarHBondContact O-CG 3.47Å; W57-L61 PolarHBondContact O-N 2.99Å; L61-S63 VanDerWaalsContact C-N 3.31Å; L61-S63 PolarHBondContact O-N 3.33Å; L61-G64 PolarHBondContact O-N 3.44Å; L61-L66 HydrophobicContact CD2-CD1 3.86Å; L61-L66 HydrophobicContact CG-CD1 4.13Å; L61-V69 HydrophobicContact CD2-CB 4.08Å; L61-V69 HydrophobicContact CD2-CG1 3.67Å; L61-N70 WeakPolarHBondContact CD2-O 3.47Å
62	N	85.7	Confident	84.7	Confident	107 Å²	107	87.3 Å²	87.3	57%	0.572	46%	0.462	S	S	*	.	H	α-helix	trans	-72.2	-25	-178.4	-74.4	-49.6	0	0	0	113.3	N58 V59 L60 G64	N58-N62 WeakPolarHBondContact O-CB 3.37Å; N58-N62 PolarHBondContact O-N 3.43Å; N58-N62 PolarHBondContact O-ND2 2.91Å; V59-N62 PolarHBondContact O-N 3Å; L60-N62 PolarHBondContact O-N 2.95Å; N62-G64 VanDerWaalsContact C-N 3.26Å; N62-G64 PolarHBondContact O-N 3.19Å
63	S	86.1	Confident	83.9	Confident	60 Å²	60	85.4 Å²	85.4	42%	0.42	46%	0.46	S	S	.	.	H	α-helix	trans	-68.7	-21.7	178.7	75.5	0	0	0	0	113.9	V59 L60 L61 I65	V59-S63 VanDerWaalsContact O-CB 3.29Å; V59-S63 WeakPolarHBondContact O-CB 3.5Å; V59-S63 PolarHBondContact O-N 3.27Å; L60-S63 PolarHBondContact O-N 3.47Å; L60-S63 PolarHBondContact O-OG 2.99Å; L61-S63 VanDerWaalsContact C-N 3.31Å; L61-S63 PolarHBondContact O-N 3.33Å; S63-I65 PolarHBondContact O-N 2.9Å; S63-I65 WeakPolarHBondContact OG-CB 3.35Å; S63-I65 PolarHBondContact OG-N 3.42Å
64	G	78.9	Confident	83.6	Confident	52 Å²	52	85.4 Å²	85.4	54%	0.536	46%	0.462	S	S	.	.	T	Hydrogen-bonded Turn	trans	72.5	9.4	-174.7	0	0	0	0	0	114.6	L61 N62 L66	L61-G64 PolarHBondContact O-N 3.44Å; N62-G64 VanDerWaalsContact C-N 3.26Å; N62-G64 PolarHBondContact O-N 3.19Å; G64-L66 VanDerWaalsContact C-N 3.3Å
65	I	85.1	Confident	83.1	Confident	124 Å²	124	85.6 Å²	85.6	64%	0.636	47%	0.467	S	S	*	.			trans	-68.6	-31.6	174.3	-76.4	171.9	0	0	0	111.5	S63 K67	S63-I65 PolarHBondContact O-N 2.9Å; S63-I65 WeakPolarHBondContact OG-CB 3.35Å; S63-I65 PolarHBondContact OG-N 3.42Å; I65-K67 PolarHBondContact O-N 3.31Å; I65-K67 VanDerWaalsContact O-N 3.09Å
66	L	82.3	Confident	82.6	Confident	40 Å²	40	82.6 Å²	82.6	21%	0.209	45%	0.453	C	S	.	.			trans	-74.4	101	-178.6	-61.7	176.8	0	0	0	109.8	W57 L60 L61 G64 T68 V69	W57-L66 HydrophobicContact CE3-CD1 4.19Å; W57-L66 HydrophobicContact CH2-CD1 3.76Å; W57-L66 HydrophobicContact CZ3-CD1 3.56Å; L60-L66 HydrophobicContact CB-CD1 3.93Å; L60-L66 HydrophobicContact CB-CG 4.24Å; L61-L66 HydrophobicContact CD2-CD1 3.86Å; L61-L66 HydrophobicContact CG-CD1 4.13Å; G64-L66 VanDerWaalsContact C-N 3.3Å; L66-T68 VanDerWaalsContact C-N 3.31Å; L66-V69 HydrophobicContact CB-CB 4.34Å
67	K	79.8	Confident	81.9	Confident	172 Å²	172	84.3 Å²	84.3	75%	0.748	47%	0.465	S	S	*	.	S	Bend	trans	-70.9	-29.1	175.2	-64.6	-172	178.4	-173.8	0	112.9	I65 L78	I65-K67 PolarHBondContact O-N 3.31Å; I65-K67 VanDerWaalsContact O-N 3.09Å; K67-L78 HydrophobicContact CB-CD2 4.4Å; K67-L78 WeakPolarHBondContact O-CD2 3.45Å
68	T	82.5	Confident	81.2	Confident	68 Å²	68	84.2 Å²	84.2	42%	0.417	47%	0.472	S	S	.	.	S	Bend	trans	-83.6	-11.7	-176.6	49.7	0	0	0	0	113.2	L66 L75 V76 L78	L66-T68 VanDerWaalsContact C-N 3.31Å; T68-L75 CarbonylContact O-C 3.5Å; T68-L75 VanDerWaalsContact O-CA 3.31Å; T68-L75 WeakPolarHBondContact O-CA 3.38Å; T68-V76 PolarHBondContact O-N 2.95Å; T68-L78 HydrophobicContact CG2-CD1 3.77Å
69	V	78.9	Confident	80.5	Confident	16 Å²	16	89 Å²	89	10%	0.097	49%	0.492	C	S	.	.	B	Isolated β-bridge	trans	-139.3	125.2	-172.7	-162.1	0	0	0	0	110.3	W57 L61 L66 G73 S74 L75	W57-V69 HydrophobicContact CH2-CB 4.49Å; W57-V69 HydrophobicContact CH2-CG1 4.43Å; W57-V69 HydrophobicContact CH2-CG2 4.08Å; W57-V69 HydrophobicContact CZ2-CG1 4.26Å; L61-V69 HydrophobicContact CD2-CB 4.08Å; L61-V69 HydrophobicContact CD2-CG1 3.67Å; L66-V69 HydrophobicContact CB-CB 4.34Å; V69-G73 WeakPolarHBondContact CG1-O 3.39Å; V69-S74 CarbonylContact C-O 3.59Å; V69-S74 WeakPolarHBondContact CA-O 3.29Å; V69-S74 WeakPolarHBondContact CG1-O 3.47Å; V69-L75 HydrophobicContact CG2-CD2 4.26Å
70	N	77.7	Confident	78.9	Confident	78 Å²	78	94.8 Å²	94.8	42%	0.417	52%	0.519	S	S	.	.			trans	-67.4	163.5	173.9	-76.2	-28.3	0	0	0	111.2	L61 D72 G73 S74 V76	L61-N70 WeakPolarHBondContact CD2-O 3.47Å; N70-D72 PolarHBondContact O-N 3.46Å; N70-G73 PolarHBondContact O-N 3.39Å; N70-S74 PolarHBondContact N-O 3.33Å; N70-V76 HydrophobicContact CB-CG2 4.14Å; N70-V76 WeakPolarHBondContact OD1-CG2 3.34Å
71	K	77.7	Confident	78.5	Confident	138 Å²	138	96.8 Å²	96.8	60%	0.6	53%	0.531	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55.6	-23.9	177.8	-68.4	-174.3	177.2	-179.2	0	114	G73	K71-G73 VanDerWaalsContact C-N 3.26Å; K71-G73 PolarHBondContact O-N 3.13Å
72	D	78.6	Confident	78.1	Confident	148 Å²	148	101.3 Å²	101.3	79%	0.791	56%	0.556	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.4	4.9	177	-52.7	-42.8	0	0	0	113.3	N70 S74	N70-D72 PolarHBondContact O-N 3.46Å; D72-S74 VanDerWaalsContact C-N 3.28Å; D72-S74 PolarHBondContact O-N 3.43Å
73	G	73.2	Confident	77.6	Confident	38 Å²	38	100.9 Å²	100.9	39%	0.392	56%	0.555	S	S	.	*	S	Bend	trans	79.8	4.4	179.1	0	0	0	0	0	114.9	V69 N70 K71	V69-G73 WeakPolarHBondContact CG1-O 3.39Å; N70-G73 PolarHBondContact O-N 3.39Å; K71-G73 VanDerWaalsContact C-N 3.26Å; K71-G73 PolarHBondContact O-N 3.13Å
74	S	80.8	Confident	77.1	Confident	71 Å²	71	103.4 Å²	103.4	50%	0.497	56%	0.563	S	S	.	*	P	Polyproline II helix	trans	-86.5	142	177.7	-58.1	0	0	0	0	111.3	V69 N70 D72	V69-S74 CarbonylContact C-O 3.59Å; V69-S74 WeakPolarHBondContact CA-O 3.29Å; V69-S74 WeakPolarHBondContact CG1-O 3.47Å; N70-S74 PolarHBondContact N-O 3.33Å; D72-S74 VanDerWaalsContact C-N 3.28Å; D72-S74 PolarHBondContact O-N 3.43Å
75	L	80.1	Confident	77	Confident	146 Å²	146	106.6 Å²	106.6	76%	0.764	56%	0.564	S	S	*	*	B	Isolated β-bridge	trans	-62.6	137.5	176.2	-69.1	165.1	0	0	0	110.4	T68 V69	T68-L75 CarbonylContact O-C 3.5Å; T68-L75 VanDerWaalsContact O-CA 3.31Å; T68-L75 WeakPolarHBondContact O-CA 3.38Å; V69-L75 HydrophobicContact CG2-CD2 4.26Å
76	V	78.7	Confident	76.5	Confident	49 Å²	49	105.4 Å²	105.4	30%	0.297	56%	0.56	S	S	.	*	P	Polyproline II helix	trans	-96.6	128.8	172.1	-162.2	0	0	0	0	107.2	T68 N70 L78	T68-V76 PolarHBondContact O-N 2.95Å; N70-V76 HydrophobicContact CB-CG2 4.14Å; N70-V76 WeakPolarHBondContact OD1-CG2 3.34Å; V76-L78 PolarHBondContact O-N 3.13Å
77	D	73.9	Confident	76.1	Confident	115 Å²	115	110.1 Å²	110.1	62%	0.615	59%	0.585	S	S	*	*	P	Polyproline II helix	trans	-70.1	122.8	169.5	-144.7	-23.3	0	0	0	108.4	E79	D77-E79 VanDerWaalsContact C-N 3.31Å
78	L	73.1	Confident	75.8	Confident	108 Å²	108	105.3 Å²	105.3	57%	0.565	57%	0.572	S	S	*	*	S	Bend	trans	-91	0.4	-174.5	-70.9	177.8	0	0	0	112.3	K67 T68 V76	K67-L78 HydrophobicContact CB-CD2 4.4Å; K67-L78 WeakPolarHBondContact O-CD2 3.45Å; T68-L78 HydrophobicContact CG2-CD1 3.77Å; V76-L78 PolarHBondContact O-N 3.13Å
79	E	73.4	Confident	75.2	Confident	182 Å²	182	108.4 Å²	108.4	85%	0.85	59%	0.585	S	S	*	*			trans	-97.9	-6.2	-173.9	-61.8	-169.3	167.6	0	0	114.1	D77	D77-E79 VanDerWaalsContact C-N 3.31Å
80	D	56.5	Low	74.9	Confident	212 Å²	212	116.8 Å²	116.8	100%	1.134	63%	0.629	S	S	*	*			trans	-86.3	0	170.9	-84.8	-16.8	0	0	0	112.5

Retrieved 80 of 80 residues in 17.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).